Summary

Q6ZUS6

Homolog: Q0VCP9.
Function: Coiled-coil domain-containing protein 149.

Statistics

Total GO Annotation: 243
Unique PROST Go: 237
Unique BLAST Go: 5

Total Homologs: 207
Unique PROST Homologs: 199
Unique BLAST Homologs: 3

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q0VCP9 (Coiled-coil domain-containing protein 149) with a FATCAT P-Value: 1.38e-13 and RMSD of 2.52 angstrom. The sequence alignment identity is 61.5%.
Structural alignment shown in left. Query protein Q6ZUS6 colored as red in alignment, homolog Q0VCP9 colored as blue. Query protein Q6ZUS6 is also shown in right top, homolog Q0VCP9 showed in right bottom. They are colored based on secondary structures. 

  Q6ZUS6 MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKLLRMTIAKQRLGDEAIGVRHFAAHEREDLVQ 100
  Q0VCP9 MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKLLRMTIAKQRLGDEEIGVRHFAAHEREDLVQ 100

  Q6ZUS6 QLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERLNQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSK 200
  Q0VCP9 QLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERLNQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSK 200

  Q6ZUS6 GQGKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKLRTLEVSGLWSLPGGKDTILF 300
  Q0VCP9 GQNKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKLRTLEVSGLWSLPG-----LS 295

  Q6ZUS6 SDPTLPSGQRSRSPLLKF-------VEQPTENKADPKDGEAQKQEEDESCAAAEALTAPEDAGRPAVNSPANQSRGNQCKLFHPSLPQLPSEEEVNSLGR 393
  Q0VCP9 YNVSIGFGSMF---FLKYLCLWLIAVH------------------------------------------------------------------------- 319

  Q6ZUS6 EIIKLTKEQAAAELEEVRRESPIEGQRSETGPAPPGLAIQGELPKSHLDSFEASRPAAKASTPEDGKGIPEGGGMRSTVKT 474
  Q0VCP9 --------------------------------------------------------------------------------- 319

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0051301 cell division
2. P GO:0140278 mitotic division septum assembly
2. P GO:0097539 ciliary transition fiber
2. P GO:0008090 retrograde axonal transport
2. P GO:0050772 positive regulation of axonogenesis
2. P GO:1901970 positive regulation of mitotic sister chromatid separation
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:0051081 nuclear membrane disassembly
2. P GO:0051028 mRNA transport
2. P GO:0030705 cytoskeleton-dependent intracellular transport
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0019904 protein domain specific binding
2. P GO:0043296 apical junction complex
2. P GO:0007060 male meiosis chromosome segregation
2. P GO:0005874 microtubule
2. P GO:1905561 positive regulation of kinetochore assembly
2. P GO:0007530 sex determination
2. P GO:0048469 cell maturation
2. P GO:0048311 mitochondrion distribution
2. P GO:0051898 negative regulation of protein kinase B signaling
2. P GO:0005080 protein kinase C binding
2. P GO:0008286 insulin receptor signaling pathway
2. P GO:0047496 vesicle transport along microtubule
2. P GO:0033693 neurofilament bundle assembly
2. P GO:1903251 multi-ciliated epithelial cell differentiation
2. P GO:0099182 presynaptic intermediate filament cytoskeleton
2. P GO:0035020 regulation of Rac protein signal transduction
2. P GO:0061163 endoplasmic reticulum polarization
2. P GO:0007399 nervous system development
2. P GO:0000132 establishment of mitotic spindle orientation
2. P GO:1902513 regulation of organelle transport along microtubule
2. P GO:0030424 axon
2. P GO:0045109 intermediate filament organization
2. P GO:0034451 centriolar satellite
2. P GO:0007265 Ras protein signal transduction
2. P GO:0007409 axonogenesis
2. P GO:1902254 negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator
2. P GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
2. P GO:0005543 phospholipid binding
2. P GO:0038007 netrin-activated signaling pathway
2. P GO:0019894 kinesin binding
2. P GO:0030426 growth cone
2. P GO:0044877 protein-containing complex binding
2. P GO:0007030 Golgi organization
2. P GO:0008017 microtubule binding
2. P GO:0005929 cilium
2. P GO:0007020 microtubule nucleation
2. P GO:0098972 anterograde dendritic transport of mitochondrion
2. P GO:0008021 synaptic vesicle
2. P GO:0007405 neuroblast proliferation
2. P GO:1900029 positive regulation of ruffle assembly
2. P GO:0098535 de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P GO:0042110 T cell activation
2. P GO:0048487 beta-tubulin binding
2. P GO:0009832 plant-type cell wall biogenesis
2. P GO:0070012 oligopeptidase activity
2. P GO:0007097 nuclear migration
2. P GO:0007059 chromosome segregation
2. P GO:2001224 positive regulation of neuron migration
2. P GO:0048749 compound eye development
2. P GO:1905349 ciliary transition zone assembly
2. P GO:0010005 cortical microtubule, transverse to long axis
2. P GO:0031133 regulation of axon diameter
2. P GO:0090630 activation of GTPase activity
2. P GO:0005815 microtubule organizing center
2. P GO:0099160 postsynaptic intermediate filament cytoskeleton
2. P GO:0035567 non-canonical Wnt signaling pathway
2. P GO:0005212 structural constituent of eye lens
2. P GO:0060053 neurofilament cytoskeleton
2. P GO:0048403 brain-derived neurotrophic factor binding
2. P GO:0032839 dendrite cytoplasm
2. P GO:0051642 centrosome localization
2. P GO:0030175 filopodium
2. P GO:0045184 establishment of protein localization
2. P GO:0005109 frizzled binding
2. P GO:0030054 cell junction
2. P GO:0031616 spindle pole centrosome
2. P GO:0098871 postsynaptic actin cytoskeleton
2. P GO:0003341 cilium movement
2. P GO:0001833 inner cell mass cell proliferation
2. P GO:0033157 regulation of intracellular protein transport
2. P GO:0036157 outer dynein arm
2. P GO:0005821 intermediate layer of spindle pole body
2. P GO:0031023 microtubule organizing center organization
2. P GO:0080009 mRNA methylation
2. P GO:0019099 female germ-line sex determination
2. P GO:0007098 centrosome cycle
2. P GO:0051959 dynein light intermediate chain binding
2. P GO:0021532 neural tube patterning
2. P GO:0000922 spindle pole
2. P GO:0005823 central plaque of spindle pole body
2. P GO:0048309 endoplasmic reticulum inheritance
2. P GO:0044565 dendritic cell proliferation
2. P GO:2000114 regulation of establishment of cell polarity
2. P GO:2001222 regulation of neuron migration
2. P GO:0010696 positive regulation of mitotic spindle pole body separation
2. P GO:0050811 GABA receptor binding
2. P GO:0098957 anterograde axonal transport of mitochondrion
2. P GO:0031252 cell leading edge
2. P GO:0061573 actin filament bundle retrograde transport
2. P GO:0006911 phagocytosis, engulfment
2. P GO:0048813 dendrite morphogenesis
2. P GO:0030374 nuclear receptor coactivator activity
2. P GO:0007539 primary sex determination, soma
2. P GO:0010975 regulation of neuron projection development
2. P GO:0005816 spindle pole body
2. P GO:0051298 centrosome duplication
2. P GO:0070865 investment cone
2. P GO:0070732 spindle envelope
2. P GO:0008333 endosome to lysosome transport
2. P GO:0001965 G-protein alpha-subunit binding
2. P GO:0032580 Golgi cisterna membrane
2. P GO:0005912 adherens junction
2. P GO:0060326 cell chemotaxis
2. P GO:0005635 nuclear envelope
2. P GO:0071800 podosome assembly
2. P GO:0050771 negative regulation of axonogenesis
2. P GO:0051225 spindle assembly
2. P GO:0006493 protein O-linked glycosylation
2. P GO:0032154 cleavage furrow
2. P GO:0034763 negative regulation of transmembrane transport
2. P GO:0006605 protein targeting
2. P GO:0008298 intracellular mRNA localization
2. P GO:0016477 cell migration
2. P GO:0007100 mitotic centrosome separation
2. P GO:1990138 neuron projection extension
2. P GO:0034501 protein localization to kinetochore
2. P GO:0097320 plasma membrane tubulation
2. P GO:0032901 positive regulation of neurotrophin production
2. P GO:0015629 actin cytoskeleton
2. P GO:0061512 protein localization to cilium
2. P GO:0021955 central nervous system neuron axonogenesis
2. P GO:0032488 Cdc42 protein signal transduction
2. P GO:0005819 spindle
2. P GO:0036158 outer dynein arm assembly
2. P GO:0044295 axonal growth cone
2. P GO:0021799 cerebral cortex radially oriented cell migration
2. P GO:0005102 signaling receptor binding
2. P GO:0030331 estrogen receptor binding
2. P GO:0090261 positive regulation of inclusion body assembly
2. P GO:0007249 I-kappaB kinase/NF-kappaB signaling
2. P GO:0000813 ESCRT I complex
2. P GO:0048680 positive regulation of axon regeneration
2. P GO:0051721 protein phosphatase 2A binding
2. P GO:0048920 posterior lateral line neuromast primordium migration
2. P GO:0071392 cellular response to estradiol stimulus
2. P GO:0030027 lamellipodium
2. P GO:0045110 intermediate filament bundle assembly
2. P GO:0043515 kinetochore binding
2. P GO:0010051 xylem and phloem pattern formation
2. P GO:0007533 mating type switching
2. P GO:2000145 regulation of cell motility
2. P GO:0030425 dendrite
2. P GO:0000375 RNA splicing, via transesterification reactions
2. P GO:1901003 negative regulation of fermentation
2. P GO:0010792 DNA double-strand break processing involved in repair via single-strand annealing
2. P GO:0001835 blastocyst hatching
2. P GO:0006930 substrate-dependent cell migration, cell extension
2. P GO:0007099 centriole replication
2. P GO:0036064 ciliary basal body
2. P GO:0022008 neurogenesis
2. P GO:0021979 hypothalamus cell differentiation
2. P GO:0045451 pole plasm oskar mRNA localization
2. P GO:0005930 axoneme
2. P GO:0045494 photoreceptor cell maintenance
2. P GO:0043203 axon hillock
2. P GO:0090268 activation of mitotic cell cycle spindle assembly checkpoint
2. P GO:0001891 phagocytic cup
2. P GO:0070971 endoplasmic reticulum exit site
2. P GO:0007010 cytoskeleton organization
2. P GO:0031410 cytoplasmic vesicle
2. P GO:0005789 endoplasmic reticulum membrane
2. P GO:0043204 perikaryon
2. P GO:0000381 regulation of alternative mRNA splicing, via spliceosome
2. P GO:0019899 enzyme binding
2. P GO:0043014 alpha-tubulin binding
2. P GO:0045105 intermediate filament polymerization or depolymerization
2. P GO:0051303 establishment of chromosome localization
2. P GO:0001764 neuron migration
2. P GO:0051015 actin filament binding
2. P GO:0090724 central region of growth cone
2. P GO:0043393 regulation of protein binding
2. P GO:0097028 dendritic cell differentiation
2. P GO:0098536 deuterosome
2. P GO:0005814 centriole
2. P GO:0048812 neuron projection morphogenesis
2. P GO:0005769 early endosome
2. P GO:2000574 obsolete regulation of microtubule motor activity
2. P GO:0005871 kinesin complex
2. P GO:0000278 mitotic cell cycle
2. P GO:0016021 integral component of membrane
2. P GO:1904115 axon cytoplasm
2. P GO:0032391 photoreceptor connecting cilium
2. P GO:0060271 cilium assembly
2. P GO:0021987 cerebral cortex development
2. P GO:0045931 positive regulation of mitotic cell cycle
2. P GO:1905824 positive regulation of mitotic sister chromatid arm separation
2. P GO:0005875 microtubule associated complex
2. P GO:0098939 dendritic transport of mitochondrion
2. P GO:0032418 lysosome localization
2. P GO:0030866 cortical actin cytoskeleton organization
2. P GO:1902423 regulation of attachment of mitotic spindle microtubules to kinetochore
2. P GO:0000940 outer kinetochore
2. P GO:0005813 centrosome
2. P GO:0042073 intraciliary transport
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0005923 bicellular tight junction
2. P GO:0046872 metal ion binding
2. P GO:0036396 RNA N6-methyladenosine methyltransferase complex
2. P GO:0017022 myosin binding
2. P GO:0000137 Golgi cis cisterna
2. P GO:0099010 modification of postsynaptic structure
2. P GO:0060327 cytoplasmic actin-based contraction involved in cell motility
2. P GO:0030911 TPR domain binding
2. P GO:0005801 cis-Golgi network
2. P GO:0005882 intermediate filament
2. P GO:0035735 intraciliary transport involved in cilium assembly
2. P GO:0002102 podosome
2. P GO:0007224 smoothened signaling pathway
2. P GO:0051220 cytoplasmic sequestering of protein
2. P GO:0035459 vesicle cargo loading
2. P GO:0031648 protein destabilization
2. P GO:0042770 signal transduction in response to DNA damage
2. P GO:0000776 kinetochore
2. P GO:0031587 positive regulation of inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
2. P GO:0045724 positive regulation of cilium assembly
2. P GO:0032410 negative regulation of transporter activity
2. P GO:0000077 DNA damage checkpoint signaling
2. P GO:0060052 neurofilament cytoskeleton organization
2. P GO:0070307 lens fiber cell development
2. P GO:0031098 stress-activated protein kinase signaling cascade
2. P GO:0007315 pole plasm assembly
2. P GO:0042802 identical protein binding
2. P GO:0005938 cell cortex
2. P GO:0045773 positive regulation of axon extension
2. P GO:0003383 apical constriction
2. P GO:1905342 positive regulation of protein localization to kinetochore
2. P GO:0070868 obsolete heterochromatin organization involved in chromatin silencing
3. B GO:0007049 cell cycle
3. B GO:0043565 sequence-specific DNA binding
3. B GO:0043590 bacterial nucleoid
3. B GO:0097546 ciliary base
3. B GO:0010974 negative regulation of division septum assembly

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6DH86 Coiled-coil domain-containing protein 149-B 1.52e-05 1.13e-22 5.08e-165
1. PB Q6NRH3 Coiled-coil domain-containing protein 149 4.28e-07 1.39e-30 0.0
1. PB Q0VCP9 Coiled-coil domain-containing protein 149 1.38e-13 1.13e-05 0.0
1. PB Q6ZUS6 Coiled-coil domain-containing protein 149 0 2.26e-144 0.0
1. PB Q5XJA2 Coiled-coil domain-containing protein 149-A 2.08e-06 9.30e-46 5.16e-154
2. P Q06637 Filensin 1.70e-04 4.43e-08 NA
2. P Q3UPP8 Centrosomal protein of 63 kDa 3.29e-02 9.11e-03 NA
2. P Q66IZ7 Nuclear distribution protein nudE-like 1-B 3.36e-03 4.39e-10 NA
2. P D3YN49 Geminin coiled-coil domain-containing protein 1 8.41e-02 3.83e-02 NA
2. P Q9P2B4 CTTNBP2 N-terminal-like protein 3.28e-04 5.24e-05 NA
2. P F7DP49 Deuterosome assembly protein 1 4.84e-04 4.19e-09 NA
2. P Q8K2Q9 Shootin-1 1.57e-03 7.18e-09 NA
2. P Q5ZMC9 Nuclear distribution protein nudE homolog 1 1.10e-02 8.45e-07 NA
2. P Q9P6S3 Up-regulated during septation protein 1 1.04e-02 4.47e-04 NA
2. P C7GY13 SWI5-dependent HO expression protein 3 1.02e-04 3.78e-03 NA
2. P D3YZP9 Coiled-coil domain-containing protein 6 1.81e-04 9.40e-04 NA
2. P Q28CJ6 Nuclear distribution protein nudE-like 1 2.60e-04 2.67e-08 NA
2. P Q8IX94 cTAGE family member 4 3.98e-04 3.20e-02 NA
2. P Q6C3S1 Nuclear distribution protein nudE homolog 1 7.41e-03 2.27e-04 NA
2. P B3DLE8 Protein Spindly 1.44e-04 2.16e-06 NA
2. P C5DLA5 SWI5-dependent HO expression protein 3 2.00e-05 1.44e-02 NA
2. P Q8BIE6 FERM domain-containing protein 4A 2.41e-01 2.42e-03 NA
2. P Q0D2H9 Putative golgin subfamily A member 8D 4.36e-05 1.99e-05 NA
2. P Q9VM65 FGFR1 oncogene partner 2 homolog 9.29e-03 3.81e-10 NA
2. P Q4R703 Centrosomal protein of 63 kDa 9.55e-05 2.65e-02 NA
2. P O46480 Nuclear distribution protein nudE-like 1 3.61e-05 3.87e-07 NA
2. P Q96M63 Outer dynein arm-docking complex subunit 1 1.22e-02 3.63e-03 NA
2. P Q02435 Filensin (Fragment) 2.57e-05 8.99e-15 NA
2. P Q8K4T4 Filamin-A-interacting protein 1 2.08e-02 5.07e-03 NA
2. P Q08AF8 Putative golgin subfamily A member 8F/8G 2.64e-05 1.39e-05 NA
2. P Q9ER69 Pre-mRNA-splicing regulator WTAP 2.06e-04 6.45e-11 NA
2. P Q86XG9 Putative neuroblastoma breakpoint family member 5 1.79e-02 2.74e-05 NA
2. P Q8N6Q1 Transmembrane and coiled-coil domain-containing protein 5A 6.00e-06 7.85e-03 NA
2. P E7KEZ1 Spindle pole body component SPC42 2.35e-04 4.36e-03 NA
2. P D3Z6Q9 Bridging integrator 2 3.94e-05 5.49e-03 NA
2. P Q10PZ6 Microtubule-associated protein 70-4 3.28e-03 2.24e-09 NA
2. P Q3UX62 Outer dynein arm-docking complex subunit 1 8.14e-03 6.94e-07 NA
2. P P0CW27 Coiled-coil domain-containing protein 166 7.82e-05 3.14e-04 NA
2. P B0CM36 Lebercilin-like protein 6.63e-03 1.02e-02 NA
2. P Q3KR99 Protein Spindly 3.48e-02 1.01e-12 NA
2. P P49455 Tropomyosin-1, isoforms 33/34 4.63e-04 1.81e-05 NA
2. P Q95K40 Coiled-coil domain-containing protein 83 1.22e-03 2.08e-05 NA
2. P Q6DK98 Nuclear distribution protein nudE-like 1-A 7.05e-04 5.64e-09 NA
2. P A5E5U9 SWI5-dependent HO expression protein 3 2.98e-03 9.57e-03 NA
2. P Q6P4K5 Pre-mRNA-splicing regulator WTAP 2.24e-04 1.27e-06 NA
2. P Q4KLT6 Pre-mRNA-splicing regulator WTAP 6.64e-04 4.09e-05 NA
2. P Q8R2H7 Trafficking kinesin-binding protein 2 4.13e-03 2.23e-05 NA
2. P Q8CGZ2 Afadin- and alpha-actinin-binding protein 1.89e-02 1.14e-02 NA
2. P Q86VQ0 Lebercilin 1.39e-02 1.84e-02 NA
2. P A7TP22 Biogenesis of lysosome-related organelles complex 1 subunit VAB2 2.63e-02 4.21e-02 NA
2. P F8WBI6 Golgin subfamily A member 8N 4.88e-05 2.50e-05 NA
2. P A6NNP5 Coiled-coil domain-containing protein 169 2.35e-03 4.98e-02 NA
2. P O74689 Nuclear distribution protein nudE 8.08e-04 2.09e-03 NA
2. P P32448 Anti-silencing protein 2 2.04e-04 3.01e-05 NA
2. P A5D8S1 Leucine zipper protein 2 3.56e-06 3.49e-05 NA
2. P Q28XY0 Pre-mRNA-splicing regulator female-lethal(2)D 5.24e-02 2.65e-06 NA
2. P Q9QYP6 5-azacytidine-induced protein 2 4.04e-05 1.70e-11 NA
2. P Q3SYW5 5-azacytidine-induced protein 2 4.92e-05 2.99e-09 NA
2. P O95447 Lebercilin-like protein 9.65e-03 1.16e-02 NA
2. P Q86X02 Cerebellar degeneration-related protein 2-like 2.97e-05 7.55e-03 NA
2. P Q75AC2 Biogenesis of lysosome-related organelles complex 1 subunit VAB2 1.30e-02 1.52e-03 NA
2. P D3UEM3 SWI5-dependent HO expression protein 3 2.99e-04 5.12e-03 NA
2. P Q32LC2 Neuroblastoma breakpoint family member 6-like protein 4.84e-03 2.27e-03 NA
2. P O45717 Protein nud-2 3.69e-06 6.94e-05 NA
2. P A7E3D8 Lebercilin-like protein 1.41e-03 3.15e-03 NA
2. P Q6NRJ5 Nuclear distribution protein nudE homolog 1-B 1.11e-02 3.24e-04 NA
2. P A0MZ66 Shootin-1 8.09e-05 1.38e-07 NA
2. P Q6NRW2 Protein Spindly-B 9.22e-03 6.03e-09 NA
2. P Q9ZRT1 Protein gamma response 1 1.05e-03 7.86e-04 NA
2. P Q4KMA0 5-azacytidine-induced protein 2 1.31e-04 7.88e-09 NA
2. P A8MQT2 Golgin subfamily A member 8B 1.71e-02 5.36e-05 NA
2. P Q8C0X0 Lebercilin-like protein 5.74e-03 9.38e-09 NA
2. P A6ZZS3 Spindle pole body component SPC42 8.04e-05 4.36e-03 NA
2. P Q6PHN1 Coiled-coil domain-containing protein 57 7.91e-03 2.34e-05 NA
2. P Q8IWF9 Coiled-coil domain-containing protein 83 1.01e-05 1.54e-05 NA
2. P A6NKD9 Coiled-coil domain-containing protein 85C 9.19e-03 1.22e-03 NA
2. P C8ZCC8 Spindle pole body component SPC42 1.35e-03 4.36e-03 NA
2. P C7GP31 Spindle pole body component SPC42 3.83e-04 4.36e-03 NA
2. P Q6R6L0 Brain-enriched guanylate kinase-associated protein 2.18e-02 4.40e-03 NA
2. P Q5R8T7 Nuclear distribution protein nudE-like 1 2.76e-05 5.15e-07 NA
2. P Q96EA4 Protein Spindly 7.28e-04 1.88e-13 NA
2. P Q6Z746 Microtubule-associated protein 70-2 5.75e-04 2.60e-03 NA
2. P Q5U2Y9 Lebercilin 2.34e-02 2.23e-03 NA
2. P A2A6T1 Cerebellar degeneration-related protein 2-like 2.65e-05 4.93e-04 NA
2. P Q6ZRC1 Uncharacterized protein C4orf50 3.66e-03 1.30e-03 NA
2. P H2KYP0 PAC-1 interacting and coiled-coil domain-containing protein 1 1.59e-04 1.47e-06 NA
2. P Q5ABV6 SWI5-dependent HO expression protein 3 7.57e-05 1.53e-02 NA
2. P Q9P219 Protein Daple 1.76e-01 1.53e-02 NA
2. P Q6PD31 Trafficking kinesin-binding protein 1 4.57e-03 1.47e-05 NA
2. P A3KNA5 Filamin A-interacting protein 1-like 3.03e-03 2.70e-04 NA
2. P O35668 Huntingtin-associated protein 1 5.32e-04 3.62e-02 NA
2. P Q6DHL7 Coiled-coil domain-containing protein 85C-B 1.58e-03 1.58e-06 NA
2. P B5VE90 SWI5-dependent HO expression protein 3 3.17e-04 4.77e-03 NA
2. P Q9UBW5 Bridging integrator 2 1.66e-02 1.04e-02 NA
2. P Q6VGS5 Protein Daple 3.26e-01 6.16e-04 NA
2. P Q2YDE5 Putative coiled-coil domain-containing protein 196 4.02e-04 1.43e-02 NA
2. P B3LR46 Spindle pole body component SPC42 2.16e-04 4.36e-03 NA
2. P Q4X1V0 Nuclear distribution protein nudE homolog 1 1.92e-02 1.84e-04 NA
2. P P97817 Cerebellar degeneration-related protein 2 5.56e-04 2.87e-05 NA
2. P E7Q664 Spindle pole body component SPC42 NA 4.13e-02 NA
2. P Q78PB6 Nuclear distribution protein nudE-like 1 2.21e-03 1.18e-08 NA
2. P Q5ZKH4 Nuclear distribution protein nudE-like 1 4.74e-05 1.15e-05 NA
2. P Q9H6S1 5-azacytidine-induced protein 2 6.62e-05 1.05e-09 NA
2. P Q96RT6 cTAGE family member 2 2.35e-03 3.35e-03 NA
2. P Q96MT8 Centrosomal protein of 63 kDa 2.95e-02 9.29e-03 NA
2. P P38272 SWI5-dependent HO expression protein 3 7.57e-05 1.29e-03 NA
2. P Q08DR9 Protein Spindly 3.37e-04 4.36e-09 NA
2. P Q66J96 Nuclear distribution protein nudE homolog 1-A 7.05e-05 2.42e-05 NA
2. P H3BSY2 Golgin subfamily A member 8M 8.68e-03 1.56e-06 NA
2. P Q803Q2 Nuclear distribution protein nudE-like 1-B 1.35e-05 1.08e-09 NA
2. P Q8BGY3 Leucine zipper protein 2 4.29e-05 2.11e-11 NA
2. P A4FV37 Caveolae-associated protein 3 5.07e-03 1.49e-02 NA
2. P A6NMD2 Golgin subfamily A member 8J 3.42e-04 1.89e-07 NA
2. P Q06568 Nuclear distribution protein nudE homolog 1 4.55e-03 4.72e-04 NA
2. P Q53HC0 Coiled-coil domain-containing protein 92 5.61e-04 8.55e-07 NA
2. P Q9NXR1 Nuclear distribution protein nudE homolog 1 7.49e-05 1.11e-05 NA
2. P Q9C9X0 Microtubule-associated protein 70-1 7.12e-04 4.10e-03 NA
2. P B3LN26 SWI5-dependent HO expression protein 3 1.16e-01 5.12e-03 NA
2. P Q0V989 Coiled-coil domain-containing protein 85C 1.71e-04 1.11e-06 NA
2. P Q86TE4 Leucine zipper protein 2 3.71e-05 1.32e-10 NA
2. P Q9GZM8 Nuclear distribution protein nudE-like 1 1.10e-04 6.52e-07 NA
2. P Q8IYY4 Zinc finger protein DZIP1L 7.16e-02 4.10e-03 NA
2. P Q7Z7B0 Filamin-A-interacting protein 1 2.49e-02 7.62e-03 NA
2. P Q8CCX5 Keratin-like protein KRT222 1.26e-04 1.15e-05 NA
2. P Q2TA00 Coiled-coil domain-containing protein 83 1.90e-05 1.21e-04 NA
2. P Q8GYX3 Microtubule-associated protein 70-5 5.04e-05 3.81e-04 NA
2. P D6RF30 Golgin subfamily A member 8K 9.10e-06 3.00e-08 NA
2. P P08553 Neurofilament medium polypeptide 1.66e-04 2.06e-02 NA
2. P H3BQL2 Golgin subfamily A member 8T 8.29e-04 7.29e-07 NA
2. P A0A1B0GTZ2 Putative coiled-coil domain-containing protein 196 4.61e-05 1.39e-02 NA
2. P Q6NZK5 Protein hinderin 7.50e-04 5.31e-04 NA
2. P A6NCC3 Golgin subfamily A member 8O 3.55e-05 2.11e-05 NA
2. P Q9DCD5 Tight junction-associated protein 1 8.67e-03 4.84e-07 NA
2. P Q8BMD2 Zinc finger protein DZIP1 9.97e-03 1.70e-03 NA
2. P Q9ES39 Nuclear distribution protein nudE homolog 1 6.27e-05 1.17e-07 NA
2. P Q9LQU7 Microtubule-associated protein 70-4 1.15e-02 4.37e-02 NA
2. P Q12934 Filensin 1.52e-05 2.09e-09 NA
2. P A0MZ67 Shootin-1 1.37e-04 3.94e-08 NA
2. P Q9VT70 Nuclear distribution protein nudE homolog 2.62e-02 3.89e-08 NA
2. P Q06002 Filensin 1.00e-03 1.03e-04 NA
2. P E9Q6B2 Coiled-coil domain-containing protein 85C 2.46e-03 1.21e-03 NA
2. P Q66JL0 Nuclear distribution protein nudE homolog 1 3.62e-04 5.55e-07 NA
2. P A7E2F4 Golgin subfamily A member 8A 1.23e-03 4.14e-03 NA
2. P Q8L7S4 Microtubule-associated protein 70-2 1.35e-04 2.94e-02 NA
2. P Q4L180 Filamin A-interacting protein 1-like 7.61e-03 1.94e-04 NA
2. P Q4R4S6 Nuclear distribution protein nudE-like 1 6.02e-03 8.57e-08 NA
2. P Q5RD40 5-azacytidine-induced protein 2 6.18e-05 7.20e-07 NA
2. P A6NC78 Putative golgin subfamily A member 8I 6.87e-04 1.07e-07 NA
2. P Q810I0 Vacuolar protein sorting-associated protein 37D 3.53e-03 3.98e-03 NA
2. P Q923A2 Protein Spindly 1.01e-03 3.87e-15 NA
2. P Q21194 Guanine nucleotide exchange factor rei-2 1.30e-04 4.63e-05 NA
2. P A4FU28 cTAGE family member 9 2.85e-03 4.21e-02 NA
2. P Q2QLI6 Microtubule-associated protein 70-1 2.62e-03 1.85e-03 NA
2. P C5MH60 SWI5-dependent HO expression protein 3 2.23e-02 2.27e-06 NA
2. P Q5RDH2 CTTNBP2 N-terminal-like protein 6.72e-03 6.71e-05 NA
2. P E9PVD1 Coiled-coil domain-containing protein 62 4.40e-04 6.13e-07 NA
2. P Q5R8Y4 Leucine zipper protein 2 7.09e-04 2.55e-11 NA
2. P I6L899 Golgin subfamily A member 8R 2.47e-05 2.68e-06 NA
2. P Q5JTD0 Tight junction-associated protein 1 2.35e-04 2.08e-05 NA
2. P Q9Y091 Pre-mRNA-splicing regulator female-lethal(2)D 4.10e-04 9.60e-05 NA
2. P Q99LJ0 CTTNBP2 N-terminal-like protein 1.01e-04 6.16e-04 NA
2. P Q17695 Spindly-like protein spdl-1 1.58e-04 1.03e-06 NA
2. P A3LXM3 SWI5-dependent HO expression protein 3 6.30e-04 7.75e-07 NA
2. P P36094 Spindle pole body component SPC42 6.57e-04 4.82e-03 NA
2. P Q7SXI6 Nuclear distribution protein nudE-like 1-A 1.99e-06 1.60e-08 NA
2. P H3BV12 Golgin subfamily A member 8Q 1.78e-05 3.18e-05 NA
2. P Q8IXS6 Paralemmin-2 9.78e-03 4.49e-02 NA
2. P Q15007 Pre-mRNA-splicing regulator WTAP 4.78e-03 1.83e-10 NA
2. P A6ZL74 SWI5-dependent HO expression protein 3 2.37e-03 3.78e-03 NA
2. P Q6P0R8 Shootin-1 2.04e-02 1.30e-03 NA
2. P Q969G5 Caveolae-associated protein 3 9.20e-04 5.71e-03 NA
2. P E7NK16 Spindle pole body component SPC42 2.45e-04 1.27e-02 NA
2. P H3BPF8 Golgin subfamily A member 8S 1.92e-03 2.75e-02 NA
2. P A6NN73 Golgin subfamily A member 8C 3.71e-04 1.60e-05 NA
2. P Q8N1A0 Keratin-like protein KRT222 3.19e-04 1.68e-06 NA
2. P Q6P9F0 Coiled-coil domain-containing protein 62 1.72e-03 1.91e-06 NA
2. P Q9ERR1 Nuclear distribution protein nudE-like 1 1.41e-05 1.18e-08 NA
2. P Q86YF9 Zinc finger protein DZIP1 2.47e-02 4.13e-02 NA
2. P Q8VDN4 Coiled-coil domain-containing protein 92 3.82e-04 5.20e-09 NA
2. P Q2KI75 Keratin-like protein KRT222 1.22e-04 2.65e-06 NA
2. P A7TJJ7 SWI5-dependent HO expression protein 3 1.62e-03 1.93e-02 NA
2. P Q9CS72 Filamin-A-interacting protein 1 4.16e-02 2.20e-03 NA
2. P A7MD70 Protein Spindly 1.28e-03 2.34e-09 NA
2. P Q4V872 Coiled-coil domain-containing protein 85C 6.70e-04 1.04e-07 NA
2. P B1H228 Outer dynein arm-docking complex subunit 1 3.29e-02 2.22e-04 NA
2. P Q8VC66 Afadin- and alpha-actinin-binding protein 1.45e-05 4.33e-02 NA
2. P Q2TAC2 Coiled-coil domain-containing protein 57 8.72e-03 1.14e-03 NA
2. P Q68FR2 Bridging integrator 2 1.96e-03 2.23e-03 NA
2. P Q4R7H3 Protein Spindly 2.19e-02 1.22e-12 NA
2. P Q86XT2 Vacuolar protein sorting-associated protein 37D 1.25e-03 1.49e-02 NA
2. P O60296 Trafficking kinesin-binding protein 2 1.05e-02 5.48e-05 NA
2. P Q653N3 Microtubule-associated protein 70-3 8.60e-04 2.73e-03 NA
2. P Q9UPV9 Trafficking kinesin-binding protein 1 3.04e-02 1.63e-05 NA
2. P Q9CZA6 Nuclear distribution protein nudE homolog 1 1.56e-04 2.09e-09 NA
2. P Q5BIX7 Protein Spindly-A 5.78e-04 2.84e-10 NA
2. P Q01850 Cerebellar degeneration-related protein 2 7.29e-04 3.22e-05 NA
2. P Q80ST9 Lebercilin 2.38e-03 6.30e-04 NA
2. P A2AMT1 Filensin 7.07e-03 6.64e-11 NA
2. P Q6P6L0 Filamin A-interacting protein 1-like 6.11e-03 6.10e-04 NA
2. P Q4R3X1 5-azacytidine-induced protein 2 2.04e-04 2.47e-09 NA
2. P P0CJ92 Golgin subfamily A member 8H 4.88e-05 1.15e-06 NA
2. P C5E4H7 Spindle pole body component SPC42 3.96e-02 1.72e-04 NA
2. P Q7SXL7 Pre-mRNA-splicing regulator WTAP 1.93e-05 2.69e-07 NA
2. P Q0P485 Coiled-coil domain-containing protein 85C-A 9.51e-04 1.72e-06 NA
3. B B7VHK0 Nucleoid occlusion factor SlmA 2.36e-02 NA 0.040
3. B Q87T90 Nucleoid occlusion factor SlmA 6.55e-03 NA 0.030
3. B Q93635 Coiled-coil domain-containing protein 149 6.17e-07 NA 3.92e-21