Results | PROST

Summary

Q75VX8

Homolog: Q6PAJ3.
Function: GRB2-associated and regulator of MAPK protein 2.

Statistics

Total GO Annotation: 123
Unique PROST Go: 117
Unique BLAST Go: 0

Total Homologs: 23
Unique PROST Homologs: 17
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q6PAJ3 (GRB2-associated and regulator of MAPK protein 2) with a FATCAT P-Value: 1.12e-12 and RMSD of 4.16 angstrom. The sequence alignment identity is 87.1%.
Structural alignment shown in left. Query protein Q75VX8 colored as red in alignment, homolog Q6PAJ3 colored as blue. Query protein Q75VX8 is also shown in right top, homolog Q6PAJ3 showed in right bottom. They are colored based on secondary structures.

  Q75VX8 MEKLAAGLAGLRWSMGAFPLDLIVSRCRLPTLACLGPGEYAEGVSERDILLIHSCRQWTTVTAHTLEEGHYVIGPKIDIPLQYPGKFKLLEQARDVREPV 100
  Q6PAJ3 MEKLAAGLAGLRWSMGAFPLDLIVSRCRLPTLACLGPGEYAEGVSERDILLIHSCRQWTTVTAHTLEEGHYVIGPKIDIPLQYPGKFKLLEQARDVREPV 100

  Q75VX8 RYFSSVEEVASVFPDRIFVMEAITFSVKVVSGEFSEDSEVYNFTLHAGDELTLMGQAEILCAKTTKERSRFTTLLRKLGRAGALAGVGGGGPASAGAAGG 200
  Q6PAJ3 RYFSSVEEVASVFPDRIFVMEAITFSVKVVSGEFSEDSEVYNFTLHAGDELTLMGQAEILCAKTTKERSRFTTLLRKLGRAGALAGI--GGPGSMGATGG 198

  Q75VX8 TGGGGARPVKGKMPCLICMNHRTNESLSLPFQCQGRFSTRSPLELQMQEGEHTVRAIIERVRLPVNVLVPSRPPRNPYDLHPVREGHCYKLVSIISKTVV 300
  Q6PAJ3 -GGGAARPVKSKMPCLICMNHRTNESLSLPFQCQGRFSTRSPLELQMQEGEHTVRAIIERVRLPVNVLVPSRPPRNPYDLHPVREGHCYKLVSIISKTVV 297

  Q75VX8 LGLALRREGPAPLHFLLLTDTPRFALPQGLLAGDPRVERLVRDSASYCRERFDPDEYSTAVREAPAELAEDCASPRRARLCLPAPRAPGLARAPGP---L 397
  Q6PAJ3 LGLALRREGPAPLHFLLLTDTPRFTLPQGLLAGDPRVERLVRDSASYCRERFDPDEYSTAVREAPAELSDDCASPRHARLCLPAPRAPGAVRAPGPPGRL 397

  Q75VX8 APA-PA-GEGDQEYVSPDWAAAPEPAAPPAEIPYEELWAHQGPE----GLVRPPPGLDLISFGAAGPPRREPEAPPPPVPPKSEAVKEECRLLNAPPVPP 491
  Q6PAJ3 GPALPAPGDSDQDYVSPDWAGVSEPAGGCAEIPYEELWVHQAPESRADARARPLAGPDLISFGIVGPPRHEPEAPPPPVPPKSEAVKEECRLLHAPPVPP 497

  Q75VX8 RGGNGS-GRLSSSPPVPPRFPKLQPVHSPSSSLSYYSSGLQDGAGSRSGSGSPSPDTYSLYCYPCTWGDCKVGESSSRPAPGPLPS-TTQPSQASRALTE 589
  Q6PAJ3 RGG-GSCSKLTGSPPVLPHFPKLQPVHSPSSSLSYYSSGLQDGAGSRSGSGSPSPDAYSLYCYPCTWGDCKASESSSRPPPGPLPSTTTQPSQASRGLSE 596

  Q75VX8 PLSGRAASLLGADTP-VKTYHSCPPLFKPSHPQKRFAPFGALNPFSGPAYPSG-PSAALSSGPRTTSGPVATSGPAYSPGPA-SP-GQAYSAAPPSSCAP 685
  Q6PAJ3 PLSGRTPSLLGADTPVVKNYHSCPPLFKSSRPQKSFAPFGALNPFSGPAHPSGAPAAS-SSGSISTSGVLATSSPTHSPGPGPGPQGQGYSA------AP 689

  Q75VX8 SSS-SSSEWQEPVLEPFDPFELGQGSSPEPELLRSQEPRAVGTPGPGPRLSPLGPSKAFEPEGLVLHQVPTPLSPAALQGPEAGGA-LFLTQGRLEGPPA 783
  Q6PAJ3 SSSLSSSEWQEPALEPLDPFELGQASPPELELVRCQEPRAAGAPGSGPCLSPLGQPKAFEPEGLVLRQVPASLSPAALQGPEAGGTLLFLTQGCLEGPPG 789

  Q75VX8 SPRDGATGFGVRDASSWQPPADLSALSLEEVSRSLRFIGLSEDVVSFFARERIDGSIFVQLSEDILADDFHLTKLQVKKIMQFIKGWRPKI 874
  Q6PAJ3 SPREGATGAGVRDASSWQPPADLSALSLEEVSRSLRFIGLSEDVVSFFARERIDGSIFVQLSEDILADDFHLTKLQVKKIMQFIKGWRPKI 880

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0051781	positive regulation of cell division
1. PB	GO:0070374	positive regulation of ERK1 and ERK2 cascade
1. PB	GO:0071364	cellular response to epidermal growth factor stimulus
1. PB	GO:0070064	proline-rich region binding
1. PB	GO:0007173	epidermal growth factor receptor signaling pathway
1. PB	GO:0008284	positive regulation of cell population proliferation
2. P	GO:0050680	negative regulation of epithelial cell proliferation
2. P	GO:0005159	insulin-like growth factor receptor binding
2. P	GO:0016055	Wnt signaling pathway
2. P	GO:0010718	positive regulation of epithelial to mesenchymal transition
2. P	GO:0000904	cell morphogenesis involved in differentiation
2. P	GO:0031087	deadenylation-independent decapping of nuclear-transcribed mRNA
2. P	GO:1905324	telomere-telomerase complex assembly
2. P	GO:0050775	positive regulation of dendrite morphogenesis
2. P	GO:0060766	negative regulation of androgen receptor signaling pathway
2. P	GO:0140445	chromosome, telomeric repeat region
2. P	GO:0045294	alpha-catenin binding
2. P	GO:0051946	regulation of glutamate uptake involved in transmission of nerve impulse
2. P	GO:0045177	apical part of cell
2. P	GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter
2. P	GO:0030136	clathrin-coated vesicle
2. P	GO:0010008	endosome membrane
2. P	GO:0090090	negative regulation of canonical Wnt signaling pathway
2. P	GO:0048009	insulin-like growth factor receptor signaling pathway
2. P	GO:0070932	histone H3 deacetylation
2. P	GO:2000678	negative regulation of transcription regulatory region DNA binding
2. P	GO:0007507	heart development
2. P	GO:0097167	circadian regulation of translation
2. P	GO:2000298	regulation of Rho-dependent protein serine/threonine kinase activity
2. P	GO:0016233	telomere capping
2. P	GO:0001701	in utero embryonic development
2. P	GO:0007409	axonogenesis
2. P	GO:0019229	regulation of vasoconstriction
2. P	GO:0008047	enzyme activator activity
2. P	GO:0048268	clathrin coat assembly
2. P	GO:2001237	negative regulation of extrinsic apoptotic signaling pathway
2. P	GO:0006898	receptor-mediated endocytosis
2. P	GO:0045664	regulation of neuron differentiation
2. P	GO:0005178	integrin binding
2. P	GO:0048545	response to steroid hormone
2. P	GO:0019894	kinesin binding
2. P	GO:0050750	low-density lipoprotein particle receptor binding
2. P	GO:0060391	positive regulation of SMAD protein signal transduction
2. P	GO:0070198	protein localization to chromosome, telomeric region
2. P	GO:1903608	protein localization to cytoplasmic stress granule
2. P	GO:0070345	negative regulation of fat cell proliferation
2. P	GO:0050872	white fat cell differentiation
2. P	GO:0030234	enzyme regulator activity
2. P	GO:0016787	hydrolase activity
2. P	GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway
2. P	GO:0030276	clathrin binding
2. P	GO:0019897	extrinsic component of plasma membrane
2. P	GO:0070187	shelterin complex
2. P	GO:0021849	neuroblast division in subventricular zone
2. P	GO:0005905	clathrin-coated pit
2. P	GO:0007405	neuroblast proliferation
2. P	GO:0030335	positive regulation of cell migration
2. P	GO:0050769	positive regulation of neurogenesis
2. P	GO:0045785	positive regulation of cell adhesion
2. P	GO:0030099	myeloid cell differentiation
2. P	GO:0043085	positive regulation of catalytic activity
2. P	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading
2. P	GO:0043548	phosphatidylinositol 3-kinase binding
2. P	GO:0001921	positive regulation of receptor recycling
2. P	GO:0031519	PcG protein complex
2. P	GO:0042393	histone binding
2. P	GO:0098978	glutamatergic synapse
2. P	GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA
2. P	GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway
2. P	GO:0071560	cellular response to transforming growth factor beta stimulus
2. P	GO:0070373	negative regulation of ERK1 and ERK2 cascade
2. P	GO:1902074	response to salt
2. P	GO:2001046	positive regulation of integrin-mediated signaling pathway
2. P	GO:2000860	positive regulation of aldosterone secretion
2. P	GO:1902990	mitotic telomere maintenance via semi-conservative replication
2. P	GO:0097543	ciliary inversin compartment
2. P	GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization
2. P	GO:0051973	positive regulation of telomerase activity
2. P	GO:0010977	negative regulation of neuron projection development
2. P	GO:0016323	basolateral plasma membrane
2. P	GO:0005158	insulin receptor binding
2. P	GO:0019249	lactate biosynthetic process
2. P	GO:0030308	negative regulation of cell growth
2. P	GO:0005769	early endosome
2. P	GO:0007588	excretion
2. P	GO:0030665	clathrin-coated vesicle membrane
2. P	GO:0001822	kidney development
2. P	GO:0000782	telomere cap complex
2. P	GO:0021670	lateral ventricle development
2. P	GO:0035091	phosphatidylinositol binding
2. P	GO:0043231	intracellular membrane-bounded organelle
2. P	GO:0003729	mRNA binding
2. P	GO:0016235	aggresome
2. P	GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation
2. P	GO:0042754	negative regulation of circadian rhythm
2. P	GO:0045296	cadherin binding
2. P	GO:0032211	negative regulation of telomere maintenance via telomerase
2. P	GO:1903077	negative regulation of protein localization to plasma membrane
2. P	GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
2. P	GO:0035026	leading edge cell differentiation
2. P	GO:0007368	determination of left/right symmetry
2. P	GO:0007004	telomere maintenance via telomerase
2. P	GO:0036464	cytoplasmic ribonucleoprotein granule
2. P	GO:0032349	positive regulation of aldosterone biosynthetic process
2. P	GO:0000932	P-body
2. P	GO:2000370	positive regulation of clathrin-dependent endocytosis
2. P	GO:0014069	postsynaptic density
2. P	GO:0071425	hematopoietic stem cell proliferation
2. P	GO:2000643	positive regulation of early endosome to late endosome transport
2. P	GO:0007257	obsolete activation of JUN kinase activity
2. P	GO:0034332	adherens junction organization
2. P	GO:0005546	phosphatidylinositol-4,5-bisphosphate binding
2. P	GO:0060487	lung epithelial cell differentiation
2. P	GO:0099150	regulation of postsynaptic specialization assembly
2. P	GO:0035612	AP-2 adaptor complex binding
2. P	GO:0045807	positive regulation of endocytosis
2. P	GO:0030900	forebrain development
2. P	GO:0030862	positive regulation of polarized epithelial cell differentiation
2. P	GO:0030132	clathrin coat of coated pit
2. P	GO:0038024	cargo receptor activity
2. P	GO:0008013	beta-catenin binding
2. P	GO:0035615	clathrin adaptor activity
2. P	GO:0002092	positive regulation of receptor internalization

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q75VX8	GRB2-associated and regulator of MAPK protein 2	0	1.05e-135	0.0
1. PB	Q6NRE4	GRB2-associated and regulator of MAPK protein	3.80e-07	2.30e-47	0.0
1. PB	Q7ZVU1	GRB2-associated and regulator of MAPK protein 1	9.66e-09	3.26e-41	4.92e-164
1. PB	Q3UFT3	GRB2-associated and regulator of MAPK protein	9.45e-03	2.19e-54	0.0
1. PB	Q9H706	GRB2-associated and regulator of MAPK protein 1	3.92e-07	4.23e-53	0.0
1. PB	Q6PAJ3	GRB2-associated and regulator of MAPK protein 2	1.12e-12	2.12e-81	0.0
2. P	Q6P4Y6	Insulin receptor substrate 1	3.16e-01	7.83e-04	NA
2. P	Q5DTW2	Scm-like with four MBT domains protein 2	5.53e-01	9.09e-03	NA
2. P	Q9UQR0	Sex comb on midleg-like protein 2	3.55e-01	3.01e-02	NA
2. P	O88797	Disabled homolog 2	3.73e-01	3.99e-02	NA
2. P	O14246	Protection of telomeres protein tpz1	5.07e-01	1.01e-02	NA
2. P	Q9QZS3	Protein numb homolog	6.77e-01	1.93e-04	NA
2. P	Q2LC84	Protein numb homolog	5.13e-01	7.91e-04	NA
2. P	P98078	Disabled homolog 2	4.47e-01	4.13e-02	NA
2. P	Q91YD3	mRNA-decapping enzyme 1A	2.19e-01	8.22e-04	NA
2. P	I3LHS8	mRNA-decapping enzyme 1A	3.93e-01	2.88e-03	NA
2. P	Q68DC2	Ankyrin repeat and SAM domain-containing protein 6	5.73e-01	4.24e-02	NA
2. P	Q8IZD4	mRNA-decapping enzyme 1B	4.34e-01	1.56e-03	NA
2. P	Q6GQX6	Ankyrin repeat and SAM domain-containing protein 6	7.23e-01	1.95e-02	NA
2. P	Q9NPI6	mRNA-decapping enzyme 1A	5.12e-01	9.62e-04	NA
2. P	Q5R413	mRNA-decapping enzyme 1B	2.62e-01	4.53e-03	NA
2. P	P49757	Protein numb homolog	4.65e-01	3.01e-04	NA
2. P	Q8K3T2	Period circadian protein homolog 2	6.66e-01	5.67e-03	NA