Summary

Q7Z422

Homolog: Q5XIA2.
Function: SUZ domain-containing protein 1.

Statistics

Total GO Annotation: 17
Unique PROST Go: 17
Unique BLAST Go: 0

Total Homologs: 30
Unique PROST Homologs: 21
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q5XIA2 (SUZ domain-containing protein 1) with a FATCAT P-Value: 2.04e-10 and RMSD of 2.64 angstrom. The sequence alignment identity is 97.4%.
Structural alignment shown in left. Query protein Q7Z422 colored as red in alignment, homolog Q5XIA2 colored as blue. Query protein Q7Z422 is also shown in right top, homolog Q5XIA2 showed in right bottom. They are colored based on secondary structures. 

  Q7Z422 MEDEEVAESWEEAADSGEIDRRLEKKLKITQKESRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSNGVVSSPNSTSRPTLPVKSLAQREAEYAEARK 100
  Q5XIA2 MEDEEVAESWEEAADSGEIDRRLEKKLKITQKESRKSKSPPKVPIVIQDDSLPTGPPPQIRILKRPTSNGVVSSPNSTSRPALPVKSLAQREAEYAEARR 100

  Q7Z422 RILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPLGPDGSQGFKQRR 152
  Q5XIA2 RILGSASPEEEQEKPILDRPTRISQPEDSRQPSNVIRQPLGPDGSQGFKQRR 152

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0042025 host cell nucleus
2. P GO:0046718 viral entry into host cell
2. P GO:0030474 spindle pole body duplication
2. P GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0005694 chromosome
2. P GO:0005634 nucleus
2. P GO:0075732 viral penetration into host nucleus
2. P GO:0005816 spindle pole body
2. P GO:0005200 structural constituent of cytoskeleton
2. P GO:0030686 90S preribosome
2. P GO:0000349 generation of catalytic spliceosome for first transesterification step
2. P GO:0003723 RNA binding
2. P GO:0000469 cleavage involved in rRNA processing
2. P GO:0005730 nucleolus
2. P GO:0005681 spliceosomal complex
2. P GO:0005823 central plaque of spindle pole body
2. P GO:0046540 U4/U6 x U5 tri-snRNP complex

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q2KI04 SUZ domain-containing protein 1 3.62e-04 5.87e-133 1.38e-101
1. PB Q5RE12 SUZ domain-containing protein 1 6.53e-10 2.64e-140 5.61e-103
1. PB Q6GR00 SUZ domain-containing protein 1 3.89e-09 7.58e-75 8.52e-84
1. PB Q6P320 SUZ domain-containing protein 1 1.42e-06 8.29e-88 2.69e-89
1. PB Q504E7 SUZ domain-containing protein 1 1.30e-05 3.48e-49 1.18e-57
1. PB Q5XIA2 SUZ domain-containing protein 1 2.04e-10 3.46e-130 4.99e-101
1. PB Q6NXN1 SUZ domain-containing protein 1 5.23e-06 3.46e-130 4.99e-101
1. PB Q5ZK25 SUZ domain-containing protein 1 9.40e-09 1.03e-104 3.49e-98
1. PB Q7Z422 SUZ domain-containing protein 1 0 7.15e-167 8.88e-104
2. P P38282 Pre-mRNA-splicing factor SPP381 2.60e-01 2.49e-02 NA
2. P E7QAA9 Spindle pole component 29 2.60e-01 9.68e-03 NA
2. P Q2YDG1 Transmembrane protein 247 1.99e-01 3.64e-02 NA
2. P A6ZWC8 Spindle pole component 29 2.87e-01 9.68e-03 NA
2. P C8ZIQ5 Spindle pole component 29 2.35e-01 5.59e-03 NA
2. P A7TEH5 Pre-mRNA-splicing factor SPP381 2.81e-01 7.60e-04 NA
2. P P0C6L3 Small delta antigen NA 2.62e-02 NA
2. P E7KVI3 Spindle pole component 29 2.07e-01 5.59e-03 NA
2. P Q8CIL4 Uncharacterized protein C1orf131 homolog 3.49e-01 1.43e-04 NA
2. P B6HGB5 rRNA biogenesis protein rrp36 3.67e-01 4.96e-02 NA
2. P P0DTC0 Small delta antigen NA 1.42e-02 NA
2. P E7M1C7 Spindle pole component 29 3.36e-01 5.59e-03 NA
2. P C7GJ78 Spindle pole component 29 1.90e-01 5.59e-03 NA
2. P B5VT41 Spindle pole component 29 3.03e-01 5.59e-03 NA
2. P B3LKV0 Spindle pole component 29 3.76e-01 5.59e-03 NA
2. P P33419 Spindle pole component 29 1.78e-01 5.59e-03 NA
2. P E7QLB7 Spindle pole component 29 NA 5.31e-03 NA
2. P A3LP95 rRNA biogenesis protein RRP36 2.92e-01 1.51e-02 NA
2. P Q3KRF3 Uncharacterized protein C1orf131 homolog 4.86e-01 3.94e-02 NA
2. P Q9BTA0 Protein FAM167B 1.30e-01 4.68e-02 NA
2. P Q9P6P2 rRNA biogenesis protein rrp36 1.72e-01 3.61e-02 NA