Results | PROST

Summary

Q7Z5U6

Homolog: P23232.
Function: Guanine nucleotide-binding protein subunit beta.

Statistics

Total GO Annotation: 718
Unique PROST Go: 205
Unique BLAST Go: 420

Total Homologs: 1076
Unique PROST Homologs: 413
Unique BLAST Homologs: 587

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was P23232 (Guanine nucleotide-binding protein subunit beta) with a FATCAT P-Value: 0.0 and RMSD of 2.30 angstrom. The sequence alignment identity is 19.8%.
Structural alignment shown in left. Query protein Q7Z5U6 colored as red in alignment, homolog P23232 colored as blue. Query protein Q7Z5U6 is also shown in right top, homolog P23232 showed in right bottom. They are colored based on secondary structures.

  Q7Z5U6 ---------------------------------------------MAVKWT-GGHSSPVLCLN-AS-KEGLLASGAEGGDLTAWGEDGTPLGHTRFQGAD 52
  P23232 MTSELEALRQETEQLKNQIREARKAAADTTLAMATANVEPVGRIQMRTRRTLRGHLAKIYAMHWASDSRNLV-SASQDGKLIVW--D----GYT----TN 89

  Q7Z5U6 DVTSV-LFSP---SCPTKLYASHGETISVLDVRSLKDSLDHFHVNEEEINCLSLNQTENLLASADDSGAIKILDLENKKVIRSLKRHSNI--CSSVAFRP 146
  P23232 KVHAIPLRSSWVMTC---AYAPSGNYVAC-------GGLD----N---I-C-SIYS----LKTRE--G--------NVRVSRELPGHTGYLSCCR--FID 154

  Q7Z5U6 QRPQSLVSCGLDMQVMLWSLQKARPLWITNLQEDETEEMEGPQSPGQLLNPALAHSISVASCGNIFSCGAEDGKVRIFRVM-GVKCEQELGFKGHTSGVS 245
  P23232 DN-QIVTSSG-DMTCALWNIETGNQ--ITSF---------GGHT-GDVMSLSLAPDMRTFVSG---AC---DASAKLFDIRDGI-CKQ--TFTGHESDIN 231

  Q7Z5U6 QVCFLPESYLLLTGGNDGKITLWDANSEVEKKQKSPTKRTHRKKPKRGTCTKQGGNTNASVTDEEEHGNILPKLNIEHG-EKVN---W-LL-----GTKI 335
  P23232 AITYFPNGFAFATGSDDATCRLFDIRADQEIGMYS-----H----DNIIC----GITSVAFS---KSGRLL--LG---GYDDFNCNVWDVLKQERAGV-L 309

  Q7Z5U6 KGHQNILVADQTSCISVYPLNEF----------------- 358
  P23232 AGHDN-----RVSCLGV---TEDGMAVATGSWDSFLKIWN 341

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0031932	TORC2 complex
1. PB	GO:1990147	talin binding
1. PB	GO:0051028	mRNA transport
1. PB	GO:0000346	transcription export complex
1. PB	GO:0001934	positive regulation of protein phosphorylation
1. PB	GO:0005643	nuclear pore
1. PB	GO:0008283	cell population proliferation
1. PB	GO:0005080	protein kinase C binding
1. PB	GO:0006325	chromatin organization
1. PB	GO:0006406	mRNA export from nucleus
1. PB	GO:0070734	histone H3-K27 methylation
1. PB	GO:0033186	CAF-1 complex
1. PB	GO:0016567	protein ubiquitination
1. PB	GO:0030687	preribosome, large subunit precursor
1. PB	GO:0034399	nuclear periphery
1. PB	GO:0032956	regulation of actin cytoskeleton organization
1. PB	GO:0016558	protein import into peroxisome matrix
1. PB	GO:0043022	ribosome binding
1. PB	GO:0005677	chromatin silencing complex
1. PB	GO:0005737	cytoplasm
1. PB	GO:0001895	retina homeostasis
1. PB	GO:0051301	cell division
1. PB	GO:0005847	mRNA cleavage and polyadenylation specificity factor complex
1. PB	GO:0032040	small-subunit processome
1. PB	GO:0035859	Seh1-associated complex
1. PB	GO:0006335	DNA replication-dependent chromatin assembly
1. PB	GO:0005782	peroxisomal matrix
1. PB	GO:0030036	actin cytoskeleton organization
1. PB	GO:0003735	structural constituent of ribosome
1. PB	GO:0000922	spindle pole
1. PB	GO:0061700	GATOR2 complex
1. PB	GO:0005198	structural molecule activity
1. PB	GO:0031252	cell leading edge
1. PB	GO:0005886	plasma membrane
1. PB	GO:0031931	TORC1 complex
1. PB	GO:1904263	positive regulation of TORC1 signaling
1. PB	GO:0030030	cell projection organization
1. PB	GO:0035098	ESC/E(Z) complex
1. PB	GO:0009845	seed germination
1. PB	GO:0048188	Set1C/COMPASS complex
1. PB	GO:0090114	COPII-coated vesicle budding
1. PB	GO:0005730	nucleolus
1. PB	GO:0035097	histone methyltransferase complex
1. PB	GO:0031080	nuclear pore outer ring
1. PB	GO:0008608	attachment of spindle microtubules to kinetochore
1. PB	GO:0097361	CIA complex
1. PB	GO:0034501	protein localization to kinetochore
1. PB	GO:0009967	positive regulation of signal transduction
1. PB	GO:0008611	ether lipid biosynthetic process
1. PB	GO:0005053	peroxisome matrix targeting signal-2 binding
1. PB	GO:0043130	ubiquitin binding
1. PB	GO:0090696	post-embryonic plant organ development
1. PB	GO:0032527	protein exit from endoplasmic reticulum
1. PB	GO:0005078	MAP-kinase scaffold activity
1. PB	GO:0071215	cellular response to abscisic acid stimulus
1. PB	GO:0051568	histone H3-K4 methylation
1. PB	GO:1903003	positive regulation of protein deubiquitination
1. PB	GO:0000209	protein polyubiquitination
1. PB	GO:0042273	ribosomal large subunit biogenesis
1. PB	GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
1. PB	GO:0031507	heterochromatin assembly
1. PB	GO:0009968	negative regulation of signal transduction
1. PB	GO:0000375	RNA splicing, via transesterification reactions
1. PB	GO:0005634	nucleus
1. PB	GO:0007099	centriole replication
1. PB	GO:0036064	ciliary basal body
1. PB	GO:0080008	Cul4-RING E3 ubiquitin ligase complex
1. PB	GO:0001891	phagocytic cup
1. PB	GO:0000445	THO complex part of transcription export complex
1. PB	GO:0031464	Cul4A-RING E3 ubiquitin ligase complex
1. PB	GO:0080135	regulation of cellular response to stress
1. PB	GO:0000347	THO complex
1. PB	GO:0051015	actin filament binding
1. PB	GO:0046784	viral mRNA export from host cell nucleus
1. PB	GO:0030127	COPII vesicle coat
1. PB	GO:0005814	centriole
1. PB	GO:0045943	positive regulation of transcription by RNA polymerase I
1. PB	GO:0080182	histone H3-K4 trimethylation
1. PB	GO:0008380	RNA splicing
1. PB	GO:0031929	TOR signaling
1. PB	GO:0032008	positive regulation of TOR signaling
1. PB	GO:0032991	protein-containing complex
1. PB	GO:0005829	cytosol
1. PB	GO:0046872	metal ion binding
1. PB	GO:0006606	protein import into nucleus
1. PB	GO:0006364	rRNA processing
1. PB	GO:0016243	regulation of autophagosome size
1. PB	GO:0016607	nuclear speck
1. PB	GO:0000776	kinetochore
1. PB	GO:0072344	rescue of stalled ribosome
1. PB	GO:1904950	negative regulation of establishment of protein localization
1. PB	GO:1901796	regulation of signal transduction by p53 class mediator
1. PB	GO:0005654	nucleoplasm
2. P	GO:2001125	negative regulation of translational frameshifting
2. P	GO:2000728	regulation of mRNA export from nucleus in response to heat stress
2. P	GO:0034314	Arp2/3 complex-mediated actin nucleation
2. P	GO:0005768	endosome
2. P	GO:0032258	cytoplasm to vacuole transport by the Cvt pathway
2. P	GO:0043029	T cell homeostasis
2. P	GO:0016973	poly(A)+ mRNA export from nucleus
2. P	GO:0007094	mitotic spindle assembly checkpoint signaling
2. P	GO:0043614	multi-eIF complex
2. P	GO:0048873	homeostasis of number of cells within a tissue
2. P	GO:0007080	mitotic metaphase plate congression
2. P	GO:0030174	regulation of DNA-dependent DNA replication initiation
2. P	GO:0000422	autophagy of mitochondrion
2. P	GO:0036195	muscle cell projection membrane
2. P	GO:0061908	phagophore
2. P	GO:0006267	pre-replicative complex assembly involved in nuclear cell cycle DNA replication
2. P	GO:0042800	histone methyltransferase activity (H3-K4 specific)
2. P	GO:1990893	mitotic chromosome centromere condensation
2. P	GO:0010008	endosome membrane
2. P	GO:0009524	phragmoplast
2. P	GO:0003743	translation initiation factor activity
2. P	GO:0071353	cellular response to interleukin-4
2. P	GO:0032045	guanyl-nucleotide exchange factor complex
2. P	GO:0032456	endocytic recycling
2. P	GO:0038202	TORC1 signaling
2. P	GO:0033290	eukaryotic 48S preinitiation complex
2. P	GO:1905861	intranuclear rod assembly
2. P	GO:0000159	protein phosphatase type 2A complex
2. P	GO:0001825	blastocyst formation
2. P	GO:0005656	nuclear pre-replicative complex
2. P	GO:0032796	uropod organization
2. P	GO:0061502	early endosome to recycling endosome transport
2. P	GO:0051321	meiotic cell cycle
2. P	GO:0002091	negative regulation of receptor internalization
2. P	GO:1903673	mitotic cleavage furrow formation
2. P	GO:0038203	TORC2 signaling
2. P	GO:0000329	fungal-type vacuole membrane
2. P	GO:0016070	RNA metabolic process
2. P	GO:0009855	determination of bilateral symmetry
2. P	GO:0003431	growth plate cartilage chondrocyte development
2. P	GO:0000972	transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery
2. P	GO:0032781	positive regulation of ATP-dependent activity
2. P	GO:0120293	dynein axonemal particle
2. P	GO:0030838	positive regulation of actin filament polymerization
2. P	GO:0045324	late endosome to vacuole transport
2. P	GO:0001673	male germ cell nucleus
2. P	GO:0000176	nuclear exosome (RNase complex)
2. P	GO:0016226	iron-sulfur cluster assembly
2. P	GO:0001674	female germ cell nucleus
2. P	GO:0006413	translational initiation
2. P	GO:0007059	chromosome segregation
2. P	GO:0022618	ribonucleoprotein complex assembly
2. P	GO:0000012	single strand break repair
2. P	GO:0006283	transcription-coupled nucleotide-excision repair
2. P	GO:0005774	vacuolar membrane
2. P	GO:0006397	mRNA processing
2. P	GO:0071540	eukaryotic translation initiation factor 3 complex, eIF3e
2. P	GO:0034145	positive regulation of toll-like receptor 4 signaling pathway
2. P	GO:0070273	phosphatidylinositol-4-phosphate binding
2. P	GO:0051315	attachment of mitotic spindle microtubules to kinetochore
2. P	GO:0030595	leukocyte chemotaxis
2. P	GO:0048571	long-day photoperiodism
2. P	GO:0000387	spliceosomal snRNP assembly
2. P	GO:0080025	phosphatidylinositol-3,5-bisphosphate binding
2. P	GO:0030277	maintenance of gastrointestinal epithelium
2. P	GO:0043320	natural killer cell degranulation
2. P	GO:0006405	RNA export from nucleus
2. P	GO:0030242	autophagy of peroxisome
2. P	GO:0001403	invasive growth in response to glucose limitation
2. P	GO:0016282	eukaryotic 43S preinitiation complex
2. P	GO:0000324	fungal-type vacuole
2. P	GO:0043078	polar nucleus
2. P	GO:0043527	tRNA methyltransferase complex
2. P	GO:0033597	mitotic checkpoint complex
2. P	GO:0001732	formation of cytoplasmic translation initiation complex
2. P	GO:0000109	nucleotide-excision repair complex
2. P	GO:0097428	protein maturation by iron-sulfur cluster transfer
2. P	GO:0061586	positive regulation of transcription by transcription factor localization
2. P	GO:0019898	extrinsic component of membrane
2. P	GO:0061739	protein lipidation involved in autophagosome assembly
2. P	GO:0010506	regulation of autophagy
2. P	GO:0000407	phagophore assembly site
2. P	GO:0036093	germ cell proliferation
2. P	GO:0015031	protein transport
2. P	GO:0061802	anterior cell cortex
2. P	GO:0031139	positive regulation of conjugation with cellular fusion
2. P	GO:0006914	autophagy
2. P	GO:0030488	tRNA methylation
2. P	GO:0062078	TSC1-TSC2 complex binding
2. P	GO:0044805	late nucleophagy
2. P	GO:0005545	1-phosphatidylinositol binding
2. P	GO:0000380	alternative mRNA splicing, via spliceosome
2. P	GO:0034141	positive regulation of toll-like receptor 3 signaling pathway
2. P	GO:0042058	regulation of epidermal growth factor receptor signaling pathway
2. P	GO:0002183	cytoplasmic translational initiation
2. P	GO:0031339	negative regulation of vesicle fusion
2. P	GO:0090594	inflammatory response to wounding
2. P	GO:0030864	cortical actin cytoskeleton
2. P	GO:0061365	positive regulation of triglyceride lipase activity
2. P	GO:0006999	nuclear pore organization
2. P	GO:0048477	oogenesis
2. P	GO:0051169	nuclear transport
2. P	GO:1904594	regulation of termination of RNA polymerase II transcription
2. P	GO:0010314	phosphatidylinositol-5-phosphate binding
2. P	GO:0070262	peptidyl-serine dephosphorylation
2. P	GO:0051983	regulation of chromosome segregation
2. P	GO:1990298	bub1-bub3 complex
2. P	GO:0030659	cytoplasmic vesicle membrane
2. P	GO:0006624	vacuolar protein processing
2. P	GO:0016236	macroautophagy
2. P	GO:0007015	actin filament organization
2. P	GO:0032426	stereocilium tip
2. P	GO:0050918	positive chemotaxis
2. P	GO:0061803	posterior cell cortex
2. P	GO:0050870	positive regulation of T cell activation
2. P	GO:0036284	tubulobulbar complex
2. P	GO:1903341	regulation of meiotic DNA double-strand break formation
2. P	GO:0015629	actin cytoskeleton
2. P	GO:0030670	phagocytic vesicle membrane
2. P	GO:0071541	eukaryotic translation initiation factor 3 complex, eIF3m
2. P	GO:0070286	axonemal dynein complex assembly
2. P	GO:0043521	regulation of myosin II filament disassembly
2. P	GO:0030331	estrogen receptor binding
2. P	GO:0072357	PTW/PP1 phosphatase complex
2. P	GO:0005764	lysosome
2. P	GO:0030685	nucleolar preribosome
2. P	GO:0032036	myosin heavy chain binding
2. P	GO:0031589	cell-substrate adhesion
2. P	GO:0005092	GDP-dissociation inhibitor activity
2. P	GO:0090326	positive regulation of locomotion involved in locomotory behavior
2. P	GO:0070772	PAS complex
2. P	GO:0035861	site of double-strand break
2. P	GO:0044090	positive regulation of vacuole organization
2. P	GO:0009267	cellular response to starvation
2. P	GO:0034727	piecemeal microautophagy of the nucleus
2. P	GO:1904811	positive regulation of dense core granule transport
2. P	GO:0048367	shoot system development
2. P	GO:1902801	regulation of siRNA-independent facultative heterochromatin assembly
2. P	GO:1990447	U2 snRNP binding
2. P	GO:0051126	negative regulation of actin nucleation
2. P	GO:1902184	negative regulation of shoot apical meristem development
2. P	GO:0006497	protein lipidation
2. P	GO:0019888	protein phosphatase regulator activity
2. P	GO:0008092	cytoskeletal protein binding
2. P	GO:0000045	autophagosome assembly
2. P	GO:0001772	immunological synapse
2. P	GO:1901981	phosphatidylinositol phosphate binding
2. P	GO:0070912	Ddb1-Ckn1 complex
2. P	GO:0002188	translation reinitiation
2. P	GO:0043548	phosphatidylinositol 3-kinase binding
2. P	GO:0005765	lysosomal membrane
2. P	GO:0035077	ecdysone-mediated polytene chromosome puffing
2. P	GO:0140499	negative regulation of mitotic spindle assembly checkpoint signaling
2. P	GO:0006909	phagocytosis
2. P	GO:1903138	negative regulation of cell wall integrity MAPK cascade
2. P	GO:0030182	neuron differentiation
2. P	GO:0000070	mitotic sister chromatid segregation
2. P	GO:0034045	phagophore assembly site membrane
2. P	GO:0009960	endosperm development
2. P	GO:0003682	chromatin binding
2. P	GO:0005852	eukaryotic translation initiation factor 3 complex
2. P	GO:0010973	positive regulation of division septum assembly
2. P	GO:0048203	vesicle targeting, trans-Golgi to endosome
2. P	GO:0008270	zinc ion binding
2. P	GO:1900091	regulation of raffinose biosynthetic process
2. P	GO:0106143	tRNA (m7G46) methyltransferase complex
2. P	GO:0034719	SMN-Sm protein complex
2. P	GO:0005769	early endosome
2. P	GO:0042102	positive regulation of T cell proliferation
2. P	GO:0097680	double-strand break repair via classical nonhomologous end joining
2. P	GO:0036265	RNA (guanine-N7)-methylation
2. P	GO:1905281	positive regulation of retrograde transport, endosome to Golgi
2. P	GO:0034497	protein localization to phagophore assembly site
2. P	GO:0038180	nerve growth factor signaling pathway
2. P	GO:0106004	tRNA (guanine-N7)-methylation
2. P	GO:0005776	autophagosome
2. P	GO:0098792	xenophagy
2. P	GO:0080186	developmental vegetative growth
2. P	GO:0050681	androgen receptor binding
2. P	GO:0045739	positive regulation of DNA repair
2. P	GO:0000781	chromosome, telomeric region
2. P	GO:1990567	DPS complex
2. P	GO:0034629
2. P	GO:0045793	positive regulation of cell size
2. P	GO:0061685	diphthine methylesterase activity
2. P	GO:0003779	actin binding
2. P	GO:0032797	SMN complex
2. P	GO:0016006	Nebenkern
2. P	GO:0097344	Rix1 complex
2. P	GO:0001845	phagolysosome assembly
2. P	GO:0034198	cellular response to amino acid starvation
2. P	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
2. P	GO:0005885	Arp2/3 protein complex
2. P	GO:0010476	gibberellin mediated signaling pathway
2. P	GO:0016050	vesicle organization
2. P	GO:0017183	peptidyl-diphthamide biosynthetic process from peptidyl-histidine
2. P	GO:0032266	phosphatidylinositol-3-phosphate binding
2. P	GO:0045335	phagocytic vesicle
2. P	GO:0008064	regulation of actin polymerization or depolymerization
2. P	GO:1900088	regulation of inositol biosynthetic process
2. P	GO:0051279	regulation of release of sequestered calcium ion into cytosol
2. P	GO:0044804	autophagy of nucleus
2. P	GO:1990942	mitotic metaphase chromosome recapture
2. P	GO:0003785	actin monomer binding
2. P	GO:0010231	maintenance of seed dormancy
3. B	GO:0021540	corpus callosum morphogenesis
3. B	GO:0006336	DNA replication-independent chromatin assembly
3. B	GO:1902510	regulation of apoptotic DNA fragmentation
3. B	GO:0005770	late endosome
3. B	GO:0019226	transmission of nerve impulse
3. B	GO:0000244	spliceosomal tri-snRNP complex assembly
3. B	GO:0008610	lipid biosynthetic process
3. B	GO:0005874	microtubule
3. B	GO:0000122	negative regulation of transcription by RNA polymerase II
3. B	GO:0006368	transcription elongation from RNA polymerase II promoter
3. B	GO:1902610	response to N-phenylthiourea
3. B	GO:1901800	positive regulation of proteasomal protein catabolic process
3. B	GO:0006338	chromatin remodeling
3. B	GO:2000543	positive regulation of gastrulation
3. B	GO:0008327	methyl-CpG binding
3. B	GO:0031062	positive regulation of histone methylation
3. B	GO:0031965	nuclear membrane
3. B	GO:0019903	protein phosphatase binding
3. B	GO:2000234	positive regulation of rRNA processing
3. B	GO:0008017	microtubule binding
3. B	GO:0009553	embryo sac development
3. B	GO:0008344	adult locomotory behavior
3. B	GO:0004842	ubiquitin-protein transferase activity
3. B	GO:0031313	extrinsic component of endosome membrane
3. B	GO:0032420	stereocilium
3. B	GO:0050885	neuromuscular process controlling balance
3. B	GO:0045722	positive regulation of gluconeogenesis
3. B	GO:0035264	multicellular organism growth
3. B	GO:0005869	dynactin complex
3. B	GO:0043224	nuclear SCF ubiquitin ligase complex
3. B	GO:0006342
3. B	GO:0006337	nucleosome disassembly
3. B	GO:0016571	histone methylation
3. B	GO:0044255	cellular lipid metabolic process
3. B	GO:0016579	protein deubiquitination
3. B	GO:0007634	optokinetic behavior
3. B	GO:0071217	cellular response to external biotic stimulus
3. B	GO:0007283	spermatogenesis
3. B	GO:0017053	transcription repressor complex
3. B	GO:0043025	neuronal cell body
3. B	GO:0061883	clathrin-dependent endocytosis involved in vitellogenesis
3. B	GO:0070840	dynein complex binding
3. B	GO:2001162	positive regulation of histone H3-K79 methylation
3. B	GO:1905168	positive regulation of double-strand break repair via homologous recombination
3. B	GO:0005826	actomyosin contractile ring
3. B	GO:0072520	seminiferous tubule development
3. B	GO:0051649	establishment of localization in cell
3. B	GO:0090181	regulation of cholesterol metabolic process
3. B	GO:0005671	obsolete Ada2/Gcn5/Ada3 transcription activator complex
3. B	GO:0045138	nematode male tail tip morphogenesis
3. B	GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process
3. B	GO:0050765	negative regulation of phagocytosis
3. B	GO:0051539	4 iron, 4 sulfur cluster binding
3. B	GO:0006367	transcription initiation from RNA polymerase II promoter
3. B	GO:0006886	intracellular protein transport
3. B	GO:0061003	positive regulation of dendritic spine morphogenesis
3. B	GO:0017145	stem cell division
3. B	GO:0000349	generation of catalytic spliceosome for first transesterification step
3. B	GO:0005819	spindle
3. B	GO:0001667	ameboidal-type cell migration
3. B	GO:0010154	fruit development
3. B	GO:0048814	regulation of dendrite morphogenesis
3. B	GO:0048511	rhythmic process
3. B	GO:0031037	myosin II filament disassembly
3. B	GO:0045638	negative regulation of myeloid cell differentiation
3. B	GO:0005834	heterotrimeric G-protein complex
3. B	GO:0030425	dendrite
3. B	GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
3. B	GO:0030496	midbody
3. B	GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0000123	histone acetyltransferase complex
3. B	GO:2000217	regulation of invasive growth in response to glucose limitation
3. B	GO:0048527	lateral root development
3. B	GO:0031682	G-protein gamma-subunit binding
3. B	GO:0010629	negative regulation of gene expression
3. B	GO:0000118	histone deacetylase complex
3. B	GO:0048383	mesectoderm development
3. B	GO:0030515	snoRNA binding
3. B	GO:0005789	endoplasmic reticulum membrane
3. B	GO:0031592	centrosomal corona
3. B	GO:0035064	methylated histone binding
3. B	GO:0005681	spliceosomal complex
3. B	GO:1905301	regulation of macropinocytosis
3. B	GO:0051012	microtubule sliding
3. B	GO:0034388	Pwp2p-containing subcomplex of 90S preribosome
3. B	GO:0030971	receptor tyrosine kinase binding
3. B	GO:0001764	neuron migration
3. B	GO:0030157	pancreatic juice secretion
3. B	GO:0016905	myosin heavy chain kinase activity
3. B	GO:0030178	negative regulation of Wnt signaling pathway
3. B	GO:0071339	MLL1 complex
3. B	GO:0007312	oocyte nucleus migration involved in oocyte dorsal/ventral axis specification
3. B	GO:0032350	regulation of hormone metabolic process
3. B	GO:0034452	dynactin binding
3. B	GO:0005840	ribosome
3. B	GO:0005525	GTP binding
3. B	GO:0010992	ubiquitin recycling
3. B	GO:0007294	germarium-derived oocyte fate determination
3. B	GO:0071007	U2-type catalytic step 2 spliceosome
3. B	GO:1903146	regulation of autophagy of mitochondrion
3. B	GO:0015630	microtubule cytoskeleton
3. B	GO:0016575	histone deacetylation
3. B	GO:0045495	pole plasm
3. B	GO:0008352	katanin complex
3. B	GO:0051299	centrosome separation
3. B	GO:0030120	vesicle coat
3. B	GO:0047391	alkylglycerophosphoethanolamine phosphodiesterase activity
3. B	GO:0000974	Prp19 complex
3. B	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0017166	vinculin binding
3. B	GO:0051443	positive regulation of ubiquitin-protein transferase activity
3. B	GO:0042304	regulation of fatty acid biosynthetic process
3. B	GO:0005662	DNA replication factor A complex
3. B	GO:0043588	skin development
3. B	GO:0008013	beta-catenin binding
3. B	GO:0005635	nuclear envelope
3. B	GO:0071333	cellular response to glucose stimulus
3. B	GO:0043982	histone H4-K8 acetylation
3. B	GO:0040013	negative regulation of locomotion
3. B	GO:0031568	mitotic G1 cell size control checkpoint signaling
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0051434	BH3 domain binding
3. B	GO:0051081	nuclear membrane disassembly
3. B	GO:0003380	establishment or maintenance of cytoskeleton polarity involved in gastrulation
3. B	GO:0010214	seed coat development
3. B	GO:0030374	nuclear receptor coactivator activity
3. B	GO:0000245	spliceosomal complex assembly
3. B	GO:0010026	trichome differentiation
3. B	GO:0071870	cellular response to catecholamine stimulus
3. B	GO:0051510	regulation of unidimensional cell growth
3. B	GO:0043966	histone H3 acetylation
3. B	GO:0048568	embryonic organ development
3. B	GO:0048872	homeostasis of number of cells
3. B	GO:1990716	axonemal central apparatus
3. B	GO:0001675	acrosome assembly
3. B	GO:1901386	negative regulation of voltage-gated calcium channel activity
3. B	GO:0003714	transcription corepressor activity
3. B	GO:0048545	response to steroid hormone
3. B	GO:0030723	ovarian fusome organization
3. B	GO:0007298	border follicle cell migration
3. B	GO:0045741	positive regulation of epidermal growth factor-activated receptor activity
3. B	GO:0055087	Ski complex
3. B	GO:0045542	positive regulation of cholesterol biosynthetic process
3. B	GO:0007052	mitotic spindle organization
3. B	GO:0001826	inner cell mass cell differentiation
3. B	GO:0034396	negative regulation of transcription from RNA polymerase II promoter in response to iron
3. B	GO:0006891	intra-Golgi vesicle-mediated transport
3. B	GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:1902525	regulation of protein monoubiquitination
3. B	GO:0007097	nuclear migration
3. B	GO:0002244	hematopoietic progenitor cell differentiation
3. B	GO:0033276	transcription factor TFTC complex
3. B	GO:0007019	microtubule depolymerization
3. B	GO:2001224	positive regulation of neuron migration
3. B	GO:0007281	germ cell development
3. B	GO:0005815	microtubule organizing center
3. B	GO:1904672	regulation of somatic stem cell population maintenance
3. B	GO:0070534	protein K63-linked ubiquitination
3. B	GO:2001244	positive regulation of intrinsic apoptotic signaling pathway
3. B	GO:0061630	ubiquitin protein ligase activity
3. B	GO:0051642	centrosome localization
3. B	GO:0009585	red, far-red light phototransduction
3. B	GO:0043005	neuron projection
3. B	GO:0031616	spindle pole centrosome
3. B	GO:0030308	negative regulation of cell growth
3. B	GO:0031023	microtubule organizing center organization
3. B	GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0007219	Notch signaling pathway
3. B	GO:0008203	cholesterol metabolic process
3. B	GO:0005848	mRNA cleavage stimulating factor complex
3. B	GO:0032933	SREBP signaling pathway
3. B	GO:0007212	dopamine receptor signaling pathway
3. B	GO:0042622	photoreceptor outer segment membrane
3. B	GO:0060770	negative regulation of epithelial cell proliferation involved in prostate gland development
3. B	GO:2001205	negative regulation of osteoclast development
3. B	GO:0051664	nuclear pore localization
3. B	GO:0060590	ATPase regulator activity
3. B	GO:0009560	embryo sac egg cell differentiation
3. B	GO:0045159	myosin II binding
3. B	GO:0051219	phosphoprotein binding
3. B	GO:0048026	positive regulation of mRNA splicing, via spliceosome
3. B	GO:0051225	spindle assembly
3. B	GO:0043984	histone H4-K16 acetylation
3. B	GO:0035220	wing disc development
3. B	GO:0051901	positive regulation of mitochondrial depolarization
3. B	GO:0032430	positive regulation of phospholipase A2 activity
3. B	GO:0046662	regulation of oviposition
3. B	GO:1903362	regulation of cellular protein catabolic process
3. B	GO:0009909	regulation of flower development
3. B	GO:0090660	cerebrospinal fluid circulation
3. B	GO:0007026	negative regulation of microtubule depolymerization
3. B	GO:0033137	negative regulation of peptidyl-serine phosphorylation
3. B	GO:0043551	regulation of phosphatidylinositol 3-kinase activity
3. B	GO:1990630	IRE1-RACK1-PP2A complex
3. B	GO:0007611	learning or memory
3. B	GO:0034514	mitochondrial unfolded protein response
3. B	GO:0010393	galacturonan metabolic process
3. B	GO:0000226	microtubule cytoskeleton organization
3. B	GO:0046329	negative regulation of JNK cascade
3. B	GO:0060465	pharynx development
3. B	GO:0071363	cellular response to growth factor stimulus
3. B	GO:0030332	cyclin binding
3. B	GO:0090176	microtubule cytoskeleton organization involved in establishment of planar polarity
3. B	GO:0016593	Cdc73/Paf1 complex
3. B	GO:1902066	regulation of cell wall pectin metabolic process
3. B	GO:0005828	kinetochore microtubule
3. B	GO:0016230	sphingomyelin phosphodiesterase activator activity
3. B	GO:0060027	convergent extension involved in gastrulation
3. B	GO:0043087	regulation of GTPase activity
3. B	GO:0001961	positive regulation of cytokine-mediated signaling pathway
3. B	GO:0031334	positive regulation of protein-containing complex assembly
3. B	GO:0016021	integral component of membrane
3. B	GO:0060290	transdifferentiation
3. B	GO:0016581	NuRD complex
3. B	GO:0031514	motile cilium
3. B	GO:0005875	microtubule associated complex
3. B	GO:0030513	positive regulation of BMP signaling pathway
3. B	GO:0030663	COPI-coated vesicle membrane
3. B	GO:0005813	centrosome
3. B	GO:1904951	positive regulation of establishment of protein localization
3. B	GO:0007186	G protein-coupled receptor signaling pathway
3. B	GO:0097525	spliceosomal snRNP complex
3. B	GO:0030621	U4 snRNA binding
3. B	GO:0090207	regulation of triglyceride metabolic process
3. B	GO:0070507	regulation of microtubule cytoskeleton organization
3. B	GO:0031124	mRNA 3'-end processing
3. B	GO:0012507	ER to Golgi transport vesicle membrane
3. B	GO:0030117	membrane coat
3. B	GO:0015631	tubulin binding
3. B	GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process
3. B	GO:2000653	regulation of genetic imprinting
3. B	GO:0005938	cell cortex
3. B	GO:0030674	protein-macromolecule adaptor activity
3. B	GO:0048364	root development
3. B	GO:0034450	ubiquitin-ubiquitin ligase activity
3. B	GO:0031497	chromatin assembly
3. B	GO:0035327
3. B	GO:0047496	vesicle transport along microtubule
3. B	GO:0051013	microtubule severing
3. B	GO:0031902	late endosome membrane
3. B	GO:0046843	dorsal appendage formation
3. B	GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
3. B	GO:0048096
3. B	GO:0046469	platelet activating factor metabolic process
3. B	GO:0006693	prostaglandin metabolic process
3. B	GO:0030426	growth cone
3. B	GO:0044877	protein-containing complex binding
3. B	GO:0005576	extracellular region
3. B	GO:0005700	polytene chromosome
3. B	GO:0051343	positive regulation of cyclic-nucleotide phosphodiesterase activity
3. B	GO:0016319	mushroom body development
3. B	GO:1903467	negative regulation of mitotic DNA replication initiation
3. B	GO:1900045	negative regulation of protein K63-linked ubiquitination
3. B	GO:0007405	neuroblast proliferation
3. B	GO:0030914
3. B	GO:0010968	regulation of microtubule nucleation
3. B	GO:0008247	1-alkyl-2-acetylglycerophosphocholine esterase complex
3. B	GO:0005524	ATP binding
3. B	GO:0007303	cytoplasmic transport, nurse cell to oocyte
3. B	GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation
3. B	GO:0060256	regulation of flocculation
3. B	GO:0034511	U3 snoRNA binding
3. B	GO:0019005	SCF ubiquitin ligase complex
3. B	GO:0001650	fibrillar center
3. B	GO:2000114	regulation of establishment of cell polarity
3. B	GO:0042826	histone deacetylase binding
3. B	GO:0046540	U4/U6 x U5 tri-snRNP complex
3. B	GO:0040035	hermaphrodite genitalia development
3. B	GO:0071005	U2-type precatalytic spliceosome
3. B	GO:0045879	negative regulation of smoothened signaling pathway
3. B	GO:0009792	embryo development ending in birth or egg hatching
3. B	GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
3. B	GO:0051571	positive regulation of histone H3-K4 methylation
3. B	GO:0006412	translation
3. B	GO:0050909	sensory perception of taste
3. B	GO:0043547	positive regulation of GTPase activity
3. B	GO:0016589	NURF complex
3. B	GO:2000280	regulation of root development
3. B	GO:0001198	negative regulation of mating-type specific transcription from RNA polymerase II promoter
3. B	GO:0008298	intracellular mRNA localization
3. B	GO:0016005	phospholipase A2 activator activity
3. B	GO:0048711	positive regulation of astrocyte differentiation
3. B	GO:0051130	positive regulation of cellular component organization
3. B	GO:0036158	outer dynein arm assembly
3. B	GO:0051383	kinetochore organization
3. B	GO:0048142	germarium-derived cystoblast division
3. B	GO:0019827	stem cell population maintenance
3. B	GO:0051661	maintenance of centrosome location
3. B	GO:0072686	mitotic spindle
3. B	GO:0045540	regulation of cholesterol biosynthetic process
3. B	GO:0072432	response to G1 DNA damage checkpoint signaling
3. B	GO:0032934	sterol binding
3. B	GO:0030473	nuclear migration along microtubule
3. B	GO:0042052	rhabdomere development
3. B	GO:0071011	precatalytic spliceosome
3. B	GO:0043143	regulation of translation by machinery localization
3. B	GO:0070971	endoplasmic reticulum exit site
3. B	GO:0051660	establishment of centrosome localization
3. B	GO:1903026	negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding
3. B	GO:0045014	carbon catabolite repression of transcription by glucose
3. B	GO:0000381	regulation of alternative mRNA splicing, via spliceosome
3. B	GO:0003677	DNA binding
3. B	GO:0031101	fin regeneration
3. B	GO:0048471	perinuclear region of cytoplasm
3. B	GO:0043473	pigmentation
3. B	GO:0090724	central region of growth cone
3. B	GO:0120197	mucociliary clearance
3. B	GO:0097027	ubiquitin-protein transferase activator activity
3. B	GO:0030507	spectrin binding
3. B	GO:0000398	mRNA splicing, via spliceosome
3. B	GO:0010883	regulation of lipid storage
3. B	GO:0000235	astral microtubule
3. B	GO:0060528	secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
3. B	GO:0007079	mitotic chromosome movement towards spindle pole
3. B	GO:2000574	obsolete regulation of microtubule motor activity
3. B	GO:0030706	germarium-derived oocyte differentiation
3. B	GO:0090049	regulation of cell migration involved in sprouting angiogenesis
3. B	GO:0046716	muscle cell cellular homeostasis
3. B	GO:0038026	reelin-mediated signaling pathway
3. B	GO:1903378	positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
3. B	GO:1904115	axon cytoplasm
3. B	GO:0021987	cerebral cortex development
3. B	GO:1903955	positive regulation of protein targeting to mitochondrion
3. B	GO:0070370	cellular heat acclimation
3. B	GO:0010118	stomatal movement
3. B	GO:0040019	positive regulation of embryonic development
3. B	GO:0045827	negative regulation of isoprenoid metabolic process
3. B	GO:0051726	regulation of cell cycle
3. B	GO:0010906	regulation of glucose metabolic process
3. B	GO:0090110	COPII-coated vesicle cargo loading
3. B	GO:0070176	DRM complex
3. B	GO:0000077	DNA damage checkpoint signaling
3. B	GO:0007315	pole plasm assembly
3. B	GO:0021819	layer formation in cerebral cortex
3. B	GO:0035591	signaling adaptor activity
3. B	GO:0021766	hippocampus development
3. B	GO:0008090	retrograde axonal transport
3. B	GO:0007369	gastrulation
3. B	GO:0005881	cytoplasmic microtubule
3. B	GO:0051898	negative regulation of protein kinase B signaling
3. B	GO:0070545	PeBoW complex
3. B	GO:0048705	skeletal system morphogenesis
3. B	GO:0035014	phosphatidylinositol 3-kinase regulator activity
3. B	GO:0007399	nervous system development
3. B	GO:0003093	regulation of glomerular filtration
3. B	GO:0000132	establishment of mitotic spindle orientation
3. B	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
3. B	GO:1903861	positive regulation of dendrite extension
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:0032091	negative regulation of protein binding
3. B	GO:0044666	MLL3/4 complex
3. B	GO:0042998	positive regulation of Golgi to plasma membrane protein transport
3. B	GO:0009991	response to extracellular stimulus
3. B	GO:0031117	positive regulation of microtubule depolymerization
3. B	GO:0006974	cellular response to DNA damage stimulus
3. B	GO:0016559	peroxisome fission
3. B	GO:0031901	early endosome membrane
3. B	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
3. B	GO:0034709	methylosome
3. B	GO:0005246	calcium channel regulator activity
3. B	GO:0007165	signal transduction
3. B	GO:0009867	jasmonic acid mediated signaling pathway
3. B	GO:0005669	transcription factor TFIID complex
3. B	GO:0043622	cortical microtubule organization
3. B	GO:0043981	histone H4-K5 acetylation
3. B	GO:0045505	dynein intermediate chain binding
3. B	GO:0048854	brain morphogenesis
3. B	GO:0072499	photoreceptor cell axon guidance
3. B	GO:0032880	regulation of protein localization
3. B	GO:1903423	positive regulation of synaptic vesicle recycling
3. B	GO:1905392	plant organ morphogenesis
3. B	GO:0048813	dendrite morphogenesis
3. B	GO:1901998	toxin transport
3. B	GO:0071013	catalytic step 2 spliceosome
3. B	GO:0048794	swim bladder development
3. B	GO:0044297	cell body
3. B	GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
3. B	GO:0071006	U2-type catalytic step 1 spliceosome
3. B	GO:1902773	GTPase activator complex
3. B	GO:0140582	adenylate cyclase-activating G protein-coupled cAMP receptor signaling pathway
3. B	GO:0051010	microtubule plus-end binding
3. B	GO:0043021	ribonucleoprotein complex binding
3. B	GO:0021895	cerebral cortex neuron differentiation
3. B	GO:0051020	GTPase binding
3. B	GO:0030126	COPI vesicle coat
3. B	GO:0036035	osteoclast development
3. B	GO:0045022	early endosome to late endosome transport
3. B	GO:0000437	carbon catabolite repression of transcription from RNA polymerase II promoter
3. B	GO:0060117	auditory receptor cell development
3. B	GO:0000466	maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0017070	U6 snRNA binding
3. B	GO:0048135	female germ-line cyst formation
3. B	GO:0030686	90S preribosome
3. B	GO:1990756	ubiquitin ligase-substrate adaptor activity
3. B	GO:0032936	SREBP-SCAP complex
3. B	GO:0042393	histone binding
3. B	GO:0030286	dynein complex
3. B	GO:0071001	U4/U6 snRNP
3. B	GO:1903725	regulation of phospholipid metabolic process
3. B	GO:0045598	regulation of fat cell differentiation
3. B	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0060271	cilium assembly
3. B	GO:0010659	cardiac muscle cell apoptotic process
3. B	GO:0051302	regulation of cell division
3. B	GO:1990452	Parkin-FBXW7-Cul1 ubiquitin ligase complex
3. B	GO:0043293	apoptosome
3. B	GO:0030381	chorion-containing eggshell pattern formation
3. B	GO:0050816	phosphothreonine residue binding
3. B	GO:0045842	positive regulation of mitotic metaphase/anaphase transition
3. B	GO:0090102	cochlea development
3. B	GO:0000139	Golgi membrane
3. B	GO:0042249	establishment of planar polarity of embryonic epithelium
3. B	GO:0098654	CENP-A recruiting complex
3. B	GO:0042169	SH2 domain binding
3. B	GO:1903208	negative regulation of hydrogen peroxide-induced neuron death
3. B	GO:0030292	protein tyrosine kinase inhibitor activity
3. B	GO:0051572	negative regulation of histone H3-K4 methylation
3. B	GO:0000433	carbon catabolite repression of transcription from RNA polymerase II promoter by glucose
3. B	GO:0046982	protein heterodimerization activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q7Z5U6	WD repeat-containing protein 53	0	3.41e-158	0.0
1. PB	Q8JZX3	POC1 centriolar protein homolog A	5.01e-12	1.02e-02	1.14e-09
1. PB	Q5U4D9	THO complex subunit 6 homolog	2.22e-16	2.94e-07	0.010
1. PB	Q75BS2	Protein transport protein SEC13	0.00e+00	4.48e-02	0.049
1. PB	Q10281	Guanine nucleotide-binding protein subunit beta-like protein	3.38e-11	2.11e-04	0.004
1. PB	Q39836	Guanine nucleotide-binding protein subunit beta-like protein	2.39e-11	6.41e-05	0.006
1. PB	G4MQX3	MST50-interacting protein 11	1.49e-12	2.72e-05	0.034
1. PB	Q9H6Y2	WD repeat-containing protein 55	2.22e-15	2.36e-02	3.85e-04
1. PB	P97865	Peroxisomal targeting signal 2 receptor	0.00e+00	7.01e-03	7.34e-05
1. PB	P49026	Guanine nucleotide-binding protein subunit beta-like protein	3.02e-11	1.06e-06	0.011
1. PB	A0A1W5T363	WD40 repeat protein poxJ	NA	4.44e-06	3.49e-04
1. PB	O24076	Guanine nucleotide-binding protein subunit beta-like protein	5.32e-13	5.60e-05	0.004
1. PB	Q8NBT0	POC1 centriolar protein homolog A	2.07e-12	3.31e-04	4.82e-10
1. PB	Q6ZJX0	Polycomb group protein FIE1	0.00e+00	1.81e-04	0.036
1. PB	A8Q2R5	WD repeat-containing protein 48 homolog	2.94e-09	4.91e-02	0.020
1. PB	Q5JTN6	WD repeat-containing protein 38	0.00e+00	3.53e-04	4.88e-08
1. PB	Q5RD06	POC1 centriolar protein homolog B	4.14e-11	1.01e-03	3.80e-10
1. PB	P33750	Protein SOF1	1.11e-16	2.55e-03	0.007
1. PB	B4HND9	WD repeat-containing protein 48 homolog	7.55e-10	1.72e-02	2.42e-05
1. PB	Q9NWT1	p21-activated protein kinase-interacting protein 1	1.43e-09	1.48e-04	1.15e-05
1. PB	Q8R537	Peroxisomal targeting signal 2 receptor	0.00e+00	1.07e-02	1.39e-04
1. PB	Q5EA99	p21-activated protein kinase-interacting protein 1	0.00e+00	1.90e-06	9.30e-08
1. PB	Q93ZG3	WD repeat-containing protein ATCSA-1	1.77e-09	1.84e-02	0.027
1. PB	Q68FJ6	p21-activated protein kinase-interacting protein 1-like	3.18e-10	1.74e-05	2.97e-06
1. PB	Q25189	Guanine nucleotide-binding protein subunit beta-like protein	2.82e-12	1.86e-02	0.023
1. PB	Q54MT0	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	7.18e-07	0.001
1. PB	B4MFM2	WD repeat-containing protein 48 homolog	4.15e-09	1.91e-02	2.75e-05
1. PB	B4P7H8	WD repeat-containing protein 48 homolog	6.99e-10	1.80e-02	1.27e-05
1. PB	Q9DB94	WD repeat-containing protein 53	0.00e+00	1.66e-78	0.0
1. PB	P49027	Guanine nucleotide-binding protein subunit beta-like protein A	9.22e-12	8.05e-03	0.006
1. PB	Q6DJD8	Coronin-2B	3.22e-08	3.93e-02	0.003
1. PB	Q9C4Z6	Receptor for activated C kinase 1B	1.11e-12	7.32e-05	2.86e-04
1. PB	B4KRQ4	WD repeat-containing protein 48 homolog	5.16e-09	9.60e-03	2.71e-05
1. PB	Q54BI5	WD repeat-containing protein 53 homolog	0.00e+00	4.59e-11	2.74e-28
1. PB	Q6L4F8	Guanine nucleotide-binding protein subunit beta-like protein B	8.55e-11	1.06e-04	0.027
1. PB	D3ZW91	POC1 centriolar protein homolog B	8.39e-09	4.95e-03	4.90e-08
1. PB	Q96J01	THO complex subunit 3	0.00e+00	1.38e-04	0.041
1. PB	Q5B563	Protein transport protein sec13	1.11e-16	9.70e-03	0.002
1. PB	B3MET8	WD repeat-containing protein 48 homolog	8.20e-10	1.04e-02	1.35e-05
1. PB	P0CS33	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	8.37e-05	0.044
1. PB	Q6TNS2	p21-activated protein kinase-interacting protein 1-like	7.20e-10	5.82e-06	3.83e-08
1. PB	B0X2V9	WD repeat-containing protein 48 homolog	1.39e-06	4.76e-03	8.92e-06
1. PB	F6ZT52	POC1 centriolar protein homolog B	4.58e-11	1.80e-03	1.06e-08
1. PB	O42249	Guanine nucleotide-binding protein subunit beta-2-like 1	2.22e-12	1.74e-02	1.30e-04
1. PB	Q32KQ2	WD repeat-containing protein 53	0.00e+00	2.66e-85	0.0
1. PB	Q8TC44	POC1 centriolar protein homolog B	4.98e-09	2.23e-02	1.61e-09
1. PB	B4NW98	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	7.01e-03	0.046
1. PB	B0XFT7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	4.80e-03	0.011
1. PB	B3NSK1	WD repeat-containing protein 48 homolog	8.48e-10	1.59e-02	1.25e-05
1. PB	Q96P53	WD repeat and FYVE domain-containing protein 2	2.95e-12	4.65e-02	3.96e-04
1. PB	Q9UQ03	Coronin-2B	8.92e-08	3.28e-02	4.38e-04
1. PB	Q4V7Z1	POC1 centriolar protein homolog B	4.26e-11	1.93e-02	7.10e-06
1. PB	O74184	Target of rapamycin complex subunit wat1	0.00e+00	7.18e-07	0.004
1. PB	P0CS32	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	8.37e-05	0.044
1. PB	O13985	Uncharacterized WD repeat-containing protein C26H5.03	6.99e-06	3.38e-02	0.040
1. PB	P83774	Guanine nucleotide-binding protein subunit beta-like protein	1.78e-12	1.04e-03	0.002
1. PB	Q39336	Guanine nucleotide-binding protein subunit beta-like protein	2.30e-10	4.66e-07	5.96e-04
1. PB	Q9DCE5	p21-activated protein kinase-interacting protein 1	1.05e-09	3.69e-05	3.46e-08
1. PB	Q5ZKU8	p21-activated protein kinase-interacting protein 1-like	1.87e-11	2.27e-02	9.53e-05
1. PB	Q8BHD1	POC1 centriolar protein homolog B	5.95e-09	1.25e-03	2.96e-07
1. PB	Q86W42	THO complex subunit 6 homolog	0.00e+00	1.79e-06	0.009
1. PB	Q1LZ08	WD repeat-containing protein 48 homolog	6.64e-10	1.14e-02	1.10e-05
1. PB	Q16MY0	WD repeat-containing protein 48 homolog	2.75e-10	1.89e-02	2.10e-05
1. PB	Q01369	Guanine nucleotide-binding protein subunit beta-like protein	2.07e-12	1.45e-04	0.014
1. PB	O24456	Receptor for activated C kinase 1A	3.48e-11	1.02e-06	0.005
1. PB	Q9AYE4	Target of rapamycin complex subunit LST8	0.00e+00	3.85e-02	0.020
1. PB	S8ASK6	WD40 repeat protein poxJ	NA	4.44e-06	3.49e-04
1. PB	Q9LV28	Receptor for activated C kinase 1C	3.22e-11	5.24e-06	5.44e-04
1. PB	O18640	Guanine nucleotide-binding protein subunit beta-like protein	2.72e-12	6.41e-04	1.50e-04
1. PB	Q6AY87	THO complex subunit 6 homolog	1.11e-16	8.11e-07	0.006
1. PB	Q7T0P4	POC1 centriolar protein homolog A	2.03e-11	4.69e-02	1.42e-07
1. PB	B4J8H6	WD repeat-containing protein 48 homolog	3.62e-09	1.75e-02	2.95e-05
1. PB	B4QB64	WD repeat-containing protein 48 homolog	5.58e-10	1.32e-02	2.54e-05
1. PB	Q2TBP4	POC1 centriolar protein homolog A	6.10e-13	2.55e-03	4.41e-11
1. PB	A8WGE3	Coronin-2B	8.91e-08	2.36e-02	0.005
1. PB	P25387	Guanine nucleotide-binding protein subunit beta-like protein	2.23e-12	9.04e-05	0.005
2. P	Q5AI22	Autophagy-related protein 21	1.90e-06	9.54e-11	NA
2. P	B4KGX9	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	5.05e-03	NA
2. P	Q6DCV0	WD repeat domain phosphoinositide-interacting protein 4	1.47e-13	2.77e-08	NA
2. P	Q9U1Q0	EARP-interacting protein 1	0.00e+00	9.89e-03	NA
2. P	Q58E77	WD repeat-containing protein 82-B	0.00e+00	7.67e-04	NA
2. P	Q6BUJ2	Ribosome biogenesis protein NSA1	2.58e-13	1.08e-04	NA
2. P	Q5R4T8	DDB1- and CUL4-associated factor 13	0.00e+00	2.11e-04	NA
2. P	Q6BIA1	Autophagy-related protein 21	1.39e-06	2.83e-09	NA
2. P	Q5RB58	Mitotic checkpoint protein BUB3	0.00e+00	1.45e-09	NA
2. P	A4RDD7	Eukaryotic translation initiation factor 3 subunit I	5.53e-09	4.60e-06	NA
2. P	B0BNA7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.08e-04	NA
2. P	Q9XWH0	Mitotic checkpoint protein bub-3	0.00e+00	3.31e-04	NA
2. P	B5VG60	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	1.63e-13	3.15e-03	NA
2. P	Q6BT42	Protein DSE1	2.70e-06	3.52e-03	NA
2. P	A6ZRQ0	Protein SWT21	7.97e-14	1.21e-06	NA
2. P	A4QNE6	Dynein axonemal assembly factor 10	0.00e+00	6.67e-03	NA
2. P	Q80W47	WD repeat domain phosphoinositide-interacting protein 2	9.68e-14	1.40e-05	NA
2. P	Q9UT39	Uncharacterized WD repeat-containing protein C824.04	0.00e+00	1.06e-08	NA
2. P	P26449	Cell cycle arrest protein BUB3	5.55e-16	1.59e-10	NA
2. P	P27133	Coronin-A	1.51e-09	3.11e-04	NA
2. P	Q8K0G5	EARP and GARP complex-interacting protein 1	0.00e+00	4.56e-02	NA
2. P	O89053	Coronin-1A	9.29e-08	2.96e-02	NA
2. P	Q5AQ62	WD repeat-containing protein JIP5	6.52e-09	1.52e-02	NA
2. P	Q9HDZ7	Autophagy-related protein 18	8.65e-09	6.35e-07	NA
2. P	C5DLA7	ASTRA-associated protein 1	3.96e-08	8.34e-04	NA
2. P	Q6PAC3	DDB1- and CUL4-associated factor 13	0.00e+00	1.53e-04	NA
2. P	Q9R0Q6	Actin-related protein 2/3 complex subunit 1A	1.64e-09	1.80e-05	NA
2. P	Q8BFQ4	WD repeat-containing protein 82	0.00e+00	1.25e-03	NA
2. P	Q75D34	Autophagy-related protein 21	4.36e-09	1.71e-09	NA
2. P	A6RUL1	Eukaryotic translation initiation factor 3 subunit I	1.43e-09	8.52e-04	NA
2. P	Q2GTM8	Eukaryotic translation initiation factor 3 subunit I	5.94e-09	1.17e-04	NA
2. P	B3MVL6	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.91e-03	NA
2. P	B6H7A3	Probable cytosolic iron-sulfur protein assembly protein 1	5.46e-13	2.06e-02	NA
2. P	Q0CRF8	WD repeat-containing protein jip5	1.19e-07	2.07e-05	NA
2. P	E3LB80	Eukaryotic translation initiation factor 3 subunit I	1.11e-16	1.08e-03	NA
2. P	Q17I16	WD repeat-containing protein on Y chromosome	9.42e-07	2.62e-02	NA
2. P	Q7PP77	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	8.46e-05	NA
2. P	Q6BMP5	Pre-rRNA-processing protein IPI3	1.80e-12	8.71e-03	NA
2. P	Q9FHK8	Autophagy-related protein 18e	1.74e-13	6.83e-04	NA
2. P	Q9LJN8	Mitotic checkpoint protein BUB3.1	0.00e+00	2.14e-10	NA
2. P	Q2U6D5	Autophagy-related protein 18	2.49e-10	7.13e-08	NA
2. P	Q7RXH4	Eukaryotic translation initiation factor 3 subunit I	3.80e-09	9.98e-06	NA
2. P	P53873	Protein SWT21	8.24e-14	1.21e-06	NA
2. P	P0CS30	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	6.94e-03	NA
2. P	C4R970	ASTRA-associated protein 1	2.02e-13	6.35e-03	NA
2. P	Q9DAJ4	WD repeat domain-containing protein 83	3.59e-13	2.08e-08	NA
2. P	Q6CN23	SVP1-like protein 2	8.46e-14	2.05e-03	NA
2. P	Q6FJ73	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	1.08e-03	NA
2. P	Q96EE3	Nucleoporin SEH1	7.21e-12	1.39e-04	NA
2. P	Q66J51	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	6.48e-05	NA
2. P	Q7ZWU5	WD repeat domain phosphoinositide-interacting protein 2	8.42e-14	7.63e-09	NA
2. P	E9Q4P1	WD repeat and FYVE domain-containing protein 1	1.16e-10	1.40e-03	NA
2. P	Q9SJW6	Actin-related protein 2/3 complex subunit 1B	2.14e-09	1.85e-06	NA
2. P	I1RKA1	Autophagy-related protein 18	1.22e-06	1.55e-06	NA
2. P	Q59Y20	Protein DSE1	1.36e-10	1.84e-02	NA
2. P	Q5FVP5	WD repeat-containing protein 89	5.55e-16	1.88e-06	NA
2. P	Q6CEI9	SVP1-like protein 2	2.01e-09	8.46e-05	NA
2. P	P38332	Diphthine methyltransferase	9.21e-15	2.25e-02	NA
2. P	A5E654	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	1.08e-13	4.09e-03	NA
2. P	Q9VLN1	WD repeat-containing protein 82	0.00e+00	5.42e-03	NA
2. P	Q758M2	WD repeat-containing protein JIP5	7.33e-07	3.26e-05	NA
2. P	Q2KIY3	WD repeat and FYVE domain-containing protein 1	1.13e-10	1.40e-02	NA
2. P	Q9V3J4	Protein SEC13 homolog	6.66e-16	1.51e-03	NA
2. P	P40217	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	7.67e-04	NA
2. P	Q9BV38	WD repeat-containing protein 18	4.44e-16	2.82e-04	NA
2. P	O16466	Autophagy-related protein 18	5.82e-09	2.10e-07	NA
2. P	F4I241	Mitotic checkpoint protein BUB3.3	0.00e+00	2.11e-08	NA
2. P	O42860	Mitotic checkpoint protein bub3	0.00e+00	1.48e-08	NA
2. P	A8WVX8	Eukaryotic translation initiation factor 3 subunit I	1.11e-16	1.36e-02	NA
2. P	B4LUA5	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	9.70e-03	NA
2. P	Q6UXN9	WD repeat-containing protein 82	0.00e+00	1.25e-03	NA
2. P	Q5R7W0	WD repeat domain phosphoinositide-interacting protein 3	2.79e-14	9.07e-09	NA
2. P	Q4VBE8	WD repeat-containing protein 18	2.44e-15	1.53e-04	NA
2. P	O74865	Diphthine methyltransferase	0.00e+00	2.23e-03	NA
2. P	B8MWR8	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	4.91e-02	NA
2. P	A0A1L8EXB5	Actin-related protein 2/3 complex subunit 1A-B	2.05e-09	8.09e-05	NA
2. P	Q93134	Guanine nucleotide-binding protein subunit beta-2-like 1	6.43e-14	4.31e-02	NA
2. P	Q8R3E3	WD repeat domain phosphoinositide-interacting protein 1	7.25e-06	1.88e-06	NA
2. P	Q875D4	WD repeat-containing protein JIP5	1.23e-09	6.02e-04	NA
2. P	Q1DKJ3	Autophagy-related protein 18	3.83e-09	2.37e-04	NA
2. P	Q6GL39	WD repeat-containing protein 82	0.00e+00	3.46e-04	NA
2. P	A7RM20	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	7.54e-07	NA
2. P	Q02793	Antiviral protein SKI8	3.33e-16	6.93e-05	NA
2. P	C8ZG43	Protein SWT21	1.33e-13	8.95e-07	NA
2. P	Q944S2	WD repeat-containing protein GTS1	1.22e-15	4.60e-06	NA
2. P	A7A258	Autophagy-related protein 18	6.44e-05	5.30e-05	NA
2. P	Q499N3	WD repeat-containing protein 18	3.77e-15	4.00e-05	NA
2. P	Q75BE7	ASTRA-associated protein 1	1.97e-08	1.71e-08	NA
2. P	A2RAG5	Autophagy-related protein 18	2.22e-07	7.54e-07	NA
2. P	Q9Y4P8	WD repeat domain phosphoinositide-interacting protein 2	1.90e-13	1.10e-04	NA
2. P	O74453	Shk1 kinase-binding protein 15	1.08e-12	2.89e-08	NA
2. P	Q4P6E2	Eukaryotic translation initiation factor 3 subunit I	8.42e-09	4.38e-04	NA
2. P	O88656	Actin-related protein 2/3 complex subunit 1B	3.42e-09	8.05e-09	NA
2. P	Q05583	Cytosolic iron-sulfur protein assembly protein 1	0.00e+00	7.22e-03	NA
2. P	Q6CFV3	ASTRA-associated protein 1	8.88e-08	9.76e-04	NA
2. P	A3LXM4	ASTRA-associated protein 1	2.53e-08	6.43e-08	NA
2. P	Q9D0R9	WD repeat-containing protein 89	4.44e-16	1.60e-05	NA
2. P	O59894	Peroxisomal targeting signal 2 receptor	0.00e+00	1.01e-03	NA
2. P	Q5M8I4	EARP-interacting protein homolog	0.00e+00	2.99e-02	NA
2. P	P0CS28	Autophagy-related protein 18	2.87e-08	7.33e-09	NA
2. P	A3LTS5	Protein DSE1	2.86e-11	4.00e-02	NA
2. P	Q9Y484	WD repeat domain phosphoinositide-interacting protein 4	6.49e-08	1.44e-07	NA
2. P	Q8BGF3	Dynein axonemal assembly factor 10	0.00e+00	2.62e-02	NA
2. P	Q7K2X8	Nucleoporin seh1	8.31e-10	6.86e-09	NA
2. P	Q5U4Y8	Nucleoporin SEH1	6.93e-10	1.51e-06	NA
2. P	Q3UDP0	WD repeat-containing protein 41	2.26e-10	8.62e-03	NA
2. P	B4GSH1	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.36e-03	NA
2. P	A6RDW5	WD repeat-containing protein JIP5	4.85e-09	3.94e-06	NA
2. P	Q524W4	Autophagy-related protein 18	4.67e-13	4.76e-06	NA
2. P	Q6CEC9	Ribosome biogenesis protein NSA1	4.19e-14	3.50e-06	NA
2. P	P20484	Protein MAK11	3.33e-16	1.99e-06	NA
2. P	B4L6T9	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	9.66e-15	4.09e-03	NA
2. P	Q99296	Uncharacterized protein YLR149C	1.61e-03	1.06e-05	NA
2. P	Q5BH53	Autophagy-related protein 18	3.26e-08	2.28e-06	NA
2. P	P50079	SVP1-like protein 2	1.27e-06	1.52e-03	NA
2. P	Q91VM3	WD repeat domain phosphoinositide-interacting protein 4	1.20e-09	1.25e-07	NA
2. P	Q00362	Protein phosphatase PP2A regulatory subunit B	1.85e-07	5.75e-07	NA
2. P	Q9VNX8	Eukaryotic translation initiation factor 2A	1.61e-05	7.35e-04	NA
2. P	Q8IWB7	WD repeat and FYVE domain-containing protein 1	1.16e-10	1.72e-02	NA
2. P	Q6CRH2	ASTRA-associated protein 1	1.50e-07	5.64e-03	NA
2. P	A7YY75	Nucleoporin SEH1	1.21e-11	1.97e-05	NA
2. P	Q2UQ34	Eukaryotic translation initiation factor 3 subunit I	2.46e-09	1.99e-03	NA
2. P	Q5QA94	Autophagy-related protein 18	4.31e-07	7.31e-08	NA
2. P	Q965S8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.61e-03	NA
2. P	O59762	Guanine nucleotide-binding protein negative regulator 1	1.54e-07	1.69e-03	NA
2. P	Q6BIL4	Autophagy-related protein 18	3.15e-06	1.99e-07	NA
2. P	A5DGL8	Eukaryotic translation initiation factor 3 subunit I	2.22e-16	4.68e-05	NA
2. P	C5MH59	ASTRA-associated protein 1	4.60e-07	5.24e-08	NA
2. P	Q86MP3	Ectopic P granules protein 6	9.98e-14	3.06e-03	NA
2. P	Q1DNW5	WD repeat-containing protein JIP5	1.07e-10	5.69e-06	NA
2. P	Q6FU05	Ribosome biogenesis protein NSA1	5.34e-12	2.50e-02	NA
2. P	Q6CVN2	WD repeat-containing protein JIP5	1.13e-08	5.47e-04	NA
2. P	Q4WNA1	WD repeat-containing protein jip5	9.48e-09	3.30e-05	NA
2. P	Q92747	Actin-related protein 2/3 complex subunit 1A	1.26e-09	5.06e-05	NA
2. P	B3MC74	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	3.71e-02	NA
2. P	O60137	Set1 complex component swd2	2.59e-09	5.29e-12	NA
2. P	Q5M7F6	Dynein axonemal assembly factor 10	0.00e+00	1.29e-02	NA
2. P	Q640T2	WD repeat domain phosphoinositide-interacting protein 3	2.59e-14	6.77e-09	NA
2. P	Q6GNF1	Nucleoporin SEH1-B	1.38e-11	3.46e-06	NA
2. P	Q6DH44	WD repeat domain-containing protein 83	3.80e-13	9.56e-05	NA
2. P	Q8R2U0	Nucleoporin SEH1	3.56e-12	2.28e-06	NA
2. P	Q9C701	Mitotic checkpoint protein BUB3.2	0.00e+00	2.96e-08	NA
2. P	O02195	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.16e-03	NA
2. P	Q9M3B4	Protein ROOT INITIATION DEFECTIVE 3	3.33e-16	3.57e-02	NA
2. P	A5DNK9	Pre-rRNA-processing protein IPI3	1.07e-13	9.21e-08	NA
2. P	P31146	Coronin-1A	2.78e-07	3.54e-02	NA
2. P	Q54DM1	Mitotic checkpoint protein bub3	0.00e+00	1.55e-09	NA
2. P	A0A1L8HX76	WD repeat-containing protein 18	2.11e-15	1.27e-04	NA
2. P	Q5B464	SVP1-like protein 2	2.17e-08	3.29e-07	NA
2. P	Q8CFD5	DNA excision repair protein ERCC-8	1.99e-11	3.82e-05	NA
2. P	B3LP36	Protein SWT21	5.68e-14	1.21e-06	NA
2. P	P0CS31	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	6.94e-03	NA
2. P	Q6C044	Autophagy-related protein 18	4.94e-08	5.73e-08	NA
2. P	B3LK55	ASTRA-associated protein 1	1.50e-07	3.85e-06	NA
2. P	Q8VE80	THO complex subunit 3	0.00e+00	1.33e-03	NA
2. P	Q5RBZ3	WD repeat-containing protein 89	8.88e-16	1.37e-09	NA
2. P	C7GTF9	Protein SWT21	6.14e-14	6.58e-07	NA
2. P	Q0CW30	Autophagy-related protein 18	2.70e-08	4.20e-08	NA
2. P	Q6C2S3	WD repeat-containing protein JIP5	0.00e+00	1.42e-06	NA
2. P	Q29RH4	THO complex subunit 3	0.00e+00	1.41e-04	NA
2. P	Q9NV06	DDB1- and CUL4-associated factor 13	0.00e+00	4.47e-04	NA
2. P	B5VQM2	Protein SWT21	1.30e-13	1.21e-06	NA
2. P	W0T5P4	Autophagy-related protein 18	4.59e-06	1.68e-05	NA
2. P	A1CQL6	Probable cytosolic iron-sulfur protein assembly protein 1	4.15e-14	4.15e-02	NA
2. P	C1BK83	Nucleoporin SEH1	9.25e-10	4.52e-04	NA
2. P	Q04199	Chromatin assembly factor 1 subunit p60	9.12e-07	2.62e-02	NA
2. P	Q06822	ASTRA-associated protein 1	1.29e-07	3.85e-06	NA
2. P	Q29RZ9	Dynein axonemal assembly factor 10	0.00e+00	7.74e-03	NA
2. P	Q9YGY3	Mitotic checkpoint protein BUB3	0.00e+00	6.92e-07	NA
2. P	Q6CS21	Autophagy-related protein 18	2.89e-06	1.89e-04	NA
2. P	Q5BLX8	WD repeat domain-containing protein 83	2.66e-13	4.85e-08	NA
2. P	Q10099	Nucleoporin seh1	2.29e-14	1.17e-09	NA
2. P	B9WJ47	ASTRA-associated protein 1	1.36e-07	5.42e-06	NA
2. P	Q7ZYQ6	DDB1- and CUL4-associated factor 13	0.00e+00	3.26e-06	NA
2. P	Q6FM63	Autophagy-related protein 18	5.36e-07	8.57e-06	NA
2. P	Q9WV32	Actin-related protein 2/3 complex subunit 1B	3.55e-09	4.12e-09	NA
2. P	Q9LT47	Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM	0.00e+00	3.89e-06	NA
2. P	A8J3F6	Dynein axonemal assembly factor 10	0.00e+00	1.75e-04	NA
2. P	Q5ZHN3	WD repeat domain phosphoinositide-interacting protein 2	7.64e-14	7.81e-06	NA
2. P	A8WVD2	Nucleoporin SEH1	7.77e-16	1.39e-03	NA
2. P	Q9R0D8	WD repeat-containing protein 54	0.00e+00	1.71e-03	NA
2. P	Q9N4A7	Protein SEC13 homolog	4.44e-16	2.98e-04	NA
2. P	Q5F3R7	DDB1- and CUL4-associated factor 12	1.75e-06	7.15e-03	NA
2. P	A2RA56	ASTRA-associated protein 1	6.62e-08	1.62e-02	NA
2. P	Q4P4N1	Autophagy-related protein 18	3.22e-08	3.54e-10	NA
2. P	Q8SRB0	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.05e-06	NA
2. P	B0XYC8	Eukaryotic translation initiation factor 3 subunit I	1.15e-09	5.26e-03	NA
2. P	Q2GMF6	WD repeat-containing protein JIP5	1.90e-08	2.25e-03	NA
2. P	Q9QZD9	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	7.05e-04	NA
2. P	Q8VZY6	Polycomb group protein FIE2	0.00e+00	5.64e-03	NA
2. P	Q06214	WD repeat-containing protein JIP5	1.99e-07	9.36e-04	NA
2. P	Q9EP82	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	3.66e-09	1.42e-03	NA
2. P	Q6FXC1	SVP1-like protein 2	1.35e-06	3.85e-06	NA
2. P	Q1JP79	Actin-related protein 2/3 complex subunit 1A	1.12e-09	2.02e-04	NA
2. P	Q6DCN1	WD repeat domain phosphoinositide-interacting protein 1	2.64e-06	2.92e-08	NA
2. P	A3LPR4	WD repeat-containing protein JIP5	4.24e-08	9.17e-04	NA
2. P	G0SEA3	mRNA export factor GLE2	0.00e+00	3.15e-05	NA
2. P	Q38942	Protein RAE1	0.00e+00	5.44e-08	NA
2. P	P78774	Actin-related protein 2/3 complex subunit 1	2.16e-09	5.52e-03	NA
2. P	Q0CXH9	Eukaryotic translation initiation factor 3 subunit I	3.36e-09	6.04e-03	NA
2. P	Q91ZN1	Coronin-1A	6.30e-09	2.59e-02	NA
2. P	A5DHI9	Autophagy-related protein 18	1.17e-05	1.37e-08	NA
2. P	A7EF03	Eukaryotic translation initiation factor 3 subunit I	1.39e-09	3.85e-03	NA
2. P	A7EGU0	WD repeat-containing protein jip5	7.07e-09	1.12e-05	NA
2. P	Q5XGI5	WD repeat domain-containing protein 83	2.36e-13	1.91e-05	NA
2. P	P38011	Guanine nucleotide-binding protein subunit beta-like protein	4.02e-11	4.52e-02	NA
2. P	P53962	Uncharacterized WD repeat-containing protein YNL035C	1.60e-14	5.21e-12	NA
2. P	Q9W2E7	Protein Rae1	6.66e-16	3.71e-06	NA
2. P	O80775	WD repeat-containing protein 55	1.57e-13	1.78e-03	NA
2. P	Q7ZUW6	WD repeat domain phosphoinositide-interacting protein 3	2.11e-14	3.80e-09	NA
2. P	Q4X1Y0	Polyadenylation factor subunit 2	1.27e-14	2.99e-02	NA
2. P	Q3ZBK1	WD repeat-containing protein 89	5.55e-16	4.68e-10	NA
2. P	Q9BRX9	WD repeat domain-containing protein 83	3.15e-13	4.33e-07	NA
2. P	Q6CRK4	Pre-rRNA-processing protein IPI3	2.19e-12	3.93e-02	NA
2. P	Q2GV40	Autophagy-related protein 18	9.66e-07	3.17e-07	NA
2. P	A3LX18	Eukaryotic translation initiation factor 3 subunit I	4.67e-09	1.17e-04	NA
2. P	A2QPG3	WD repeat-containing protein jip5	5.23e-09	1.08e-03	NA
2. P	A5E5U8	ASTRA-associated protein 1	1.50e-06	6.74e-03	NA
2. P	A7TKC6	ASTRA-associated protein 1	1.88e-07	5.42e-03	NA
2. P	A7KAM8	Autophagy-related protein 18	3.06e-08	3.95e-05	NA
2. P	B4N0L0	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.07e-03	NA
2. P	Q9WVA3	Mitotic checkpoint protein BUB3	0.00e+00	9.48e-10	NA
2. P	Q5ZKC1	Eukaryotic translation initiation factor 2A	4.70e-06	2.77e-02	NA
2. P	Q7ZUX3	WD repeat domain phosphoinositide-interacting protein 4	8.27e-08	3.21e-07	NA
2. P	A8QBF3	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	4.43e-03	NA
2. P	A1CE98	WD repeat-containing protein jip5	1.75e-10	1.02e-05	NA
2. P	Q99PD4	Actin-related protein 2/3 complex subunit 1A	1.25e-09	1.60e-05	NA
2. P	Q03774	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	1.21e-13	4.09e-03	NA
2. P	Q3SZD4	WD repeat-containing protein 18	1.78e-15	6.02e-04	NA
2. P	Q5ZL16	WD repeat domain phosphoinositide-interacting protein 3	2.05e-14	4.54e-08	NA
2. P	Q2UPI0	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	4.91e-02	NA
2. P	O36030	Uncharacterized WD repeat-containing protein C4F10.18	3.84e-14	2.08e-04	NA
2. P	Q5XIG8	Serine-threonine kinase receptor-associated protein	7.90e-13	9.69e-09	NA
2. P	P36104	COMPASS component SWD2	0.00e+00	2.04e-06	NA
2. P	Q38884	Eukaryotic translation initiation factor 3 subunit I	1.71e-09	3.09e-03	NA
2. P	Q75F47	Autophagy-related protein 18	7.23e-05	5.61e-07	NA
2. P	Q9CR39	WD repeat domain phosphoinositide-interacting protein 3	2.81e-14	5.92e-09	NA
2. P	Q5FVA9	mRNA export factor	1.55e-15	8.08e-04	NA
2. P	B6HHJ8	ASTRA-associated protein 1	3.47e-08	2.13e-04	NA
2. P	O45933	Nucleoporin SEH1	5.30e-12	9.23e-03	NA
2. P	B4NER4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	5.17e-09	5.26e-03	NA
2. P	Q9H977	WD repeat-containing protein 54	0.00e+00	4.82e-04	NA
2. P	A6ZMK5	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	7.67e-04	NA
2. P	Q16K15	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	4.28e-04	NA
2. P	Q10272	Pre-rRNA-processing protein crb3/ipi3	2.86e-08	2.34e-09	NA
2. P	Q68F45	WD repeat domain phosphoinositide-interacting protein 3	3.89e-14	5.04e-09	NA
2. P	Q1DPU4	Eukaryotic translation initiation factor 3 subunit I	3.33e-09	3.31e-03	NA
2. P	Q54D08	Protein LST8 homolog	0.00e+00	4.66e-04	NA
2. P	A5DR04	ASTRA-associated protein 1	9.19e-08	3.54e-02	NA
2. P	O74863	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit trm82	8.25e-14	3.26e-05	NA
2. P	Q9VTV1	THO complex subunit 6	0.00e+00	6.22e-03	NA
2. P	O74340	Protein sof1	0.00e+00	2.22e-06	NA
2. P	Q9UT73	Uncharacterized WD repeat-containing protein C343.17c	8.52e-14	4.90e-03	NA
2. P	Q96MX6	Dynein axonemal assembly factor 10	0.00e+00	7.89e-03	NA
2. P	C5DUI6	ASTRA-associated protein 1	3.59e-08	5.46e-09	NA
2. P	Q13216	DNA excision repair protein ERCC-8	1.88e-07	1.39e-06	NA
2. P	Q6FRU4	Autophagy-related protein 21	2.02e-06	1.29e-04	NA
2. P	A1CJY4	Eukaryotic translation initiation factor 3 subunit I	1.92e-10	2.21e-03	NA
2. P	P38123	COMPASS component SWD3	0.00e+00	1.45e-07	NA
2. P	Q7KWL3	DDB1- and CUL4-associated factor 13	0.00e+00	1.51e-03	NA
2. P	A8XJ40	Protein SEC13 homolog	2.22e-16	3.28e-04	NA
2. P	Q13347	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	3.97e-04	NA
2. P	A5DVY3	Eukaryotic translation initiation factor 3 subunit I	1.22e-15	5.58e-03	NA
2. P	Q5ZLK1	DDB1- and CUL4-associated factor 13	0.00e+00	9.41e-06	NA
2. P	Q4WX90	Eukaryotic translation initiation factor 3 subunit I	3.80e-09	5.26e-03	NA
2. P	P43601	Autophagy-related protein 18	3.90e-06	5.30e-05	NA
2. P	Q75AQ4	SVP1-like protein 2	3.56e-13	3.73e-05	NA
2. P	Q29L19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.36e-03	NA
2. P	A7TH19	Eukaryotic translation initiation factor 3 subunit I	1.11e-16	4.02e-07	NA
2. P	A1CBB8	Autophagy-related protein 18	3.73e-08	2.96e-08	NA
2. P	P79083	Eukaryotic translation initiation factor 3 subunit I	2.47e-09	3.21e-04	NA
2. P	Q5B2Q3	WD repeat-containing protein jip5	9.18e-08	2.26e-07	NA
2. P	Q5MNZ6	WD repeat domain phosphoinositide-interacting protein 3	3.32e-14	8.83e-09	NA
2. P	A6ZYC3	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	1.58e-13	5.31e-03	NA
2. P	Q5ABA6	Autophagy-related protein 18	4.71e-07	8.95e-09	NA
2. P	C4YSJ2	ASTRA-associated protein 1	1.86e-06	3.79e-08	NA
2. P	Q5A2T0	Ribosome biogenesis protein NSA1	9.47e-14	1.20e-03	NA
2. P	O42996	Uncharacterized WD repeat-containing protein C27B12.05	3.01e-07	8.56e-05	NA
2. P	Q9LYK6	Protein ANTHESIS POMOTING FACTOR 1	0.00e+00	2.06e-04	NA
2. P	Q5XJS5	THO complex subunit 6 homolog	1.11e-16	3.02e-07	NA
2. P	Q9HAD4	WD repeat-containing protein 41	4.11e-09	3.32e-02	NA
2. P	O96622	Actin-related protein 2/3 complex subunit 1	8.88e-16	1.85e-08	NA
2. P	P0CS29	Autophagy-related protein 18	3.29e-08	5.69e-09	NA
2. P	Q7ZY78	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4	1.08e-10	1.07e-02	NA
2. P	Q20059	WD repeat-containing protein 48 homolog	3.57e-07	4.78e-02	NA
2. P	A1DE24	Autophagy-related protein 18	2.65e-08	5.75e-07	NA
2. P	Q8NFH3	Nucleoporin Nup43	5.42e-11	9.35e-05	NA
2. P	Q68EI0	WD repeat-containing protein 18	7.22e-15	1.26e-02	NA
2. P	C7GPS8	ASTRA-associated protein 1	8.61e-08	9.51e-07	NA
2. P	Q6BSL7	Eukaryotic translation initiation factor 3 subunit I	2.22e-16	3.37e-05	NA
2. P	A6ZX45	WD repeat-containing protein JIP5	1.46e-08	3.21e-04	NA
2. P	Q5ABV4	ASTRA-associated protein 1	1.48e-06	3.46e-08	NA
2. P	O43684	Mitotic checkpoint protein BUB3	0.00e+00	3.17e-10	NA
2. P	A1D7I5	Eukaryotic translation initiation factor 3 subunit I	4.19e-09	9.36e-04	NA
2. P	O74965	Eukaryotic translation initiation factor 2A	1.49e-06	1.15e-03	NA
2. P	O13856	Uncharacterized WD repeat-containing protein C1A6.02	5.55e-10	4.18e-03	NA
2. P	P57081	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	5.86e-09	1.42e-04	NA
2. P	Q6BUX9	SVP1-like protein 2	4.08e-07	3.09e-07	NA
2. P	P41838	Poly(A)+ RNA export protein	1.11e-16	8.78e-06	NA
2. P	B5DMC9	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	1.40e-14	1.02e-02	NA
2. P	P38328	Actin-related protein 2/3 complex subunit 1	4.09e-09	9.27e-11	NA
2. P	A6RWR8	WD repeat-containing protein jip5	1.80e-10	7.74e-05	NA
2. P	Q06679	U3 small nucleolar RNA-associated protein 4	1.30e-06	1.89e-03	NA
2. P	O94698	Ribosome biogenesis protein nsa1	5.60e-10	2.82e-02	NA
2. P	P39108	Peroxisomal targeting signal 2 receptor	0.00e+00	2.52e-02	NA
2. P	Q5QJC0	Autophagy-related protein 21	4.77e-07	3.09e-12	NA
2. P	Q8GYD7	Autophagy-related protein 18c	2.94e-08	1.01e-03	NA
2. P	Q4FZW5	Nucleoporin SEH1-A	9.96e-10	3.95e-05	NA
2. P	Q0WPK3	Autophagy-related protein 18d	3.89e-08	5.08e-04	NA
2. P	Q8AVT9	Actin-related protein 2/3 complex subunit 1A-A	5.74e-08	2.88e-05	NA
2. P	A7TPY4	Autophagy-related protein 18	1.13e-04	1.59e-02	NA
2. P	Q803X4	DDB1- and CUL4-associated factor 13	0.00e+00	3.11e-04	NA
2. P	Q759L2	Eukaryotic translation initiation factor 3 subunit I	1.11e-16	8.21e-07	NA
2. P	A7E3S5	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	2.88e-09	9.60e-03	NA
2. P	Q5R7R2	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.78e-05	NA
2. P	Q9P3W2	SVP1-like protein 2	7.98e-09	1.32e-09	NA
2. P	A7TTC8	Autophagy-related protein 21	1.80e-07	5.12e-05	NA
2. P	B4I195	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.16e-03	NA
2. P	A6ZYM0	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	4.35e-03	NA
2. P	P93340	Guanine nucleotide-binding protein subunit beta-like protein	2.67e-11	2.14e-06	NA
2. P	Q5ZMV7	WD repeat-containing protein 82	0.00e+00	9.14e-03	NA
2. P	Q5E959	Serine-threonine kinase receptor-associated protein	7.63e-11	3.29e-08	NA
2. P	Q5E966	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.98e-04	NA
2. P	Q5ZL33	Serine-threonine kinase receptor-associated protein	2.66e-13	1.28e-08	NA
2. P	A3GFE3	Autophagy-related protein 18	7.19e-07	3.22e-06	NA
2. P	Q9Z2K5	Target of rapamycin complex subunit LST8	0.00e+00	9.60e-03	NA
2. P	P40066	mRNA export factor GLE2	2.22e-16	2.40e-05	NA
2. P	B0W8M5	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	2.55e-10	2.64e-02	NA
2. P	O15143	Actin-related protein 2/3 complex subunit 1B	4.86e-08	2.53e-08	NA
2. P	Q6CLZ2	Autophagy-related protein 21	3.05e-08	1.06e-08	NA
2. P	Q3KQ62	WD repeat domain-containing protein 83	2.66e-13	1.76e-05	NA
2. P	Q5MNZ9	WD repeat domain phosphoinositide-interacting protein 1	1.84e-13	6.19e-07	NA
2. P	Q9Z1Z2	Serine-threonine kinase receptor-associated protein	1.08e-10	4.35e-09	NA
2. P	Q6TGU2	Nucleoporin SEH1	4.05e-10	2.56e-04	NA
2. P	Q8VCG3	WD repeat-containing protein 74	2.22e-16	2.50e-06	NA
2. P	Q7S4F7	WD repeat-containing protein jip5	7.05e-10	8.17e-04	NA
2. P	Q8H1Q8	Autophagy-related protein 18b	1.84e-14	2.83e-12	NA
2. P	Q7ZV55	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	3.97e-07	NA
2. P	Q9Y7T2	Uncharacterized WD repeat-containing protein C63.06	0.00e+00	1.04e-11	NA
2. P	Q75E14	Pre-rRNA-processing protein IPI3	5.10e-12	4.48e-02	NA
2. P	A6QTX7	Autophagy-related protein 18	2.83e-06	1.67e-07	NA
2. P	A6ZWX0	ASTRA-associated protein 1	7.39e-08	3.85e-06	NA
2. P	P39706	COMPASS component SWD1	4.44e-16	7.36e-06	NA
2. P	P53011	Nucleoporin SEH1	7.86e-11	7.18e-07	NA
2. P	A8PZI1	WD repeat-containing protein JIP5	9.94e-10	1.23e-03	NA
2. P	Q6FVL4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	6.11e-15	1.89e-03	NA
2. P	Q54QU5	WD repeat-containing protein 89 homolog	0.00e+00	1.51e-12	NA
2. P	Q1JQB2	Mitotic checkpoint protein BUB3	0.00e+00	9.48e-10	NA
2. P	P59235	Nucleoporin Nup43	3.01e-11	8.75e-05	NA
2. P	O42858	Set1 complex component swd1	3.15e-09	8.79e-03	NA
2. P	B0D442	WD repeat-containing protein JIP5	0.00e+00	1.32e-02	NA
2. P	Q58D06	WD repeat-containing protein 74	4.44e-16	7.28e-06	NA
2. P	Q0TZA1	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	6.93e-12	1.93e-02	NA
2. P	Q6FMH9	ASTRA-associated protein 1	4.50e-05	3.01e-04	NA
2. P	Q6RFH5	WD repeat-containing protein 74	5.77e-15	6.58e-07	NA
2. P	Q5U2Y0	WD repeat domain phosphoinositide-interacting protein 4	1.64e-11	1.44e-06	NA
2. P	Q38821	Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	5.16e-06	3.18e-03	NA
2. P	B4JWS7	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	6.00e-15	2.16e-03	NA
2. P	Q6FNJ1	Pre-rRNA-processing protein IPI3	1.04e-11	7.59e-03	NA
2. P	Q5QA93	SVP1-like protein 2	7.37e-08	8.86e-08	NA
2. P	Q5EBE8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.60e-05	NA
2. P	Q5AI86	Eukaryotic translation initiation factor 3 subunit I	2.22e-16	1.76e-03	NA
2. P	Q1HPW4	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.09e-03	NA
2. P	B5FZ19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	8.31e-07	NA
2. P	A5DKC4	Ribosome biogenesis protein NSA1	1.70e-13	1.95e-08	NA
2. P	Q5RAN6	Nucleoporin SEH1	4.55e-12	3.22e-05	NA
2. P	Q9LV27	Target of rapamycin complex subunit LST8-1	0.00e+00	4.08e-02	NA
2. P	Q2UBM4	WD repeat-containing protein jip5	1.62e-10	1.55e-05	NA
2. P	Q7ZXD5	Actin-related protein 2/3 complex subunit 1B-A	2.11e-15	3.38e-06	NA
2. P	Q54NA2	Autophagy-related protein 18	1.33e-09	6.90e-10	NA
2. P	Q9Y3F4	Serine-threonine kinase receptor-associated protein	1.36e-10	2.25e-08	NA
2. P	Q96FK6	WD repeat-containing protein 89	1.22e-15	4.37e-10	NA
2. P	B3N4C7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	3.89e-03	NA
2. P	Q0V320	Eukaryotic translation initiation factor 3 subunit I	5.91e-09	4.43e-03	NA
2. P	A6SJ85	Autophagy-related protein 18	5.57e-08	5.99e-05	NA
2. P	C9STX5	ASTRA-associated protein 1	2.22e-16	2.82e-02	NA
2. P	Q80YD6	Secretion-regulating guanine nucleotide exchange factor	3.17e-05	3.64e-02	NA
2. P	Q58CQ2	Actin-related protein 2/3 complex subunit 1B	3.95e-09	4.54e-08	NA
2. P	Q7SG97	SVP1-like protein 2	1.68e-06	5.02e-07	NA
2. P	Q9BTV6	Diphthine methyltransferase	8.29e-09	2.41e-07	NA
2. P	Q5BIM8	DNA excision repair protein ERCC-8	2.54e-09	3.91e-05	NA
2. P	A5DVU7	Autophagy-related protein 18	1.28e-05	4.66e-03	NA
2. P	Q6BWJ5	WD repeat-containing protein JIP5	1.76e-07	6.87e-03	NA
2. P	Q0V786	WD repeat-containing protein JIP5	7.97e-08	3.34e-06	NA
2. P	Q9P6N1	Autophagy-related protein 21	8.88e-16	2.13e-09	NA
2. P	A7ESR0	ASTRA-associated protein 1	9.45e-07	3.29e-07	NA
2. P	B4Q354	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.96e-03	NA
2. P	A1DMA6	WD repeat-containing protein jip5	6.36e-08	2.29e-05	NA
2. P	Q0U2J8	Autophagy-related protein 18	4.67e-07	4.80e-11	NA
2. P	Q6AY57	WD repeat domain phosphoinositide-interacting protein 2	6.73e-14	1.45e-05	NA
2. P	B4JB43	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.13e-03	NA
2. P	Q9C1X0	Uncharacterized WD repeat-containing protein C713.05	3.22e-15	5.86e-05	NA
2. P	Q9USR0	DNA excision repair protein ckn1	1.17e-14	1.70e-02	NA
2. P	P53031	Protein phosphatase PP2A regulatory subunit B	3.42e-07	1.46e-02	NA
2. P	C8ZJB0	ASTRA-associated protein 1	3.34e-08	3.85e-06	NA
2. P	Q8X1F5	Autophagy-related protein 18	NA	5.89e-07	NA
2. P	Q96U88	Autophagy-related protein 18	2.54e-07	6.86e-08	NA
2. P	Q640J6	WD repeat-containing protein 82-A	0.00e+00	1.55e-04	NA
2. P	A3LNM0	Pre-rRNA-processing protein IPI3	3.82e-12	2.12e-02	NA
2. P	Q6FL15	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	4.33e-06	NA
2. P	A7EW77	Autophagy-related protein 18	3.54e-07	4.33e-07	NA
2. P	A3LVX0	Ribosome biogenesis protein NSA1	8.50e-14	7.41e-08	NA
2. P	Q6NVS5	DDB1- and CUL4-associated factor 13	0.00e+00	3.34e-06	NA
2. P	Q6C953	Pre-rRNA-processing protein IPI3	1.78e-14	1.18e-06	NA
2. P	Q6CKX3	Eukaryotic translation initiation factor 3 subunit I	1.11e-16	4.38e-04	NA
2. P	Q9W328	Protein LST8 homolog	0.00e+00	3.85e-03	NA
2. P	A7UWE6	ASTRA-associated protein 1	1.43e-07	1.64e-04	NA
2. P	Q6GNU1	Actin-related protein 2/3 complex subunit 1B-B	4.96e-08	1.21e-06	NA
2. P	O80856	Actin-related protein 2/3 complex subunit 1A	1.03e-08	3.85e-06	NA
2. P	Q4WVD0	Autophagy-related protein 18	4.57e-08	5.18e-05	NA
2. P	Q9CYU6	Diphthine methyltransferase	1.30e-08	4.09e-03	NA
2. P	A4RJA0	ASTRA-associated protein 1	3.29e-06	5.47e-04	NA
2. P	B3LGB9	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	1.56e-13	3.15e-03	NA
3. B	Q9D994	WD repeat-containing protein 38	0.00e+00	NA	5.36e-05
3. B	G8SD34	NAD(+) hydrolase ApTIR	8.77e-15	NA	5.34e-05
3. B	Q0IF90	WD repeat-containing protein 55 homolog	2.65e-14	NA	0.002
3. B	Q7ZW33	U3 small nucleolar RNA-associated protein 15 homolog	0.00e+00	NA	1.59e-04
3. B	Q5BE22	Pre-mRNA-splicing factor prp46	1.93e-09	NA	0.025
3. B	Q8YRI1	Uncharacterized WD repeat-containing protein alr3466	4.94e-04	NA	4.92e-15
3. B	Q10G81	Histone-binding protein MSI1 homolog	0.00e+00	NA	0.031
3. B	Q5R664	Coatomer subunit beta'	1.20e-07	NA	1.50e-07
3. B	B4JWA1	Lissencephaly-1 homolog	0.00e+00	NA	1.33e-07
3. B	D5GBI7	Nuclear distribution protein PAC1	0.00e+00	NA	1.52e-05
3. B	A2R3Z3	Mitochondrial division protein 1	1.19e-05	NA	0.032
3. B	Q05048	Cleavage stimulation factor subunit 1	1.11e-16	NA	4.29e-04
3. B	O00423	Echinoderm microtubule-associated protein-like 1	1.85e-06	NA	0.005
3. B	A1L271	Guanine nucleotide-binding protein subunit beta-5a	0.00e+00	NA	0.006
3. B	Q9BQA1	Methylosome protein 50	0.00e+00	NA	0.002
3. B	O43172	U4/U6 small nuclear ribonucleoprotein Prp4	0.00e+00	NA	3.26e-04
3. B	Q6DRF9	WD repeat-containing protein 55	2.30e-13	NA	0.001
3. B	O74855	Ribosome assembly protein 4	1.78e-15	NA	3.34e-04
3. B	P74442	Uncharacterized WD repeat-containing protein slr0143	3.07e-05	NA	2.34e-08
3. B	P93563	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	0.024
3. B	Q9C827	Coatomer subunit beta'-2	8.54e-08	NA	2.06e-10
3. B	O94244	Histone acetyltransferase type B subunit 2	1.11e-16	NA	0.030
3. B	B3NPW0	Lissencephaly-1 homolog	0.00e+00	NA	4.69e-07
3. B	Q6P0D9	Probable cytosolic iron-sulfur protein assembly protein ciao1	0.00e+00	NA	0.021
3. B	Q8WV16	DDB1- and CUL4-associated factor 4	1.77e-11	NA	0.029
3. B	A6QM06	Sterol regulatory element-binding protein cleavage-activating protein	2.17e-06	NA	0.040
3. B	Q9NYS7	WD repeat and SOCS box-containing protein 2	4.44e-16	NA	8.72e-07
3. B	P35606	Coatomer subunit beta'	4.94e-08	NA	1.40e-07
3. B	Q75BY3	Pre-mRNA-splicing factor PRP46	5.13e-11	NA	1.83e-05
3. B	P62881	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	NA	0.022
3. B	Q3MHE2	U4/U6 small nuclear ribonucleoprotein Prp4	0.00e+00	NA	9.65e-05
3. B	Q1DZQ0	Protein transport protein SEC13	2.22e-16	NA	1.97e-04
3. B	A4R3M4	Nuclear distribution protein PAC1	2.01e-10	NA	4.64e-07
3. B	Q92636	Protein FAN	4.19e-11	NA	2.08e-05
3. B	Q2GVT8	Protein transport protein SEC31	1.47e-05	NA	7.06e-04
3. B	Q6P2Y2	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	1.55e-05
3. B	Q6CEW7	Ribosome biogenesis protein YTM1	2.06e-08	NA	0.024
3. B	Q12788	Transducin beta-like protein 3	2.58e-09	NA	0.045
3. B	C5FP68	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.01e-08	NA	0.002
3. B	C0NRC6	Nuclear distribution protein PAC1	6.24e-09	NA	4.59e-10
3. B	B8PD53	Nuclear distribution protein PAC1-2	NA	NA	2.89e-04
3. B	Q5XGE2	U3 small nucleolar RNA-associated protein 15 homolog	0.00e+00	NA	0.008
3. B	A0CH87	Lissencephaly-1 homolog 2	0.00e+00	NA	0.001
3. B	Q5M7K4	Histone-binding protein RBBP4	3.33e-16	NA	0.003
3. B	Q8MYE8	Probable proteasomal ATPase-associated factor 1	0.00e+00	NA	0.031
3. B	Q32LN7	WD repeat-containing protein 61	0.00e+00	NA	2.20e-04
3. B	Q6ZMY6	WD repeat-containing protein 88	0.00e+00	NA	0.008
3. B	P41318	Target of rapamycin complex subunit LST8	0.00e+00	NA	0.001
3. B	P47025	Mitochondrial division protein 1	1.05e-12	NA	0.012
3. B	P38968	Protein transport protein SEC31	1.22e-04	NA	0.011
3. B	A8X8C6	WD repeat-containing protein tag-125	0.00e+00	NA	2.66e-05
3. B	Q6NZH4	Lissencephaly-1 homolog	0.00e+00	NA	1.75e-09
3. B	C7Z6H2	Nuclear distribution protein PAC1	0.00e+00	NA	8.28e-08
3. B	Q61FW2	F-box/WD repeat-containing protein sel-10	1.48e-12	NA	4.30e-06
3. B	B0LSW3	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	NA	1.08e-09
3. B	Q8SQS4	Transcription initiation factor TFIID subunit 5	2.78e-15	NA	5.80e-05
3. B	P39014	F-box protein MET30	3.94e-06	NA	6.63e-05
3. B	P49846	Transcription initiation factor TFIID subunit 5	2.97e-13	NA	0.004
3. B	Q9P7I3	Mitochondrial division protein 1	5.13e-07	NA	9.30e-06
3. B	Q59RH5	Histone acetyltransferase type B subunit 2	0.00e+00	NA	0.009
3. B	A2QP30	Nuclear distribution protein nudF	0.00e+00	NA	1.69e-05
3. B	Q8NHY2	E3 ubiquitin-protein ligase COP1	2.86e-07	NA	3.03e-05
3. B	Q8YV57	Uncharacterized WD repeat-containing protein all2124	4.18e-05	NA	7.42e-12
3. B	Q8HXX0	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	2.11e-09
3. B	Q5XFW8	Protein SEC13 homolog	4.44e-16	NA	0.004
3. B	Q498M4	WD repeat-containing protein 5	0.00e+00	NA	2.66e-07
3. B	Q24572	Chromatin assembly factor 1 p55 subunit	0.00e+00	NA	8.76e-04
3. B	Q6GM71	Leucine-rich repeat and WD repeat-containing protein 1	1.43e-12	NA	0.002
3. B	A3LNI7	Nuclear distribution protein PAC1	3.33e-16	NA	0.011
3. B	Q0VC24	Ribosome biogenesis protein WDR12	0.00e+00	NA	0.001
3. B	Q12770	Sterol regulatory element-binding protein cleavage-activating protein	4.45e-06	NA	0.045
3. B	Q9D0I6	WD repeat, SAM and U-box domain-containing protein 1	0.00e+00	NA	0.007
3. B	P53024	Protein transport protein SEC13	0.00e+00	NA	0.004
3. B	P25635	Periodic tryptophan protein 2	2.41e-07	NA	0.001
3. B	Q6NPN9	WD repeat-containing protein DWA2	0.00e+00	NA	6.89e-04
3. B	P63244	Receptor of activated protein C kinase 1	2.11e-12	NA	4.63e-04
3. B	Q7T2F6	WD repeat and SOCS box-containing protein 1	1.17e-14	NA	2.59e-04
3. B	B4QHG6	Lissencephaly-1 homolog	0.00e+00	NA	4.77e-07
3. B	Q9FKT5	THO complex subunit 3	0.00e+00	NA	4.29e-04
3. B	Q0U1B1	Nuclear distribution protein PAC1	0.00e+00	NA	3.46e-07
3. B	Q9DC48	Pre-mRNA-processing factor 17	5.65e-14	NA	0.002
3. B	Q23256	WD repeat-containing protein wdr-5.3	1.11e-16	NA	2.68e-09
3. B	Q17963	WD repeat-containing protein wdr-5.1	0.00e+00	NA	2.31e-05
3. B	B2VWG7	Nuclear distribution protein PAC1	0.00e+00	NA	1.61e-07
3. B	Q4R2Z6	WD repeat-containing protein 48	7.58e-10	NA	2.25e-05
3. B	Q90ZL4	Lissencephaly-1 homolog	0.00e+00	NA	4.23e-09
3. B	P63245	Receptor of activated protein C kinase 1	2.04e-12	NA	4.63e-04
3. B	C4YFX2	Transcriptional repressor TUP1	1.11e-16	NA	3.72e-05
3. B	C4R6H3	Nuclear distribution protein PAC1	1.11e-16	NA	1.04e-05
3. B	P79959	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	NA	5.94e-04
3. B	Q8YTC2	Uncharacterized WD repeat-containing protein alr2800	1.10e-06	NA	4.72e-09
3. B	Q9DAW6	U4/U6 small nuclear ribonucleoprotein Prp4	0.00e+00	NA	1.21e-04
3. B	Q4WLM7	Nuclear distribution protein nudF	2.54e-09	NA	4.84e-05
3. B	P62882	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	NA	0.020
3. B	Q6P6T4	Echinoderm microtubule-associated protein-like 2	1.45e-07	NA	0.002
3. B	P61480	Ribosome biogenesis protein WDR12	0.00e+00	NA	0.001
3. B	Q4V8C3	Echinoderm microtubule-associated protein-like 1	1.74e-06	NA	0.021
3. B	P43254	E3 ubiquitin-protein ligase COP1	1.64e-07	NA	6.75e-05
3. B	Q8TED0	U3 small nucleolar RNA-associated protein 15 homolog	0.00e+00	NA	2.28e-04
3. B	Q9CAA0	Coatomer subunit beta'-1	7.01e-08	NA	2.15e-09
3. B	Q54LT8	Serine-threonine kinase receptor-associated protein	0.00e+00	NA	0.046
3. B	P78706	Transcriptional repressor rco-1	1.11e-16	NA	9.85e-07
3. B	Q94A40	Coatomer subunit alpha-1	1.80e-06	NA	1.17e-06
3. B	Q9HAV0	Guanine nucleotide-binding protein subunit beta-4	0.00e+00	NA	8.87e-04
3. B	O13286	WD repeat-containing protein srw1	8.44e-15	NA	0.010
3. B	Q0J3D9	Coatomer subunit alpha-3	1.60e-06	NA	1.49e-06
3. B	Q4R4I8	Coatomer subunit beta'	4.93e-08	NA	1.35e-07
3. B	Q8TAF3	WD repeat-containing protein 48	4.10e-09	NA	2.62e-05
3. B	B4KT48	Lissencephaly-1 homolog	0.00e+00	NA	2.42e-07
3. B	P54313	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	NA	1.18e-05
3. B	Q9EPV5	Apoptotic protease-activating factor 1	7.03e-06	NA	6.75e-05
3. B	Q8AVH1	Histone-binding protein RBBP7	0.00e+00	NA	0.003
3. B	Q6FJZ9	Pre-mRNA-splicing factor PRP46	5.52e-11	NA	0.004
3. B	Q9PTR5	Lissencephaly-1 homolog	0.00e+00	NA	5.36e-10
3. B	Q6NLV4	Flowering time control protein FY	6.45e-08	NA	0.007
3. B	Q2TBS9	WD40 repeat-containing protein SMU1	1.22e-15	NA	1.17e-06
3. B	B6HP56	Nuclear distribution protein nudF 1	2.59e-08	NA	1.06e-07
3. B	Q55FJ2	WD repeat-containing protein 91 homolog	8.25e-11	NA	0.023
3. B	P0CS37	Histone acetyltransferase type B subunit 2	0.00e+00	NA	0.016
3. B	P62883	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	2.39e-12
3. B	Q01277	Probable E3 ubiquitin ligase complex SCF subunit scon-2	2.43e-07	NA	9.05e-07
3. B	Q6H8D5	Coatomer subunit beta'-2	1.13e-07	NA	2.73e-10
3. B	Q9VU68	Actin-interacting protein 1	4.01e-08	NA	0.004
3. B	Q6CKE8	Pre-mRNA-splicing factor PRP46	8.72e-11	NA	0.006
3. B	Q3TZ89	Protein transport protein Sec31B	1.15e-05	NA	0.026
3. B	Q6CJ50	Mitochondrial division protein 1	8.38e-13	NA	0.015
3. B	O88879	Apoptotic protease-activating factor 1	1.44e-05	NA	2.05e-04
3. B	Q28I85	POC1 centriolar protein homolog A	2.83e-12	NA	1.95e-08
3. B	Q4R304	Histone-binding protein RBBP7	0.00e+00	NA	0.006
3. B	Q9AUR7	Coatomer subunit alpha-2	1.72e-06	NA	1.78e-05
3. B	P25382	Ribosome assembly protein 4	4.77e-15	NA	0.002
3. B	Q921C3	Bromodomain and WD repeat-containing protein 1	7.70e-03	NA	6.07e-05
3. B	Q8BG40	Katanin p80 WD40 repeat-containing subunit B1	2.29e-07	NA	5.34e-09
3. B	Q42384	Protein pleiotropic regulatory locus 1	6.01e-09	NA	7.69e-05
3. B	F1MNN4	F-box/WD repeat-containing protein 7	1.79e-11	NA	0.044
3. B	A0DB19	Lissencephaly-1 homolog 1	0.00e+00	NA	0.002
3. B	Q9SY00	COMPASS-like H3K4 histone methylase component WDR5B	0.00e+00	NA	1.98e-08
3. B	Q9UMS4	Pre-mRNA-processing factor 19	0.00e+00	NA	0.002
3. B	O54929	WD repeat and SOCS box-containing protein 2	2.44e-14	NA	4.15e-07
3. B	P16649	General transcriptional corepressor TUP1	2.67e-13	NA	6.08e-05
3. B	Q9GZL7	Ribosome biogenesis protein WDR12	0.00e+00	NA	0.002
3. B	D4DG66	Nuclear distribution protein PAC1	0.00e+00	NA	8.65e-07
3. B	Q55FR9	Coatomer subunit alpha	3.31e-06	NA	4.33e-09
3. B	Q6NUD0	Methylosome protein 50	0.00e+00	NA	4.31e-04
3. B	Q873A1	Protein transport protein sec31	8.79e-05	NA	5.11e-05
3. B	Q55DA2	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	0.003
3. B	Q5R9T6	WD repeat-containing protein 55	1.11e-15	NA	9.35e-06
3. B	Q9R1A8	E3 ubiquitin-protein ligase COP1	3.26e-07	NA	6.93e-05
3. B	Q09150	Meiotic recombination protein rec14	0.00e+00	NA	0.002
3. B	Q6PE01	U5 small nuclear ribonucleoprotein 40 kDa protein	1.11e-16	NA	3.20e-04
3. B	Q5SUS0	F-box/WD repeat-containing protein 10	1.56e-04	NA	5.04e-04
3. B	Q8W1K8	Protein Mut11	5.84e-10	NA	1.11e-05
3. B	P56094	General transcriptional corepressor TUP1	9.75e-14	NA	1.95e-05
3. B	Q9BQ87	F-box-like/WD repeat-containing protein TBL1Y	2.44e-15	NA	0.001
3. B	A2CEH0	POC1 centriolar protein homolog B	0.00e+00	NA	2.20e-09
3. B	O54927	WD repeat and SOCS box-containing protein 1	2.08e-14	NA	0.003
3. B	P69104	Guanine nucleotide-binding protein subunit beta-like protein	5.75e-11	NA	0.002
3. B	P53622	Coatomer subunit alpha	1.02e-06	NA	1.61e-07
3. B	Q8VBV4	F-box/WD repeat-containing protein 7	2.16e-11	NA	0.042
3. B	Q6DIP5	Echinoderm microtubule-associated protein-like 4	4.22e-07	NA	0.008
3. B	A0JPH4	Sterol regulatory element-binding protein cleavage-activating protein	3.25e-06	NA	0.002
3. B	Q08E38	Pre-mRNA-processing factor 19	0.00e+00	NA	0.002
3. B	Q9NSI6	Bromodomain and WD repeat-containing protein 1	3.31e-02	NA	1.02e-04
3. B	P63247	Receptor of activated protein C kinase 1	2.13e-12	NA	4.63e-04
3. B	Q54YD8	Coatomer subunit beta'	2.82e-07	NA	1.90e-11
3. B	Q9D7H2	WD repeat-containing protein 5B	0.00e+00	NA	7.60e-07
3. B	O60508	Pre-mRNA-processing factor 17	8.50e-14	NA	0.002
3. B	Q8VEJ4	Notchless protein homolog 1	2.53e-08	NA	0.001
3. B	P93398	Guanine nucleotide-binding protein subunit beta-2	0.00e+00	NA	0.029
3. B	C5FWH1	Nuclear distribution protein PAC1	0.00e+00	NA	6.01e-07
3. B	Q99KP6	Pre-mRNA-processing factor 19	0.00e+00	NA	0.005
3. B	O75529	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	2.00e-13	NA	0.028
3. B	Q27954	Coatomer subunit alpha	1.48e-05	NA	1.84e-04
3. B	Q5RAW8	WD repeat-containing protein 48	2.61e-09	NA	2.74e-05
3. B	Q5BJQ6	Cleavage stimulation factor subunit 1	1.11e-16	NA	1.65e-04
3. B	P54311	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	NA	5.89e-04
3. B	Q5R5W8	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	NA	6.44e-04
3. B	B6K1G6	Probable cytosolic Fe-S cluster assembly factor SJAG_02895	0.00e+00	NA	2.10e-05
3. B	B8P4B0	Nuclear distribution protein PAC1-1	1.98e-11	NA	3.63e-04
3. B	Q5IS43	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	1.04e-09
3. B	O16519	Gastrulation defective protein 1	2.32e-08	NA	7.26e-04
3. B	Q5XI13	Glutamate-rich WD repeat-containing protein 1	2.22e-16	NA	1.65e-06
3. B	Q6GM65	Phospholipase A-2-activating protein	6.44e-15	NA	0.001
3. B	Q8H594	Ribosome biogenesis protein WDR12 homolog	0.00e+00	NA	0.010
3. B	Q2HJE1	WD repeat-containing protein 91	1.69e-12	NA	0.010
3. B	P90917	Probable histone-binding protein rba-1	2.22e-16	NA	9.44e-05
3. B	Q26458	Polycomb protein esc	1.11e-16	NA	0.013
3. B	Q7KNS3	Lissencephaly-1 homolog	0.00e+00	NA	4.77e-07
3. B	A2RRU4	Sterol regulatory element-binding protein cleavage-activating protein	2.57e-06	NA	0.039
3. B	C3XVT5	Lissencephaly-1 homolog	0.00e+00	NA	1.58e-06
3. B	Q9NVX2	Notchless protein homolog 1	2.91e-08	NA	0.001
3. B	Q6P1V3	WD repeat and SOCS box-containing protein 1	1.92e-14	NA	6.77e-04
3. B	Q8HXL3	WD repeat-containing protein 62	1.84e-03	NA	0.003
3. B	Q9V3J8	Protein will die slowly	0.00e+00	NA	5.02e-05
3. B	Q6GPC6	F-box-like/WD repeat-containing protein TBL1XR1-B	5.33e-15	NA	0.002
3. B	Q9FN19	WD40 repeat-containing protein HOS15	1.53e-13	NA	0.003
3. B	Q96DI7	U5 small nuclear ribonucleoprotein 40 kDa protein	1.11e-16	NA	5.45e-04
3. B	F4KB17	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3	3.35e-07	NA	8.57e-10
3. B	A7MB12	U3 small nucleolar RNA-associated protein 15 homolog	0.00e+00	NA	5.48e-05
3. B	O22467	Histone-binding protein MSI1	0.00e+00	NA	2.78e-04
3. B	P90916	Probable histone-binding protein lin-53	2.22e-16	NA	0.001
3. B	C5GVJ9	Nuclear distribution protein PAC1	9.68e-09	NA	7.08e-06
3. B	Q28YY2	WD repeat-containing protein 48 homolog	3.87e-09	NA	7.72e-06
3. B	Q6CSI1	Histone acetyltransferase type B subunit 2	0.00e+00	NA	0.019
3. B	A1CBP8	Mitochondrial division protein 1	1.41e-05	NA	0.023
3. B	O48847	Transcriptional corepressor LEUNIG_HOMOLOG	1.80e-12	NA	1.68e-04
3. B	Q6CG48	Nuclear distribution protein PAC1	0.00e+00	NA	0.014
3. B	A1CGS0	Protein transport protein sec13	2.22e-16	NA	4.98e-04
3. B	Q5R8K2	Cleavage stimulation factor subunit 1	1.11e-16	NA	0.010
3. B	C4JPW9	Nuclear distribution protein PAC1-2	0.00e+00	NA	3.82e-10
3. B	Q0P593	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	1.23e-06
3. B	Q32LP9	Coronin-2A	1.11e-07	NA	5.14e-05
3. B	Q8VYZ5	Periodic tryptophan protein 2	1.19e-07	NA	2.46e-04
3. B	P62884	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	2.39e-12
3. B	Q71UF4	Histone-binding protein RBBP7	0.00e+00	NA	0.006
3. B	Q7ZTY4	Histone-binding protein RBBP7	0.00e+00	NA	0.002
3. B	Q7ZVR1	WD repeat-containing protein 75	7.20e-06	NA	0.037
3. B	A8NEG8	Nuclear distribution protein PAC1	0.00e+00	NA	2.89e-04
3. B	Q5ZMA2	Pre-mRNA-processing factor 19	0.00e+00	NA	1.27e-04
3. B	Q6S7B0	Transcription initiation factor TFIID subunit 5	7.26e-14	NA	8.71e-04
3. B	Q1JQD2	Glutamate-rich WD repeat-containing protein 1	1.44e-14	NA	2.81e-06
3. B	O93377	Histone-binding protein RBBP4-A	4.44e-16	NA	0.003
3. B	C4Q0P6	Lissencephaly-1 homolog	0.00e+00	NA	1.07e-07
3. B	Q5BJ90	Ribosome biogenesis protein wdr12	0.00e+00	NA	0.018
3. B	Q9W5Z5	WD repeat and SOCS box-containing protein 1	1.04e-14	NA	7.12e-04
3. B	A1CF18	Nuclear distribution protein nudF 2	0.00e+00	NA	1.21e-07
3. B	O22212	U4/U6 small nuclear ribonucleoprotein PRP4-like protein	0.00e+00	NA	0.018
3. B	Q6AZS2	Polycomb protein eed-B	0.00e+00	NA	0.049
3. B	O82266	Protein SLOW WALKER 1	0.00e+00	NA	0.003
3. B	Q08706	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	0.005
3. B	U4PCM1	pre-mRNA 3' end processing protein pfs-2	1.88e-07	NA	1.17e-04
3. B	Q6BU94	Pre-mRNA-splicing factor PRP46	0.00e+00	NA	2.63e-04
3. B	Q09028	Histone-binding protein RBBP4	4.44e-16	NA	0.003
3. B	Q5M786	WD repeat-containing protein 5	0.00e+00	NA	4.06e-07
3. B	O95170	CMT1A duplicated region transcript 1 protein	6.15e-07	NA	0.003
3. B	Q8K4P0	pre-mRNA 3' end processing protein WDR33	3.39e-09	NA	5.34e-05
3. B	Q5XX13	F-box/WD repeat-containing protein 10	9.78e-05	NA	0.007
3. B	B6QC06	Nuclear distribution protein nudF 2	0.00e+00	NA	3.08e-05
3. B	Q54KL5	WD repeat-containing protein 5 homolog	0.00e+00	NA	5.33e-08
3. B	Q4WNK7	Protein transport protein sec13	3.66e-15	NA	2.86e-04
3. B	Q6GQT6	Sterol regulatory element-binding protein cleavage-activating protein	3.17e-06	NA	0.012
3. B	Q9Y263	Phospholipase A-2-activating protein	3.00e-15	NA	0.005
3. B	Q61Y48	Probable histone-binding protein lin-53	2.22e-16	NA	7.21e-05
3. B	Q58D20	Notchless protein homolog 1	5.53e-08	NA	1.86e-04
3. B	P62872	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	NA	5.89e-04
3. B	Q5R654	Histone-binding protein RBBP7	2.00e-15	NA	0.021
3. B	Q03897	Maintenance of telomere capping protein 5	3.82e-09	NA	0.001
3. B	Q6P3H7	Histone-binding protein RBBP4	0.00e+00	NA	0.003
3. B	Q2HBX6	Nuclear distribution protein PAC1-1	4.29e-09	NA	1.67e-06
3. B	Q8C092	Transcription initiation factor TFIID subunit 5	8.36e-12	NA	6.30e-06
3. B	Q9GZS3	WD repeat-containing protein 61	0.00e+00	NA	2.06e-04
3. B	Q10282	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	0.036
3. B	A2RRU3	U3 small nucleolar RNA-associated protein 15 homolog	0.00e+00	NA	3.42e-04
3. B	P49177	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	0.003
3. B	Q9FLX9	Notchless protein homolog	1.44e-15	NA	1.09e-06
3. B	Q8L4J2	Cleavage stimulation factor subunit 50	3.33e-16	NA	4.15e-06
3. B	Q5ZIU8	Katanin p80 WD40 repeat-containing subunit B1	1.39e-14	NA	3.14e-08
3. B	F4HTH8	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2	8.38e-10	NA	4.21e-06
3. B	Q4QR85	Methylosome protein 50	0.00e+00	NA	0.001
3. B	Q0CHM0	Protein transport protein sec13	3.33e-16	NA	2.02e-04
3. B	P93107	Flagellar WD repeat-containing protein Pf20	0.00e+00	NA	1.62e-05
3. B	Q9JMJ4	Pre-mRNA-processing factor 19	0.00e+00	NA	0.005
3. B	Q8BH44	Coronin-2B	1.62e-13	NA	2.79e-04
3. B	O76734	General transcriptional corepressor tupA	0.00e+00	NA	8.02e-07
3. B	Q93847	WD repeat-containing protein wdr-5.2	0.00e+00	NA	7.89e-05
3. B	Q7T394	Lissencephaly-1 homolog A	0.00e+00	NA	1.39e-07
3. B	Q7ZXK9	Notchless protein homolog 1	5.48e-08	NA	5.07e-04
3. B	Q2TAY7	WD40 repeat-containing protein SMU1	1.55e-15	NA	1.17e-06
3. B	P26308	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	NA	4.59e-04
3. B	D3Z902	F-box/WD repeat-containing protein 7	2.23e-11	NA	0.049
3. B	Q9NDC9	Lissencephaly-1 homolog	0.00e+00	NA	0.002
3. B	Q1LV15	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	1.22e-04
3. B	O22466	WD-40 repeat-containing protein MSI1	0.00e+00	NA	3.72e-04
3. B	Q4V7A0	WD repeat-containing protein 61	0.00e+00	NA	5.29e-04
3. B	Q6BRR2	Protein transport protein SEC31	2.12e-08	NA	0.001
3. B	O43379	WD repeat-containing protein 62	4.87e-04	NA	0.015
3. B	A7TNS8	CCR4-associated factor 4 homolog	3.12e-13	NA	0.037
3. B	Q61011	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	0.00e+00	NA	0.002
3. B	Q5RDY7	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	NA	0.028
3. B	Q09715	Transcriptional repressor tup11	0.00e+00	NA	8.89e-05
3. B	Q4R8H1	F-box-like/WD repeat-containing protein TBL1X	2.48e-14	NA	1.60e-04
3. B	B5X3Z6	Lissencephaly-1 homolog A	0.00e+00	NA	2.29e-09
3. B	Q7RY30	Nuclear distribution protein nudF-2	0.00e+00	NA	5.01e-06
3. B	A2QHM1	Protein transport protein sec13	0.00e+00	NA	4.61e-05
3. B	Q86VZ2	WD repeat-containing protein 5B	0.00e+00	NA	1.34e-06
3. B	B4MY65	Lissencephaly-1 homolog	0.00e+00	NA	3.07e-08
3. B	Q5ZLL7	WD repeat-containing protein 91	3.09e-12	NA	0.036
3. B	Q5REG7	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	3.06e-09
3. B	Q8UUP2	Polycomb protein eed-A	0.00e+00	NA	0.049
3. B	A9V790	Lissencephaly-1 homolog	0.00e+00	NA	1.17e-05
3. B	Q5FWQ6	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	1.28e-05
3. B	Q7SZM9	F-box-like/WD repeat-containing protein TBL1XR1-A	6.33e-15	NA	0.002
3. B	Q3UMY5	Echinoderm microtubule-associated protein-like 4	9.65e-07	NA	0.006
3. B	Q66JG1	DNA damage-binding protein 2	1.14e-06	NA	0.005
3. B	P62874	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	NA	5.89e-04
3. B	C5JD40	Nuclear distribution protein PAC1	2.79e-09	NA	7.08e-06
3. B	Q91WM3	U3 small nucleolar RNA-interacting protein 2	0.00e+00	NA	4.80e-05
3. B	Q06078	U3 small nucleolar RNA-associated protein 21	8.38e-05	NA	0.045
3. B	P52287	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	0.00e+00	NA	0.002
3. B	Q9UT57	Probable cytosolic Fe-S cluster assembly factor SPAC806.02c	0.00e+00	NA	0.026
3. B	A1DP19	Nuclear distribution protein nudF	7.24e-11	NA	1.90e-05
3. B	C4JZS6	Nuclear distribution protein PAC1-1	0.00e+00	NA	4.93e-05
3. B	Q5REE0	U3 small nucleolar RNA-associated protein 15 homolog	0.00e+00	NA	2.28e-04
3. B	B4GAJ1	Lissencephaly-1 homolog	0.00e+00	NA	3.56e-07
3. B	Q8BHB4	WD repeat-containing protein 3	1.48e-12	NA	1.05e-04
3. B	P87053	F-box/WD repeat-containing protein pof1	2.36e-06	NA	1.08e-04
3. B	Q8C4J7	Transducin beta-like protein 3	3.42e-09	NA	0.030
3. B	Q5REE6	Ribosome biogenesis protein WDR12	0.00e+00	NA	0.002
3. B	P42527	Myosin heavy chain kinase A	2.74e-09	NA	0.033
3. B	Q4WT34	Pre-mRNA-splicing factor prp46	1.89e-09	NA	4.45e-04
3. B	Q9SYX2	Protein SUPPRESSOR OF PHYA-105 1	1.59e-05	NA	2.69e-08
3. B	Q6ZMW3	Echinoderm microtubule-associated protein-like 6	1.48e-02	NA	2.80e-05
3. B	P0CS36	Histone acetyltransferase type B subunit 2	0.00e+00	NA	0.016
3. B	Q969H0	F-box/WD repeat-containing protein 7	1.56e-11	NA	0.042
3. B	A7S338	Lissencephaly-1 homolog	0.00e+00	NA	4.35e-07
3. B	Q20636	Guanine nucleotide-binding protein subunit beta-2	0.00e+00	NA	0.002
3. B	Q2HJH6	U5 small nuclear ribonucleoprotein 40 kDa protein	1.11e-16	NA	2.17e-04
3. B	Q9GL51	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	8.12e-10
3. B	Q6P315	Histone-binding protein RBBP7	0.00e+00	NA	0.003
3. B	Q6PFM9	WD repeat-containing protein 48	3.97e-09	NA	5.19e-05
3. B	D1ZEM6	Nuclear distribution protein PAC1-2	4.12e-10	NA	9.50e-05
3. B	Q5BK30	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	3.21e-05
3. B	A4D1P6	WD repeat-containing protein 91	2.00e-12	NA	0.015
3. B	P38129	Transcription initiation factor TFIID subunit 5	4.16e-11	NA	0.030
3. B	P23232	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	0.002
3. B	C6HTE8	Nuclear distribution protein PAC1	1.78e-09	NA	4.59e-10
3. B	Q5DFU0	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	2.55e-04
3. B	Q810D6	Glutamate-rich WD repeat-containing protein 1	3.33e-16	NA	1.93e-07
3. B	Q7S7L4	Nuclear distribution protein nudF-1	5.94e-09	NA	9.67e-05
3. B	P0CY34	Transcriptional repressor TUP1	1.11e-16	NA	3.73e-05
3. B	P61964	WD repeat-containing protein 5	0.00e+00	NA	2.66e-07
3. B	O14170	WD repeat-containing protein pop2	7.68e-11	NA	1.82e-05
3. B	Q8CGF6	WD repeat-containing protein 47	7.12e-13	NA	0.007
3. B	P36408	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	6.62e-05
3. B	P0CS42	Nuclear distribution protein PAC1	0.00e+00	NA	7.58e-06
3. B	O35142	Coatomer subunit beta'	5.78e-08	NA	1.02e-06
3. B	B7QKS1	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	3.53e-06
3. B	Q9QXE7	F-box-like/WD repeat-containing protein TBL1X	5.55e-15	NA	4.73e-04
3. B	Q75BS7	DNA damage-binding protein CMR1	9.16e-14	NA	3.12e-04
3. B	Q9BZK7	F-box-like/WD repeat-containing protein TBL1XR1	3.55e-15	NA	8.51e-04
3. B	Q7ZXZ2	U3 small nucleolar RNA-associated protein 15 homolog	0.00e+00	NA	0.011
3. B	Q6TMK6	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	NA	NA	2.39e-04
3. B	Q54ZP5	WD repeat-containing protein 48 homolog	1.22e-02	NA	0.027
3. B	Q5NVD0	U4/U6 small nuclear ribonucleoprotein Prp4	0.00e+00	NA	1.28e-04
3. B	Q05946	U3 small nucleolar RNA-associated protein 13	4.49e-10	NA	2.65e-05
3. B	Q7TMQ7	WD repeat-containing protein 91	4.67e-12	NA	0.014
3. B	A0A1P8AW69	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1	9.95e-11	NA	9.40e-06
3. B	Q4R7Y4	Guanine nucleotide-binding protein subunit beta-2-like 1	2.07e-12	NA	4.63e-04
3. B	P93471	E3 ubiquitin-protein ligase COP1	7.47e-07	NA	3.91e-05
3. B	Q6CBI8	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	0.006
3. B	Q91WQ5	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	1.44e-13	NA	0.006
3. B	Q12523	WD repeat-containing protein YPL247C	0.00e+00	NA	0.012
3. B	Q803D2	Lissencephaly-1 homolog B	0.00e+00	NA	1.38e-09
3. B	Q9UNX4	WD repeat-containing protein 3	1.60e-12	NA	0.008
3. B	P97260	Sterol regulatory element-binding protein cleavage-activating protein	2.30e-06	NA	0.041
3. B	Q9AUR8	Coatomer subunit alpha-1	1.03e-05	NA	1.67e-06
3. B	Q9C1X1	Periodic tryptophan protein 2 homolog	6.57e-08	NA	0.009
3. B	Q6ED65	Echinoderm microtubule-associated protein-like 5	9.98e-03	NA	0.041
3. B	A6ZQL5	Mitochondrial division protein 1	1.11e-12	NA	0.045
3. B	P49695	Probable serine/threonine-protein kinase PkwA	2.22e-16	NA	3.44e-08
3. B	Q9Y1C1	77 kDa echinoderm microtubule-associated protein (Fragment)	1.24e-07	NA	0.023
3. B	Q95RJ9	F-box-like/WD repeat-containing protein ebi	9.24e-13	NA	1.59e-04
3. B	O74319	Transcription initiation factor TFIID subunit taf73	4.17e-13	NA	1.96e-06
3. B	P41811	Coatomer subunit beta'	1.00e-07	NA	8.24e-08
3. B	A8JAN3	Centriole proteome protein 16	6.63e-06	NA	0.003
3. B	Q8BUB4	WD repeat and FYVE domain-containing protein 2	3.53e-11	NA	2.33e-04
3. B	Q3U3T8	WD repeat-containing protein 62	1.87e-03	NA	0.005
3. B	Q05B17	WD repeat-containing protein 48	2.62e-09	NA	2.26e-05
3. B	Q4R8E7	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	6.76e-07
3. B	Q39190	Protein pleiotropic regulator PRL2	7.04e-09	NA	0.002
3. B	P17343	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	NA	0.039
3. B	P61965	WD repeat-containing protein 5	0.00e+00	NA	2.66e-07
3. B	Q3SWX8	Histone-binding protein RBBP7	0.00e+00	NA	0.006
3. B	Q8I0F4	Lissencephaly-1 homolog	0.00e+00	NA	7.08e-06
3. B	B0XM00	Nuclear distribution protein nudF	3.83e-09	NA	4.84e-05
3. B	Q5R6T6	WD repeat-containing protein 91	7.71e-13	NA	0.013
3. B	Q9XF57	Peroxisome biogenesis protein 7	0.00e+00	NA	0.001
3. B	P49178	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	2.83e-04
3. B	Q76B40	WD40 repeat-containing protein SMU1	8.88e-16	NA	1.17e-06
3. B	Q5U2W5	Transducin beta-like protein 3	2.38e-09	NA	0.033
3. B	Q32PG3	WD repeat-containing protein 48	2.46e-09	NA	2.57e-05
3. B	P43033	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	NA	1.16e-09
3. B	P35605	Coatomer subunit beta'	5.80e-08	NA	1.47e-07
3. B	Q0V8J1	WD repeat and SOCS box-containing protein 2	1.89e-15	NA	2.92e-07
3. B	Q00808	Vegetative incompatibility protein HET-E-1	5.84e-06	NA	5.14e-08
3. B	Q5ZJH5	WD repeat-containing protein 61	0.00e+00	NA	2.34e-04
3. B	P63246	Receptor of activated protein C kinase 1	2.18e-12	NA	4.63e-04
3. B	Q9VZF4	F-box/WD repeat-containing protein 7	2.04e-07	NA	0.038
3. B	Q2TAF3	Echinoderm microtubule-associated protein-like 4	4.17e-07	NA	0.004
3. B	Q566T0	Polycomb protein eed	0.00e+00	NA	0.031
3. B	B7FNU7	Lissencephaly-1 homolog	0.00e+00	NA	5.61e-06
3. B	C0S902	Nuclear distribution protein PAC1	1.60e-09	NA	3.00e-08
3. B	Q8N136	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	1.95e-08
3. B	Q7ZVF0	POC1 centriolar protein homolog A	0.00e+00	NA	2.42e-10
3. B	Q8H0T9	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4	2.10e-12	NA	1.94e-05
3. B	B6QC56	Nuclear distribution protein nudF 1	0.00e+00	NA	3.91e-05
3. B	Q9W7I5	Histone-binding protein RBBP4	4.44e-16	NA	0.003
3. B	Q4V7Y7	Katanin p80 WD40 repeat-containing subunit B1	2.86e-14	NA	1.63e-07
3. B	Q58DT8	WD repeat-containing protein 55	4.19e-13	NA	0.001
3. B	P87060	WD repeat-containing protein pop1	1.72e-07	NA	0.006
3. B	P0CS43	Nuclear distribution protein PAC1	0.00e+00	NA	7.58e-06
3. B	A8XZJ9	Lissencephaly-1 homolog	0.00e+00	NA	0.001
3. B	B6GZD3	Nuclear distribution protein nudF 2	0.00e+00	NA	2.31e-05
3. B	Q7TNG5	Echinoderm microtubule-associated protein-like 2	1.41e-07	NA	0.009
3. B	Q8N0X2	Sperm-associated antigen 16 protein	1.11e-16	NA	1.01e-07
3. B	Q5GIS3	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	5.55e-05
3. B	D3BUN1	Lissencephaly-1 homolog	0.00e+00	NA	1.82e-06
3. B	P54319	Phospholipase A-2-activating protein	3.00e-15	NA	7.33e-04
3. B	Q8BHJ5	F-box-like/WD repeat-containing protein TBL1XR1	2.11e-15	NA	0.001
3. B	P55735	Protein SEC13 homolog	7.77e-16	NA	0.001
3. B	Q6GMD2	WD repeat-containing protein 61	0.00e+00	NA	1.58e-04
3. B	A8IZG4	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	0.004
3. B	Q61ZF6	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	NA	0.039
3. B	Q7ZVA0	WD40 repeat-containing protein SMU1	6.66e-16	NA	0.023
3. B	Q4ICM0	Nuclear distribution protein PAC1	0.00e+00	NA	1.31e-07
3. B	Q8K450	Sperm-associated antigen 16 protein	1.11e-16	NA	3.19e-07
3. B	Q0D0X6	Nuclear distribution protein nudF	0.00e+00	NA	1.86e-04
3. B	B2AEZ5	Nuclear distribution protein PAC1-1	4.83e-09	NA	8.89e-06
3. B	Q9P783	Ribosome assembly protein rrb1	2.22e-16	NA	0.006
3. B	P62873	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	NA	5.89e-04
3. B	A7EKM8	Nuclear distribution protein PAC1	1.26e-10	NA	1.45e-05
3. B	Q5F3K4	WD repeat-containing protein 48	2.70e-09	NA	4.32e-05
3. B	Q99LC2	Cleavage stimulation factor subunit 1	1.11e-16	NA	1.65e-04
3. B	Q5SQM0	Echinoderm microtubule-associated protein-like 6	1.03e-02	NA	1.04e-05
3. B	Q15542	Transcription initiation factor TFIID subunit 5	6.73e-12	NA	6.46e-06
3. B	Q5RFF8	Notchless protein homolog 1	2.69e-08	NA	8.82e-04
3. B	P46800	Guanine nucleotide-binding protein subunit beta-like protein	7.79e-14	NA	6.39e-06
3. B	B4GIJ0	WD repeat-containing protein 48 homolog	1.42e-09	NA	7.72e-06
3. B	Q5FVN8	WD repeat, SAM and U-box domain-containing protein 1	0.00e+00	NA	3.92e-04
3. B	O35353	Guanine nucleotide-binding protein subunit beta-4	0.00e+00	NA	6.38e-04
3. B	Q86H45	Probable elongator complex protein 2	4.09e-05	NA	7.50e-05
3. B	Q2UG43	Protein transport protein sec13	4.44e-16	NA	4.49e-04
3. B	Q6H8D6	Putative coatomer subunit beta'-3	9.40e-08	NA	9.33e-11
3. B	Q4I7L0	Histone acetyltransferase type B subunit 2	0.00e+00	NA	3.28e-05
3. B	Q291L9	Lissencephaly-1 homolog	0.00e+00	NA	3.56e-07
3. B	Q6INH0	Histone-binding protein RBBP4-B	0.00e+00	NA	0.003
3. B	O14775	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	NA	0.034
3. B	Q60973	Histone-binding protein RBBP7	3.33e-16	NA	0.006
3. B	Q5RF51	U5 small nuclear ribonucleoprotein 40 kDa protein	1.11e-16	NA	0.004
3. B	O60136	Uncharacterized WD repeat-containing protein C18H10.05	1.73e-13	NA	0.047
3. B	P62871	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	NA	5.89e-04
3. B	Q3Y8L7	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	4.82e-04
3. B	Q5F3D7	U3 small nucleolar RNA-associated protein 15 homolog	0.00e+00	NA	5.19e-06
3. B	Q8BH57	WD repeat-containing protein 48	2.57e-09	NA	2.29e-05
3. B	Q3MKM6	U3 snoRNP-associated protein-like EMB2271	0.00e+00	NA	0.027
3. B	Q8C0P5	Coronin-2A	6.25e-08	NA	7.58e-04
3. B	P63004	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	1.08e-09
3. B	Q10990	Cell division cycle protein cdt2	3.33e-16	NA	0.018
3. B	Q6PNB6	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	NA	0.028
3. B	O42248	Guanine nucleotide-binding protein subunit beta-2-like 1	1.95e-12	NA	8.01e-05
3. B	Q3MHL3	Histone-binding protein RBBP4	0.00e+00	NA	0.003
3. B	Q8TBZ3	WD repeat-containing protein 20	2.35e-08	NA	0.026
3. B	Q2GT28	Nuclear distribution protein PAC1-2	0.00e+00	NA	2.85e-05
3. B	Q8MY12	Myosin heavy chain kinase C	2.01e-14	NA	9.92e-05
3. B	Q2KIG2	WD repeat-containing protein 5	0.00e+00	NA	2.88e-07
3. B	O55029	Coatomer subunit beta'	1.24e-07	NA	1.40e-07
3. B	Q8NI36	WD repeat-containing protein 36	1.33e-05	NA	0.016
3. B	Q99J09	Methylosome protein 50	0.00e+00	NA	2.10e-04
3. B	Q9CX97	WD repeat-containing protein 55	2.19e-13	NA	0.001
3. B	P62880	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	NA	1.18e-05
3. B	A1L112	WD repeat-containing protein 55	1.26e-13	NA	1.52e-04
3. B	P0CS40	WD repeat-containing protein JIP5	2.40e-11	NA	0.007
3. B	Q92828	Coronin-2A	4.69e-08	NA	6.65e-04
3. B	O43017	Set1 complex component swd3	0.00e+00	NA	1.27e-07
3. B	Q3UKJ7	WD40 repeat-containing protein SMU1	9.99e-16	NA	1.17e-06
3. B	B5X3C4	Lissencephaly-1 homolog B	0.00e+00	NA	2.17e-08
3. B	Q20168	Probable coatomer subunit beta'	2.29e-07	NA	9.69e-11
3. B	B2ZZS9	WD repeat-containing protein 55	1.89e-15	NA	0.008
3. B	Q5ZJL7	DNA damage-binding protein 2	3.17e-07	NA	0.029
3. B	Q6NRT3	WD40 repeat-containing protein SMU1	8.88e-16	NA	0.009
3. B	O43818	U3 small nucleolar RNA-interacting protein 2	0.00e+00	NA	5.15e-05
3. B	Q9D1M0	Protein SEC13 homolog	4.44e-16	NA	0.004
3. B	B8M0Q1	Nuclear distribution protein nudF	2.32e-09	NA	6.59e-05
3. B	Q10051	Pre-mRNA-processing factor 19	0.00e+00	NA	1.99e-07
3. B	Q60972	Histone-binding protein RBBP4	3.33e-16	NA	0.003
3. B	Q9I8G9	Histone-binding protein RBBP7	0.00e+00	NA	0.003
3. B	Q2KJJ5	Transducin beta-like protein 3	9.12e-09	NA	0.012
3. B	Q229Z6	POC1 centriolar protein homolog	9.11e-07	NA	3.67e-05
3. B	C1GB49	Nuclear distribution protein PAC1	1.05e-09	NA	2.70e-08
3. B	Q9SJT9	Coatomer subunit alpha-2	1.84e-06	NA	4.38e-06
3. B	P0CS41	WD repeat-containing protein JIP5	3.53e-12	NA	0.007
3. B	C5PFX0	Nuclear distribution protein PAC1	8.98e-11	NA	2.31e-06
3. B	O14435	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	0.001
3. B	Q99M63	WD40 repeat-containing protein SMU1	7.77e-16	NA	1.00e-06
3. B	Q9BVA0	Katanin p80 WD40 repeat-containing subunit B1	1.27e-14	NA	5.88e-09
3. B	Q80ZD0	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	NA	0.028
3. B	B4P6P9	Lissencephaly-1 homolog	0.00e+00	NA	4.69e-07
3. B	B3S4I5	Lissencephaly-1 homolog	0.00e+00	NA	2.57e-06
3. B	Q9XZ25	GATOR complex protein WDR24	6.71e-13	NA	1.94e-05
3. B	Q4P9P9	Nuclear distribution protein PAC1	0.00e+00	NA	1.25e-04
3. B	B4LQ21	Lissencephaly-1 homolog	0.00e+00	NA	2.49e-07
3. B	O94365	U3 small nucleolar RNA-associated protein 15	0.00e+00	NA	0.002
3. B	P79147	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	0.00e+00	NA	0.002
3. B	Q5RFQ3	Periodic tryptophan protein 2 homolog	1.33e-07	NA	0.002
3. B	Q9UUG8	Transcriptional repressor tup12	2.22e-16	NA	2.73e-06
3. B	A0JP70	WD repeat-containing protein 90	2.51e-03	NA	1.05e-04
3. B	Q2UGU1	Nuclear distribution protein nudF	0.00e+00	NA	1.76e-07
3. B	Q25306	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	2.34e-12
3. B	P53621	Coatomer subunit alpha	1.63e-05	NA	3.44e-04
3. B	Q8BQM8	Echinoderm microtubule-associated protein-like 5	1.09e-02	NA	0.021
3. B	Q9Z2Q1	Protein transport protein Sec31A	1.13e-04	NA	0.041
3. B	Q6P5M2	WD repeat-containing protein 61	0.00e+00	NA	6.30e-05
3. B	A5DXE2	Protein transport protein SEC13	0.00e+00	NA	0.001
3. B	A4R2Q6	Ribosome biogenesis protein YTM1	5.55e-16	NA	0.002
3. B	Q9VU65	POC1 centriolar protein homolog	0.00e+00	NA	2.53e-05
3. B	Q9USN3	Probable U3 small nucleolar RNA-associated protein 13	4.35e-06	NA	1.33e-05
3. B	Q6P4J8	WD40 repeat-containing protein SMU1	9.99e-16	NA	0.029
3. B	Q3ZCC9	Protein SEC13 homolog	4.44e-16	NA	0.007
3. B	Q24338	Polycomb protein esc	1.11e-16	NA	0.017
3. B	Q5VQ78	Coatomer subunit beta'-1	9.23e-08	NA	4.44e-09
3. B	Q15269	Periodic tryptophan protein 2 homolog	1.35e-07	NA	0.002
3. B	Q54PE0	Periodic tryptophan protein 2 homolog	2.09e-07	NA	3.80e-07
3. B	Q54S79	WD repeat-containing protein 3 homolog	4.57e-06	NA	0.006
3. B	Q9M2Z2	COMPASS-like H3K4 histone methylase component WDR5A	0.00e+00	NA	2.34e-07
3. B	Q6ZPG2	WD repeat-containing protein 90	2.19e-03	NA	0.002
3. B	Q04491	Protein transport protein SEC13	0.00e+00	NA	0.016
3. B	B4HSL3	Lissencephaly-1 homolog	0.00e+00	NA	4.77e-07
3. B	P63005	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	NA	1.08e-09
3. B	P63243	Receptor of activated protein C kinase 1	2.16e-12	NA	4.63e-04
3. B	A5DB75	Protein transport protein SEC31	1.93e-05	NA	0.041
3. B	Q93454	mRNA export factor rae-1	1.11e-15	NA	0.009
3. B	Q5RF92	Histone-binding protein RBBP4	0.00e+00	NA	0.003
3. B	O60907	F-box-like/WD repeat-containing protein TBL1X	2.07e-14	NA	2.75e-04
3. B	Q26613	77 kDa echinoderm microtubule-associated protein	5.75e-07	NA	0.014
3. B	Q16576	Histone-binding protein RBBP7	2.22e-16	NA	0.006
3. B	Q8CIE6	Coatomer subunit alpha	1.59e-05	NA	2.08e-04
3. B	Q5E9I7	Methylosome protein 50	0.00e+00	NA	0.004
3. B	D4AZ50	Nuclear distribution protein PAC1	0.00e+00	NA	8.65e-07
3. B	Q00659	Probable E3 ubiquitin ligase complex SCF subunit sconB	5.92e-07	NA	0.015
3. B	Q9ERF3	WD repeat-containing protein 61	0.00e+00	NA	5.15e-04
3. B	D1ZEB4	Nuclear distribution protein PAC1-1	0.00e+00	NA	5.99e-06
3. B	Q6NVM2	Katanin p80 WD40 repeat-containing subunit B1	1.12e-14	NA	2.32e-07
3. B	B8N9H4	Nuclear distribution protein nudF	0.00e+00	NA	1.76e-07
3. B	P62879	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	NA	1.18e-05
3. B	Q2GSM6	Protein transport protein SEC13	4.55e-15	NA	0.007
3. B	O14021	RbAp48-related WD40 repeat-containing protein prw1	0.00e+00	NA	0.003
3. B	Q55563	Uncharacterized WD repeat-containing protein sll0163	2.05e-04	NA	8.62e-06
3. B	Q9BQ67	Glutamate-rich WD repeat-containing protein 1	1.48e-14	NA	1.31e-07
3. B	O62621	Coatomer subunit beta'	6.45e-08	NA	1.22e-09
3. B	O22468	WD-40 repeat-containing protein MSI2	0.00e+00	NA	0.043
3. B	Q54ED4	Glutamate-rich WD repeat-containing protein 1	2.22e-16	NA	7.78e-04
3. B	Q9C0J8	pre-mRNA 3' end processing protein WDR33	3.72e-09	NA	4.81e-05
3. B	P68040	Receptor of activated protein C kinase 1	2.22e-12	NA	4.63e-04
3. B	D3TLL6	Lissencephaly-1 homolog	0.00e+00	NA	1.17e-06
3. B	A1CUD6	Nuclear distribution protein nudF 1	8.79e-10	NA	1.67e-04
3. B	Q9Y6I7	WD repeat and SOCS box-containing protein 1	9.99e-15	NA	6.24e-04
3. B	Q9FFA7	WD repeat-containing protein RUP2	6.31e-09	NA	0.003
3. B	O94967	WD repeat-containing protein 47	1.43e-12	NA	0.008
3. B	O61585	Katanin p80 WD40 repeat-containing subunit B1	2.86e-08	NA	1.08e-11
3. B	A2RRH5	WD repeat-containing protein 27	7.33e-06	NA	0.047
3. B	Q5ZME8	WD40 repeat-containing protein SMU1	1.11e-15	NA	2.41e-06
3. B	Q05B30	WD repeat-containing protein 91	5.46e-12	NA	0.016
3. B	P93397	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	NA	0.007
3. B	Q6PH57	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	NA	1.11e-04
3. B	Q5RE95	WD repeat-containing protein 5B	0.00e+00	NA	6.69e-07
3. B	Q06440	Coronin-like protein	5.71e-06	NA	0.029
3. B	O00628	Peroxisomal targeting signal 2 receptor	0.00e+00	NA	8.28e-04
3. B	Q5MNU5	Sterol regulatory element-binding protein cleavage-activating protein	4.00e-06	NA	0.036
3. B	Q4V8C4	WD repeat-containing protein 5B	0.00e+00	NA	1.16e-06
3. B	Q5RBZ2	Methylosome protein 50	0.00e+00	NA	4.49e-04
3. B	Q9VPR4	Protein Notchless	1.51e-08	NA	0.002
3. B	Q6PBD6	WD repeat-containing protein 61	0.00e+00	NA	8.40e-05
3. B	Q17N69	Lissencephaly-1 homolog	0.00e+00	NA	1.80e-06
3. B	P29387	Guanine nucleotide-binding protein subunit beta-4	0.00e+00	NA	4.89e-04
3. B	Q54SD4	Probable histone-binding protein rbbD	5.55e-16	NA	2.50e-04
3. B	B7PS00	Lissencephaly-1 homolog	0.00e+00	NA	4.32e-06
3. B	Q7ZUV2	Katanin p80 WD40 repeat-containing subunit B1	4.05e-08	NA	4.87e-10
3. B	P69103	Guanine nucleotide-binding protein subunit beta-like protein	4.56e-11	NA	0.002
3. B	Q8C7V3	U3 small nucleolar RNA-associated protein 15 homolog	0.00e+00	NA	3.24e-04
3. B	Q05BC3	Echinoderm microtubule-associated protein-like 1	1.72e-06	NA	0.026
3. B	P16520	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	0.00e+00	NA	4.05e-04
3. B	Q93794	F-box/WD repeat-containing protein sel-10	1.31e-12	NA	1.41e-05
3. B	Q05BV3	Echinoderm microtubule-associated protein-like 5	9.84e-03	NA	0.002
3. B	P43034	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	NA	1.08e-09
3. B	P11017	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	NA	1.18e-05
3. B	P27612	Phospholipase A-2-activating protein	2.33e-15	NA	7.45e-04
3. B	Q5AEF2	Protein transport protein SEC13	0.00e+00	NA	0.045
3. B	A1DDL6	Mitochondrial division protein 1	1.52e-05	NA	0.048
3. B	Q8L828	Coatomer subunit beta'-3	6.33e-08	NA	2.39e-11
3. B	B5X9P2	Probable cytosolic iron-sulfur protein assembly protein ciao1-A	0.00e+00	NA	0.018
3. B	B3MEY6	Lissencephaly-1 homolog	0.00e+00	NA	4.10e-07
3. B	Q9JJA4	Ribosome biogenesis protein WDR12	0.00e+00	NA	0.002
3. B	O14727	Apoptotic protease-activating factor 1	4.60e-06	NA	6.14e-06
3. B	Q00664	Nuclear distribution protein nudF	0.00e+00	NA	0.001
3. B	Q4RJN5	Lissencephaly-1 homolog	0.00e+00	NA	8.38e-09
3. B	O45040	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	NA	4.63e-04
3. B	B2B766	Nuclear distribution protein PAC1-2	0.00e+00	NA	7.27e-04