Results | PROST

Summary

Q86TI4

Homolog: Q75BY3.
Function: Pre-mRNA-splicing factor PRP46.

Statistics

Total GO Annotation: 721
Unique PROST Go: 97
Unique BLAST Go: 422

Total Homologs: 1282
Unique PROST Homologs: 81
Unique BLAST Homologs: 935

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q75BY3 (Pre-mRNA-splicing factor PRP46) with a FATCAT P-Value: 0.0 and RMSD of 3.02 angstrom. The sequence alignment identity is 25.4%.
Structural alignment shown in left. Query protein Q86TI4 colored as red in alignment, homolog Q75BY3 colored as blue. Query protein Q86TI4 is also shown in right top, homolog Q75BY3 showed in right bottom. They are colored based on secondary structures.

  Q86TI4 -----------------------------------MGGGGSALRVCADH---RGGINWL---SL-----SPDGQR-LL---TGSEDGTARL--------- 41
  Q75BY3 MNEHSDDVYVRARLRNQFGYMTWVPEYVEDRISSKKG----ILQRYEDYQQKQAKAQEVKTDSLVKYEGAKDVPRNLLRIYRGEAD-TSALARYEEVVSQ 95

  Q86TI4 ---WSTADGQCCALLQGHESYV-TFCQLE--DEAAF-TCSADCTIRRWDVLTGQCLQV-YRGHTSIVNRILV-ANN-QLFSSSYDRTARVWSVDKGQMSR 131
  Q75BY3 KPQWH-APWKLTRVINGHTGWVRCVC-VDPVDNAWFATGSNDSTIRVWDLATGK-LKVTLQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERNTVVR 192

  Q86TI4 EFRGHRNCVLTLA--YSAPWDL-PSTPCAEEAAAGGLLVTGSTDGTAKVWQVASGCCHQTLRGHTG---AVLCLVLDTPGHTAFTGSTDATIRAWDILSG 225
  Q75BY3 DFHG------TLSGVHSV--DLHPSL---------DLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVD-P--QIVSCSTDATVKLWDLVAG 272

  Q86TI4 EQLRVFREHRGSVICLEL-VNRLVYS-GSA--DRTVKCW-LADTGECVRTFTAHRRN-VSALKYHA-GTLFTGSGDACARAFDAQSGELRRVF---RGHT 315
  Q75BY3 KPMKTLTHHKRNV--RDLAFNPTEFSFASACTD-DIRSWKLVD-GQLLTNFNSEALGIVNTLACNQDGVLFAG-GD---------TGEL-SFFDYKTGHK 357

  Q86TI4 FI-INCIQVHGQVLYTASHDGAL-RLWDVRGLR--GAPRPPPPMRSLSRLFSNKVGCA--AAP-L--QPA------ 376
  Q75BY3 FQKLETTAMPGSL---ESEKGVLASTFDRTGLRLLTCERD----KSI-KIWKHIDGATQDSHPGLPWNPSLVRQRF 425

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0031932	TORC2 complex
1. PB	GO:0035591	signaling adaptor activity
1. PB	GO:0007369	gastrulation
1. PB	GO:0051434	BH3 domain binding
1. PB	GO:0043614	multi-eIF complex
1. PB	GO:0051028	mRNA transport
1. PB	GO:0007080	mitotic metaphase plate congression
1. PB	GO:0000346	transcription export complex
1. PB	GO:0001934	positive regulation of protein phosphorylation
1. PB	GO:0005643	nuclear pore
1. PB	GO:0008283	cell population proliferation
1. PB	GO:0006368	transcription elongation from RNA polymerase II promoter
1. PB	GO:0051898	negative regulation of protein kinase B signaling
1. PB	GO:0035327
1. PB	GO:1902610	response to N-phenylthiourea
1. PB	GO:0005080	protein kinase C binding
1. PB	GO:0042800	histone methyltransferase activity (H3-K4 specific)
1. PB	GO:2000543	positive regulation of gastrulation
1. PB	GO:0003743	translation initiation factor activity
1. PB	GO:0006406	mRNA export from nucleus
1. PB	GO:0038202	TORC1 signaling
1. PB	GO:0071870	cellular response to catecholamine stimulus
1. PB	GO:0000132	establishment of mitotic spindle orientation
1. PB	GO:0033290	eukaryotic 48S preinitiation complex
1. PB	GO:0043966	histone H3 acetylation
1. PB	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
1. PB	GO:0016567	protein ubiquitination
1. PB	GO:0044666	MLL3/4 complex
1. PB	GO:0042998	positive regulation of Golgi to plasma membrane protein transport
1. PB	GO:0044877	protein-containing complex binding
1. PB	GO:0009991	response to extracellular stimulus
1. PB	GO:0055087	Ski complex
1. PB	GO:0010267	primary ta-siRNA processing
1. PB	GO:0000972	transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery
1. PB	GO:0051343	positive regulation of cyclic-nucleotide phosphodiesterase activity
1. PB	GO:0032781	positive regulation of ATP-dependent activity
1. PB	GO:0030838	positive regulation of actin filament polymerization
1. PB	GO:0034399	nuclear periphery
1. PB	GO:0097431	mitotic spindle pole
1. PB	GO:0032956	regulation of actin cytoskeleton organization
1. PB	GO:0016558	protein import into peroxisome matrix
1. PB	GO:0016226	iron-sulfur cluster assembly
1. PB	GO:0007165	signal transduction
1. PB	GO:0009867	jasmonic acid mediated signaling pathway
1. PB	GO:0045722	positive regulation of gluconeogenesis
1. PB	GO:0006413	translational initiation
1. PB	GO:0007059	chromosome segregation
1. PB	GO:0022618	ribonucleoprotein complex assembly
1. PB	GO:0000012	single strand break repair
1. PB	GO:0006283	transcription-coupled nucleotide-excision repair
1. PB	GO:0071540	eukaryotic translation initiation factor 3 complex, eIF3e
1. PB	GO:2001244	positive regulation of intrinsic apoptotic signaling pathway
1. PB	GO:0051301	cell division
1. PB	GO:0043981	histone H4-K5 acetylation
1. PB	GO:0032040	small-subunit processome
1. PB	GO:0005847	mRNA cleavage and polyadenylation specificity factor complex
1. PB	GO:0051315	attachment of mitotic spindle microtubules to kinetochore
1. PB	GO:0035859	Seh1-associated complex
1. PB	GO:0000387	spliceosomal snRNP assembly
1. PB	GO:0006405	RNA export from nucleus
1. PB	GO:0030277	maintenance of gastrointestinal epithelium
1. PB	GO:0060041	retina development in camera-type eye
1. PB	GO:0005782	peroxisomal matrix
1. PB	GO:0032880	regulation of protein localization
1. PB	GO:0001403	invasive growth in response to glucose limitation
1. PB	GO:0016282	eukaryotic 43S preinitiation complex
1. PB	GO:0003735	structural constituent of ribosome
1. PB	GO:0001650	fibrillar center
1. PB	GO:0033597	mitotic checkpoint complex
1. PB	GO:0001732	formation of cytoplasmic translation initiation complex
1. PB	GO:0061700	GATOR2 complex
1. PB	GO:2000114	regulation of establishment of cell polarity
1. PB	GO:0000109	nucleotide-excision repair complex
1. PB	GO:2001162	positive regulation of histone H3-K79 methylation
1. PB	GO:0097428	protein maturation by iron-sulfur cluster transfer
1. PB	GO:0005198	structural molecule activity
1. PB	GO:1905392	plant organ morphogenesis
1. PB	GO:0005886	plasma membrane
1. PB	GO:0045879	negative regulation of smoothened signaling pathway
1. PB	GO:0043982	histone H4-K8 acetylation
1. PB	GO:0031139	positive regulation of conjugation with cellular fusion
1. PB	GO:0031931	TORC1 complex
1. PB	GO:1904263	positive regulation of TORC1 signaling
1. PB	GO:0071013	catalytic step 2 spliceosome
1. PB	GO:0009845	seed germination
1. PB	GO:0000380	alternative mRNA splicing, via spliceosome
1. PB	GO:0002183	cytoplasmic translational initiation
1. PB	GO:0060236	regulation of mitotic spindle organization
1. PB	GO:0090594	inflammatory response to wounding
1. PB	GO:0048188	Set1C/COMPASS complex
1. PB	GO:0044297	cell body
1. PB	GO:0051571	positive regulation of histone H3-K4 methylation
1. PB	GO:0090181	regulation of cholesterol metabolic process
1. PB	GO:0006999	nuclear pore organization
1. PB	GO:0005671	obsolete Ada2/Gcn5/Ada3 transcription activator complex
1. PB	GO:0005730	nucleolus
1. PB	GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process
1. PB	GO:0006412	translation
1. PB	GO:0050765	negative regulation of phagocytosis
1. PB	GO:0035097	histone methyltransferase complex
1. PB	GO:0043984	histone H4-K16 acetylation
1. PB	GO:0043547	positive regulation of GTPase activity
1. PB	GO:0031080	nuclear pore outer ring
1. PB	GO:2000280	regulation of root development
1. PB	GO:0051020	GTPase binding
1. PB	GO:0051901	positive regulation of mitochondrial depolarization
1. PB	GO:0097361	CIA complex
1. PB	GO:0034501	protein localization to kinetochore
1. PB	GO:0009967	positive regulation of signal transduction
1. PB	GO:0046662	regulation of oviposition
1. PB	GO:0071541	eukaryotic translation initiation factor 3 complex, eIF3m
1. PB	GO:0008611	ether lipid biosynthetic process
1. PB	GO:0005053	peroxisome matrix targeting signal-2 binding
1. PB	GO:0043130	ubiquitin binding
1. PB	GO:0072357	PTW/PP1 phosphatase complex
1. PB	GO:0010154	fruit development
1. PB	GO:0048511	rhythmic process
1. PB	GO:0005078	MAP-kinase scaffold activity
1. PB	GO:0071215	cellular response to abscisic acid stimulus
1. PB	GO:0051568	histone H3-K4 methylation
1. PB	GO:0045638	negative regulation of myeloid cell differentiation
1. PB	GO:0033137	negative regulation of peptidyl-serine phosphorylation
1. PB	GO:0000209	protein polyubiquitination
1. PB	GO:0005834	heterotrimeric G-protein complex
1. PB	GO:1990630	IRE1-RACK1-PP2A complex
1. PB	GO:0030425	dendrite
1. PB	GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
1. PB	GO:0031507	heterochromatin assembly
1. PB	GO:1990447	U2 snRNP binding
1. PB	GO:0000375	RNA splicing, via transesterification reactions
1. PB	GO:0005634	nucleus
1. PB	GO:0000123	histone acetyltransferase complex
1. PB	GO:0048527	lateral root development
1. PB	GO:0031682	G-protein gamma-subunit binding
1. PB	GO:0080008	Cul4-RING E3 ubiquitin ligase complex
1. PB	GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling
1. PB	GO:0001891	phagocytic cup
1. PB	GO:0000445	THO complex part of transcription export complex
1. PB	GO:0043204	perikaryon
1. PB	GO:0035064	methylated histone binding
1. PB	GO:0045014	carbon catabolite repression of transcription by glucose
1. PB	GO:0005681	spliceosomal complex
1. PB	GO:0070912	Ddb1-Ckn1 complex
1. PB	GO:0031464	Cul4A-RING E3 ubiquitin ligase complex
1. PB	GO:0071363	cellular response to growth factor stimulus
1. PB	GO:0005765	lysosomal membrane
1. PB	GO:0042393	histone binding
1. PB	GO:0019899	enzyme binding
1. PB	GO:0030332	cyclin binding
1. PB	GO:0000347	THO complex
1. PB	GO:0048471	perinuclear region of cytoplasm
1. PB	GO:0046784	viral mRNA export from host cell nucleus
1. PB	GO:0030971	receptor tyrosine kinase binding
1. PB	GO:0003682	chromatin binding
1. PB	GO:0005852	eukaryotic translation initiation factor 3 complex
1. PB	GO:0016593	Cdc73/Paf1 complex
1. PB	GO:1903725	regulation of phospholipid metabolic process
1. PB	GO:0045598	regulation of fat cell differentiation
1. PB	GO:0030507	spectrin binding
1. PB	GO:0000398	mRNA splicing, via spliceosome
1. PB	GO:0030178	negative regulation of Wnt signaling pathway
1. PB	GO:0071339	MLL1 complex
1. PB	GO:0034719	SMN-Sm protein complex
1. PB	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
1. PB	GO:0097680	double-strand break repair via classical nonhomologous end joining
1. PB	GO:0043087	regulation of GTPase activity
1. PB	GO:0009411	response to UV
1. PB	GO:0032350	regulation of hormone metabolic process
1. PB	GO:0031334	positive regulation of protein-containing complex assembly
1. PB	GO:0080182	histone H3-K4 trimethylation
1. PB	GO:0045739	positive regulation of DNA repair
1. PB	GO:0008380	RNA splicing
1. PB	GO:0000781	chromosome, telomeric region
1. PB	GO:0010659	cardiac muscle cell apoptotic process
1. PB	GO:0051302	regulation of cell division
1. PB	GO:0031929	TOR signaling
1. PB	GO:0032008	positive regulation of TOR signaling
1. PB	GO:0034629
1. PB	GO:0030968	endoplasmic reticulum unfolded protein response
1. PB	GO:0010118	stomatal movement
1. PB	GO:0007186	G protein-coupled receptor signaling pathway
1. PB	GO:0005829	cytosol
1. PB	GO:0090207	regulation of triglyceride metabolic process
1. PB	GO:0032797	SMN complex
1. PB	GO:0051726	regulation of cell cycle
1. PB	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
1. PB	GO:0047391	alkylglycerophosphoethanolamine phosphodiesterase activity
1. PB	GO:0000974	Prp19 complex
1. PB	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
1. PB	GO:0071817	MMXD complex
1. PB	GO:0042169	SH2 domain binding
1. PB	GO:0071407	cellular response to organic cyclic compound
1. PB	GO:0090110	COPII-coated vesicle cargo loading
1. PB	GO:0000776	kinetochore
1. PB	GO:1903208	negative regulation of hydrogen peroxide-induced neuron death
1. PB	GO:0030292	protein tyrosine kinase inhibitor activity
1. PB	GO:0051572	negative regulation of histone H3-K4 methylation
1. PB	GO:0072344	rescue of stalled ribosome
1. PB	GO:0002188	translation reinitiation
1. PB	GO:0005635	nuclear envelope
1. PB	GO:0005654	nucleoplasm
1. PB	GO:0040013	negative regulation of locomotion
2. P	GO:0031152	aggregation involved in sorocarp development
2. P	GO:2001125	negative regulation of translational frameshifting
2. P	GO:0048364	root development
2. P	GO:2000728	regulation of mRNA export from nucleus in response to heat stress
2. P	GO:0016973	poly(A)+ mRNA export from nucleus
2. P	GO:0007094	mitotic spindle assembly checkpoint signaling
2. P	GO:1903561	extracellular vesicle
2. P	GO:0003380	establishment or maintenance of cytoskeleton polarity involved in gastrulation
2. P	GO:0030374	nuclear receptor coactivator activity
2. P	GO:0001958	endochondral ossification
2. P	GO:1990893	mitotic chromosome centromere condensation
2. P	GO:0010228	vegetative to reproductive phase transition of meristem
2. P	GO:0009524	phragmoplast
2. P	GO:0008327	methyl-CpG binding
2. P	GO:0032045	guanyl-nucleotide exchange factor complex
2. P	GO:0006884	cell volume homeostasis
2. P	GO:0032995	regulation of fungal-type cell wall biogenesis
2. P	GO:0032091	negative regulation of protein binding
2. P	GO:0071380	cellular response to prostaglandin E stimulus
2. P	GO:0043519	regulation of myosin II filament organization
2. P	GO:0051321	meiotic cell cycle
2. P	GO:0007191	adenylate cyclase-activating dopamine receptor signaling pathway
2. P	GO:0019903	protein phosphatase binding
2. P	GO:0003431	growth plate cartilage chondrocyte development
2. P	GO:0034729	histone H3-K79 methylation
2. P	GO:0034709	methylosome
2. P	GO:0005246	calcium channel regulator activity
2. P	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation
2. P	GO:0043022	ribosome binding
2. P	GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway
2. P	GO:0001750	photoreceptor outer segment
2. P	GO:0030308	negative regulation of cell growth
2. P	GO:0016835	carbon-oxygen lyase activity
2. P	GO:0061586	positive regulation of transcription by transcription factor localization
2. P	GO:1900102	negative regulation of endoplasmic reticulum unfolded protein response
2. P	GO:0071456	cellular response to hypoxia
2. P	GO:0042622	photoreceptor outer segment membrane
2. P	GO:0009792	embryo development ending in birth or egg hatching
2. P	GO:0010506	regulation of autophagy
2. P	GO:0060770	negative regulation of epithelial cell proliferation involved in prostate gland development
2. P	GO:0015031	protein transport
2. P	GO:0051664	nuclear pore localization
2. P	GO:0061343	cell adhesion involved in heart morphogenesis
2. P	GO:1903076	regulation of protein localization to plasma membrane
2. P	GO:0090114	COPII-coated vesicle budding
2. P	GO:0001917	photoreceptor inner segment
2. P	GO:0051169	nuclear transport
2. P	GO:0051983	regulation of chromosome segregation
2. P	GO:0050909	sensory perception of taste
2. P	GO:1990298	bub1-bub3 complex
2. P	GO:0030433	ubiquitin-dependent ERAD pathway
2. P	GO:0008608	attachment of spindle microtubules to kinetochore
2. P	GO:1903341	regulation of meiotic DNA double-strand break formation
2. P	GO:0032527	protein exit from endoplasmic reticulum
2. P	GO:0051865	protein autoubiquitination
2. P	GO:0048920	posterior lateral line neuromast primordium migration
2. P	GO:0010165	response to X-ray
2. P	GO:0005092	GDP-dissociation inhibitor activity
2. P	GO:0043539	protein serine/threonine kinase activator activity
2. P	GO:0000287	magnesium ion binding
2. P	GO:0017001	antibiotic catabolic process
2. P	GO:0048367	shoot system development
2. P	GO:0030496	midbody
2. P	GO:0016059	deactivation of rhodopsin mediated signaling
2. P	GO:0010629	negative regulation of gene expression
2. P	GO:0003723	RNA binding
2. P	GO:0048383	mesectoderm development
2. P	GO:0010619	adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway
2. P	GO:0005789	endoplasmic reticulum membrane
2. P	GO:0030335	positive regulation of cell migration
2. P	GO:1905301	regulation of macropinocytosis
2. P	GO:0000070	mitotic sister chromatid segregation
2. P	GO:0035077	ecdysone-mediated polytene chromosome puffing
2. P	GO:0140499	negative regulation of mitotic spindle assembly checkpoint signaling
2. P	GO:1903138	negative regulation of cell wall integrity MAPK cascade
2. P	GO:0030182	neuron differentiation
2. P	GO:0043473	pigmentation
2. P	GO:0010973	positive regulation of division septum assembly
2. P	GO:0030127	COPII vesicle coat
2. P	GO:0060027	convergent extension involved in gastrulation
2. P	GO:0009908	flower development
2. P	GO:0060528	secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
2. P	GO:1902624	positive regulation of neutrophil migration
2. P	GO:0045495	pole plasm
2. P	GO:0045793	positive regulation of cell size
2. P	GO:0006606	protein import into nucleus
2. P	GO:0016243	regulation of autophagosome size
2. P	GO:0016006	Nebenkern
2. P	GO:0010224	response to UV-B
2. P	GO:0034198	cellular response to amino acid starvation
2. P	GO:0010906	regulation of glucose metabolic process
2. P	GO:0010476	gibberellin mediated signaling pathway
2. P	GO:0008363	larval chitin-based cuticle development
2. P	GO:0007315	pole plasm assembly
2. P	GO:0043327	chemotaxis to cAMP
2. P	GO:1990942	mitotic metaphase chromosome recapture
2. P	GO:0071333	cellular response to glucose stimulus
3. B	GO:0021540	corpus callosum morphogenesis
3. B	GO:0006336	DNA replication-independent chromatin assembly
3. B	GO:1902510	regulation of apoptotic DNA fragmentation
3. B	GO:1990147	talin binding
3. B	GO:0090141	positive regulation of mitochondrial fission
3. B	GO:0019226	transmission of nerve impulse
3. B	GO:0030622	U4atac snRNA binding
3. B	GO:0000244	spliceosomal tri-snRNP complex assembly
3. B	GO:0000122	negative regulation of transcription by RNA polymerase II
3. B	GO:0005874	microtubule
3. B	GO:0006511	ubiquitin-dependent protein catabolic process
3. B	GO:1901800	positive regulation of proteasomal protein catabolic process
3. B	GO:0006325	chromatin organization
3. B	GO:1905861	intranuclear rod assembly
3. B	GO:0031965	nuclear membrane
3. B	GO:1903260	protein localization to mating projection tip
3. B	GO:0060307	regulation of ventricular cardiac muscle cell membrane repolarization
3. B	GO:1903673	mitotic cleavage furrow formation
3. B	GO:0007541	sex determination, primary response to X:A ratio
3. B	GO:1905786	positive regulation of anaphase-promoting complex-dependent catabolic process
3. B	GO:2000234	positive regulation of rRNA processing
3. B	GO:0008017	microtubule binding
3. B	GO:0009553	embryo sac development
3. B	GO:0008344	adult locomotory behavior
3. B	GO:0004842	ubiquitin-protein transferase activity
3. B	GO:0031313	extrinsic component of endosome membrane
3. B	GO:0120293	dynein axonemal particle
3. B	GO:0005615	extracellular space
3. B	GO:0032420	stereocilium
3. B	GO:0035264	multicellular organism growth
3. B	GO:0050885	neuromuscular process controlling balance
3. B	GO:0005869	dynactin complex
3. B	GO:0043224	nuclear SCF ubiquitin ligase complex
3. B	GO:0110136	protein-RNA complex remodeling
3. B	GO:0033140	negative regulation of peptidyl-serine phosphorylation of STAT protein
3. B	GO:0006337	nucleosome disassembly
3. B	GO:0005667	transcription regulator complex
3. B	GO:0016579	protein deubiquitination
3. B	GO:0007634	optokinetic behavior
3. B	GO:0017053	transcription repressor complex
3. B	GO:0043025	neuronal cell body
3. B	GO:0010997	anaphase-promoting complex binding
3. B	GO:0061883	clathrin-dependent endocytosis involved in vitellogenesis
3. B	GO:0070840	dynein complex binding
3. B	GO:0019985	translesion synthesis
3. B	GO:1905168	positive regulation of double-strand break repair via homologous recombination
3. B	GO:0039023	pronephric duct morphogenesis
3. B	GO:0005826	actomyosin contractile ring
3. B	GO:0072520	seminiferous tubule development
3. B	GO:0051649	establishment of localization in cell
3. B	GO:0040011	locomotion
3. B	GO:0033598	mammary gland epithelial cell proliferation
3. B	GO:0030836	positive regulation of actin filament depolymerization
3. B	GO:0051539	4 iron, 4 sulfur cluster binding
3. B	GO:0006367	transcription initiation from RNA polymerase II promoter
3. B	GO:0006886	intracellular protein transport
3. B	GO:0061003	positive regulation of dendritic spine morphogenesis
3. B	GO:0017145	stem cell division
3. B	GO:0006903	vesicle targeting
3. B	GO:0043521	regulation of myosin II filament disassembly
3. B	GO:0071906	CRD domain binding
3. B	GO:0000349	generation of catalytic spliceosome for first transesterification step
3. B	GO:0005819	spindle
3. B	GO:0001667	ameboidal-type cell migration
3. B	GO:0048814	regulation of dendrite morphogenesis
3. B	GO:0031037	myosin II filament disassembly
3. B	GO:0036170	filamentous growth of a population of unicellular organisms in response to starvation
3. B	GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
3. B	GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0009968	negative regulation of signal transduction
3. B	GO:0014909	smooth muscle cell migration
3. B	GO:1902184	negative regulation of shoot apical meristem development
3. B	GO:2000217	regulation of invasive growth in response to glucose limitation
3. B	GO:0036064	ciliary basal body
3. B	GO:1903335	regulation of vacuolar transport
3. B	GO:0000118	histone deacetylase complex
3. B	GO:0005930	axoneme
3. B	GO:0030515	snoRNA binding
3. B	GO:0099139	cheating during chimeric sorocarp development
3. B	GO:0034504	protein localization to nucleus
3. B	GO:0043297	apical junction assembly
3. B	GO:0051012	microtubule sliding
3. B	GO:0034388	Pwp2p-containing subcomplex of 90S preribosome
3. B	GO:1903013	response to differentiation-inducing factor 1
3. B	GO:0001764	neuron migration
3. B	GO:0030157	pancreatic juice secretion
3. B	GO:0016905	myosin heavy chain kinase activity
3. B	GO:0007312	oocyte nucleus migration involved in oocyte dorsal/ventral axis specification
3. B	GO:0005840	ribosome
3. B	GO:0098792	xenophagy
3. B	GO:0005525	GTP binding
3. B	GO:0010992	ubiquitin recycling
3. B	GO:1990266	neutrophil migration
3. B	GO:0007294	germarium-derived oocyte fate determination
3. B	GO:0030043	actin filament fragmentation
3. B	GO:0071007	U2-type catalytic step 2 spliceosome
3. B	GO:1903146	regulation of autophagy of mitochondrion
3. B	GO:0030834	regulation of actin filament depolymerization
3. B	GO:0015630	microtubule cytoskeleton
3. B	GO:0016575	histone deacetylation
3. B	GO:0008352	katanin complex
3. B	GO:0070121	Kupffer's vesicle development
3. B	GO:0051299	centrosome separation
3. B	GO:0035844	cloaca development
3. B	GO:1903033	positive regulation of microtubule plus-end binding
3. B	GO:0042304	regulation of fatty acid biosynthetic process
3. B	GO:0010697	negative regulation of mitotic spindle pole body separation
3. B	GO:0005662	DNA replication factor A complex
3. B	GO:0008013	beta-catenin binding
3. B	GO:1990907	beta-catenin-TCF complex
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0016055	Wnt signaling pathway
3. B	GO:0051081	nuclear membrane disassembly
3. B	GO:0031465	Cul4B-RING E3 ubiquitin ligase complex
3. B	GO:0000245	spliceosomal complex assembly
3. B	GO:0001738	morphogenesis of a polarized epithelium
3. B	GO:2000738	positive regulation of stem cell differentiation
3. B	GO:0090090	negative regulation of canonical Wnt signaling pathway
3. B	GO:0051510	regulation of unidimensional cell growth
3. B	GO:0048872	homeostasis of number of cells
3. B	GO:1990716	axonemal central apparatus
3. B	GO:0001675	acrosome assembly
3. B	GO:0097504	Gemini of coiled bodies
3. B	GO:0045013	carbon catabolite repression of transcription
3. B	GO:0003714	transcription corepressor activity
3. B	GO:1901386	negative regulation of voltage-gated calcium channel activity
3. B	GO:0030687	preribosome, large subunit precursor
3. B	GO:0030723	ovarian fusome organization
3. B	GO:0007298	border follicle cell migration
3. B	GO:0045741	positive regulation of epidermal growth factor-activated receptor activity
3. B	GO:0045542	positive regulation of cholesterol biosynthetic process
3. B	GO:0039008	pronephric nephron tubule morphogenesis
3. B	GO:0048713	regulation of oligodendrocyte differentiation
3. B	GO:0001826	inner cell mass cell differentiation
3. B	GO:0055082	cellular chemical homeostasis
3. B	GO:0140297	DNA-binding transcription factor binding
3. B	GO:0034396	negative regulation of transcription from RNA polymerase II promoter in response to iron
3. B	GO:0006891	intra-Golgi vesicle-mediated transport
3. B	GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:1902525	regulation of protein monoubiquitination
3. B	GO:0050795	regulation of behavior
3. B	GO:0007097	nuclear migration
3. B	GO:0033276	transcription factor TFTC complex
3. B	GO:0007019	microtubule depolymerization
3. B	GO:0005737	cytoplasm
3. B	GO:2001224	positive regulation of neuron migration
3. B	GO:0007281	germ cell development
3. B	GO:0005815	microtubule organizing center
3. B	GO:1904672	regulation of somatic stem cell population maintenance
3. B	GO:0070534	protein K63-linked ubiquitination
3. B	GO:0061630	ubiquitin protein ligase activity
3. B	GO:0051642	centrosome localization
3. B	GO:0009585	red, far-red light phototransduction
3. B	GO:0043005	neuron projection
3. B	GO:0031616	spindle pole centrosome
3. B	GO:0000417	HIR complex
3. B	GO:0031023	microtubule organizing center organization
3. B	GO:0009507	chloroplast
3. B	GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0000922	spindle pole
3. B	GO:0000421	autophagosome membrane
3. B	GO:0007219	Notch signaling pathway
3. B	GO:0005848	mRNA cleavage stimulating factor complex
3. B	GO:0032933	SREBP signaling pathway
3. B	GO:0007212	dopamine receptor signaling pathway
3. B	GO:2001205	negative regulation of osteoclast development
3. B	GO:0007064	mitotic sister chromatid cohesion
3. B	GO:0060590	ATPase regulator activity
3. B	GO:0045159	myosin II binding
3. B	GO:0007095	mitotic G2 DNA damage checkpoint signaling
3. B	GO:0005741	mitochondrial outer membrane
3. B	GO:0051219	phosphoprotein binding
3. B	GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling
3. B	GO:1902805	positive regulation of synaptic vesicle transport
3. B	GO:0048026	positive regulation of mRNA splicing, via spliceosome
3. B	GO:0051225	spindle assembly
3. B	GO:0032430	positive regulation of phospholipase A2 activity
3. B	GO:0002446	neutrophil mediated immunity
3. B	GO:0006378	mRNA polyadenylation
3. B	GO:0035973	aggrephagy
3. B	GO:0090660	cerebrospinal fluid circulation
3. B	GO:0045292	mRNA cis splicing, via spliceosome
3. B	GO:1903003	positive regulation of protein deubiquitination
3. B	GO:0043551	regulation of phosphatidylinositol 3-kinase activity
3. B	GO:0033365	protein localization to organelle
3. B	GO:0065001	specification of axis polarity
3. B	GO:0003700	DNA-binding transcription factor activity
3. B	GO:0045309	protein phosphorylated amino acid binding
3. B	GO:0010393	galacturonan metabolic process
3. B	GO:0000266	mitochondrial fission
3. B	GO:0007099	centriole replication
3. B	GO:0046329	negative regulation of JNK cascade
3. B	GO:0140026	contractile vacuole dissociation from plasma membrane
3. B	GO:0006895	Golgi to endosome transport
3. B	GO:0000045	autophagosome assembly
3. B	GO:0006909	phagocytosis
3. B	GO:0034613	cellular protein localization
3. B	GO:0090176	microtubule cytoskeleton organization involved in establishment of planar polarity
3. B	GO:0005828	kinetochore microtubule
3. B	GO:0016230	sphingomyelin phosphodiesterase activator activity
3. B	GO:0001961	positive regulation of cytokine-mediated signaling pathway
3. B	GO:0071599	otic vesicle development
3. B	GO:0040020	regulation of meiotic nuclear division
3. B	GO:0016021	integral component of membrane
3. B	GO:0031514	motile cilium
3. B	GO:0005875	microtubule associated complex
3. B	GO:0051276	chromosome organization
3. B	GO:0030513	positive regulation of BMP signaling pathway
3. B	GO:0005813	centrosome
3. B	GO:0035845	photoreceptor cell outer segment organization
3. B	GO:1904951	positive regulation of establishment of protein localization
3. B	GO:0070034	telomerase RNA binding
3. B	GO:0097525	spliceosomal snRNP complex
3. B	GO:0030621	U4 snRNA binding
3. B	GO:0070507	regulation of microtubule cytoskeleton organization
3. B	GO:0005697	telomerase holoenzyme complex
3. B	GO:0031124	mRNA 3'-end processing
3. B	GO:0012507	ER to Golgi transport vesicle membrane
3. B	GO:0002102	podosome
3. B	GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process
3. B	GO:0031648	protein destabilization
3. B	GO:0005938	cell cortex
3. B	GO:0030674	protein-macromolecule adaptor activity
3. B	GO:0034450	ubiquitin-ubiquitin ligase activity
3. B	GO:0045862	positive regulation of proteolysis
3. B	GO:1905191	positive regulation of metaphase/anaphase transition of meiosis II
3. B	GO:0031497	chromatin assembly
3. B	GO:0047496	vesicle transport along microtubule
3. B	GO:0033186	CAF-1 complex
3. B	GO:0051013	microtubule severing
3. B	GO:0005656	nuclear pre-replicative complex
3. B	GO:0046843	dorsal appendage formation
3. B	GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
3. B	GO:0046469	platelet activating factor metabolic process
3. B	GO:0006693	prostaglandin metabolic process
3. B	GO:0030426	growth cone
3. B	GO:0070986	left/right axis specification
3. B	GO:0005576	extracellular region
3. B	GO:0120095	vacuole-isolation membrane contact site
3. B	GO:0016319	mushroom body development
3. B	GO:1900045	negative regulation of protein K63-linked ubiquitination
3. B	GO:0007405	neuroblast proliferation
3. B	GO:1990757	ubiquitin ligase activator activity
3. B	GO:0030914
3. B	GO:1904668	positive regulation of ubiquitin protein ligase activity
3. B	GO:0008247	1-alkyl-2-acetylglycerophosphocholine esterase complex
3. B	GO:0005524	ATP binding
3. B	GO:0007303	cytoplasmic transport, nurse cell to oocyte
3. B	GO:1901838	positive regulation of transcription of nucleolar large rRNA by RNA polymerase I
3. B	GO:0034511	U3 snoRNA binding
3. B	GO:0030036	actin cytoskeleton organization
3. B	GO:0019005	SCF ubiquitin ligase complex
3. B	GO:0030041	actin filament polymerization
3. B	GO:1990889	H4K20me3 modified histone binding
3. B	GO:0046540	U4/U6 x U5 tri-snRNP complex
3. B	GO:0010072	primary shoot apical meristem specification
3. B	GO:0071005	U2-type precatalytic spliceosome
3. B	GO:0061739	protein lipidation involved in autophagosome assembly
3. B	GO:0008104	protein localization
3. B	GO:2001235	positive regulation of apoptotic signaling pathway
3. B	GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
3. B	GO:0000281	mitotic cytokinesis
3. B	GO:0031145	anaphase-promoting complex-dependent catabolic process
3. B	GO:0090129	positive regulation of synapse maturation
3. B	GO:0005545	1-phosphatidylinositol binding
3. B	GO:0039689	negative stranded viral RNA replication
3. B	GO:0034141	positive regulation of toll-like receptor 3 signaling pathway
3. B	GO:0030864	cortical actin cytoskeleton
3. B	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
3. B	GO:0075296	positive regulation of ascospore formation
3. B	GO:0042753	positive regulation of circadian rhythm
3. B	GO:0090344	negative regulation of cell aging
3. B	GO:0044665	MLL1/2 complex
3. B	GO:0098789	pre-mRNA cleavage required for polyadenylation
3. B	GO:0008298	intracellular mRNA localization
3. B	GO:0016005	phospholipase A2 activator activity
3. B	GO:0048711	positive regulation of astrocyte differentiation
3. B	GO:0051130	positive regulation of cellular component organization
3. B	GO:0030331	estrogen receptor binding
3. B	GO:0051383	kinetochore organization
3. B	GO:0048142	germarium-derived cystoblast division
3. B	GO:0019827	stem cell population maintenance
3. B	GO:0051661	maintenance of centrosome location
3. B	GO:0072686	mitotic spindle
3. B	GO:0045540	regulation of cholesterol biosynthetic process
3. B	GO:0042273	ribosomal large subunit biogenesis
3. B	GO:0072432	response to G1 DNA damage checkpoint signaling
3. B	GO:0032934	sterol binding
3. B	GO:0003720	telomerase activity
3. B	GO:0030473	nuclear migration along microtubule
3. B	GO:0042052	rhabdomere development
3. B	GO:0071011	precatalytic spliceosome
3. B	GO:0043143	regulation of translation by machinery localization
3. B	GO:0007010	cytoskeleton organization
3. B	GO:0051660	establishment of centrosome localization
3. B	GO:1903026	negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding
3. B	GO:0080135	regulation of cellular response to stress
3. B	GO:0000381	regulation of alternative mRNA splicing, via spliceosome
3. B	GO:0003677	DNA binding
3. B	GO:0051015	actin filament binding
3. B	GO:0090724	central region of growth cone
3. B	GO:0120197	mucociliary clearance
3. B	GO:0008270	zinc ion binding
3. B	GO:0097027	ubiquitin-protein transferase activator activity
3. B	GO:0006907	pinocytosis
3. B	GO:1900091	regulation of raffinose biosynthetic process
3. B	GO:0030042	actin filament depolymerization
3. B	GO:0005814	centriole
3. B	GO:0045943	positive regulation of transcription by RNA polymerase I
3. B	GO:0000235	astral microtubule
3. B	GO:0007079	mitotic chromosome movement towards spindle pole
3. B	GO:0034718	SMN-Gemin2 complex
3. B	GO:2000574	obsolete regulation of microtubule motor activity
3. B	GO:0090049	regulation of cell migration involved in sprouting angiogenesis
3. B	GO:0071532	ankyrin repeat binding
3. B	GO:0010826	negative regulation of centrosome duplication
3. B	GO:0046716	muscle cell cellular homeostasis
3. B	GO:0038026	reelin-mediated signaling pathway
3. B	GO:1903378	positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
3. B	GO:1904115	axon cytoplasm
3. B	GO:0021987	cerebral cortex development
3. B	GO:1903955	positive regulation of protein targeting to mitochondrion
3. B	GO:1900087	positive regulation of G1/S transition of mitotic cell cycle
3. B	GO:0006364	rRNA processing
3. B	GO:0005680	anaphase-promoting complex
3. B	GO:0040019	positive regulation of embryonic development
3. B	GO:0097344	Rix1 complex
3. B	GO:0016607	nuclear speck
3. B	GO:0045827	negative regulation of isoprenoid metabolic process
3. B	GO:0036180	filamentous growth of a population of unicellular organisms in response to biotic stimulus
3. B	GO:0030862	positive regulation of polarized epithelial cell differentiation
3. B	GO:0021819	layer formation in cerebral cortex
3. B	GO:0008090	retrograde axonal transport
3. B	GO:0005881	cytoplasmic microtubule
3. B	GO:0030174	regulation of DNA-dependent DNA replication initiation
3. B	GO:0030220	platelet formation
3. B	GO:0070545	PeBoW complex
3. B	GO:0048705	skeletal system morphogenesis
3. B	GO:0035014	phosphatidylinositol 3-kinase regulator activity
3. B	GO:0007399	nervous system development
3. B	GO:0003093	regulation of glomerular filtration
3. B	GO:1903861	positive regulation of dendrite extension
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:1900052	regulation of retinoic acid biosynthetic process
3. B	GO:0042247	establishment of planar polarity of follicular epithelium
3. B	GO:0031915	positive regulation of synaptic plasticity
3. B	GO:0006974	cellular response to DNA damage stimulus
3. B	GO:0031117	positive regulation of microtubule depolymerization
3. B	GO:0016559	peroxisome fission
3. B	GO:0045214	sarcomere organization
3. B	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
3. B	GO:0072593	reactive oxygen species metabolic process
3. B	GO:0005669	transcription factor TFIID complex
3. B	GO:0006513	protein monoubiquitination
3. B	GO:0001895	retina homeostasis
3. B	GO:0043622	cortical microtubule organization
3. B	GO:1905362	negative regulation of endosomal vesicle fusion
3. B	GO:0034145	positive regulation of toll-like receptor 4 signaling pathway
3. B	GO:0120151	positive regulation of mitotic actomyosin contractile ring disassembly
3. B	GO:0048854	brain morphogenesis
3. B	GO:0072499	photoreceptor cell axon guidance
3. B	GO:1903423	positive regulation of synaptic vesicle recycling
3. B	GO:0031252	cell leading edge
3. B	GO:0030030	cell projection organization
3. B	GO:0048813	dendrite morphogenesis
3. B	GO:1901998	toxin transport
3. B	GO:0031154	culmination involved in sorocarp development
3. B	GO:0034773	histone H4-K20 trimethylation
3. B	GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
3. B	GO:0071006	U2-type catalytic step 1 spliceosome
3. B	GO:2000582	obsolete positive regulation of microtubule motor activity, plus-end-directed
3. B	GO:0045199	maintenance of epithelial cell apical/basal polarity
3. B	GO:1902773	GTPase activator complex
3. B	GO:0140582	adenylate cyclase-activating G protein-coupled cAMP receptor signaling pathway
3. B	GO:0051010	microtubule plus-end binding
3. B	GO:0043021	ribonucleoprotein complex binding
3. B	GO:0021895	cerebral cortex neuron differentiation
3. B	GO:0034967	Set3 complex
3. B	GO:0030126	COPI vesicle coat
3. B	GO:0036035	osteoclast development
3. B	GO:0045022	early endosome to late endosome transport
3. B	GO:0000437	carbon catabolite repression of transcription from RNA polymerase II promoter
3. B	GO:0060117	auditory receptor cell development
3. B	GO:0051721	protein phosphatase 2A binding
3. B	GO:0050773	regulation of dendrite development
3. B	GO:0000466	maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0017070	U6 snRNA binding
3. B	GO:0048135	female germ-line cyst formation
3. B	GO:0030686	90S preribosome
3. B	GO:0061966	establishment of left/right asymmetry
3. B	GO:1990756	ubiquitin ligase-substrate adaptor activity
3. B	GO:0030286	dynein complex
3. B	GO:0036038	MKS complex
3. B	GO:1990939
3. B	GO:0071001	U4/U6 snRNP
3. B	GO:0080001	mucilage extrusion from seed coat
3. B	GO:0009723	response to ethylene
3. B	GO:0005871	kinesin complex
3. B	GO:0060271	cilium assembly
3. B	GO:0003711	transcription elongation regulator activity
3. B	GO:1990452	Parkin-FBXW7-Cul1 ubiquitin ligase complex
3. B	GO:0032991	protein-containing complex
3. B	GO:0043293	apoptosome
3. B	GO:0030381	chorion-containing eggshell pattern formation
3. B	GO:0003777	microtubule motor activity
3. B	GO:0046872	metal ion binding
3. B	GO:0050816	phosphothreonine residue binding
3. B	GO:0045842	positive regulation of mitotic metaphase/anaphase transition
3. B	GO:0090102	cochlea development
3. B	GO:0009640	photomorphogenesis
3. B	GO:0000139	Golgi membrane
3. B	GO:0042249	establishment of planar polarity of embryonic epithelium
3. B	GO:0010842	retina layer formation
3. B	GO:0120206	photoreceptor distal connecting cilium
3. B	GO:0090443	FAR/SIN/STRIPAK complex
3. B	GO:1904950	negative regulation of establishment of protein localization
3. B	GO:1901796	regulation of signal transduction by p53 class mediator
3. B	GO:1900088	regulation of inositol biosynthetic process
3. B	GO:0000433	carbon catabolite repression of transcription from RNA polymerase II promoter by glucose
3. B	GO:0046982	protein heterodimerization activity
3. B	GO:0070016	armadillo repeat domain binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q9D994	WD repeat-containing protein 38	0.00e+00	2.24e-06	1.77e-25
1. PB	P63247	Receptor of activated protein C kinase 1	0.00e+00	6.84e-11	3.60e-09
1. PB	Q6PA72	Target of rapamycin complex subunit lst8	0.00e+00	1.98e-03	0.002
1. PB	Q58E77	WD repeat-containing protein 82-B	2.22e-16	1.62e-03	0.002
1. PB	Q9D7H2	WD repeat-containing protein 5B	2.44e-15	3.29e-08	6.29e-28
1. PB	Q5R4T8	DDB1- and CUL4-associated factor 13	4.44e-16	1.10e-02	0.004
1. PB	P93398	Guanine nucleotide-binding protein subunit beta-2	0.00e+00	8.31e-04	9.24e-10
1. PB	G4MQX3	MST50-interacting protein 11	0.00e+00	3.48e-09	2.19e-12
1. PB	B0BNA7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	5.95e-04	5.81e-07
1. PB	A4RDD7	Eukaryotic translation initiation factor 3 subunit I	5.55e-16	3.03e-03	3.90e-04
1. PB	B4LJT7	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	1.26e-02	9.88e-05
1. PB	P23232	Guanine nucleotide-binding protein subunit beta	0.00e+00	7.71e-04	8.75e-12
1. PB	P54311	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	1.52e-05	1.20e-11
1. PB	Q5R5W8	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	5.83e-05	1.82e-11
1. PB	Q75C26	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	1.59e-02	8.64e-05
1. PB	Q5XIG8	Serine-threonine kinase receptor-associated protein	5.41e-14	5.58e-06	2.91e-05
1. PB	P36104	COMPASS component SWD2	2.07e-12	4.18e-02	2.09e-05
1. PB	Q38884	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.38e-03	5.27e-09
1. PB	Q5FVA9	mRNA export factor	1.68e-11	6.60e-06	1.14e-05
1. PB	O76071	Probable cytosolic iron-sulfur protein assembly protein CIAO1	0.00e+00	6.72e-03	3.44e-06
1. PB	Q25189	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.19e-13	1.77e-09
1. PB	Q9C4Z6	Receptor for activated C kinase 1B	0.00e+00	3.93e-13	5.91e-15
1. PB	A7RWD2	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	1.18e-03	6.76e-09
1. PB	P61964	WD repeat-containing protein 5	0.00e+00	2.54e-03	1.46e-26
1. PB	Q75AV4	Polyadenylation factor subunit 2	2.56e-12	2.44e-02	2.22e-12
1. PB	Q6PAC3	DDB1- and CUL4-associated factor 13	4.44e-16	2.13e-03	0.005
1. PB	P36408	Guanine nucleotide-binding protein subunit beta	0.00e+00	6.68e-06	1.83e-09
1. PB	Q8BFQ4	WD repeat-containing protein 82	0.00e+00	5.55e-03	0.001
1. PB	Q6L4F8	Guanine nucleotide-binding protein subunit beta-like protein B	0.00e+00	3.47e-12	1.42e-13
1. PB	P93563	Guanine nucleotide-binding protein subunit beta	0.00e+00	2.73e-03	2.32e-10
1. PB	Q5A7Q3	Pre-mRNA-splicing factor PRP46	0.00e+00	8.95e-04	3.75e-15
1. PB	B4GDM7	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	9.85e-04	1.84e-08
1. PB	Q1DPU4	Eukaryotic translation initiation factor 3 subunit I	5.55e-16	2.04e-03	2.61e-04
1. PB	Q54D08	Protein LST8 homolog	0.00e+00	2.32e-02	8.60e-13
1. PB	B7QKS1	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	1.32e-06	1.31e-07
1. PB	B4KTK4	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	1.35e-03	1.35e-04
1. PB	Q6TNS2	p21-activated protein kinase-interacting protein 1-like	8.51e-12	2.84e-04	8.04e-13
1. PB	E3LB80	Eukaryotic translation initiation factor 3 subunit I	1.84e-14	5.08e-05	1.16e-05
1. PB	Q6P0D9	Probable cytosolic iron-sulfur protein assembly protein ciao1	0.00e+00	1.52e-04	6.72e-06
1. PB	Q9VTV1	THO complex subunit 6	1.67e-12	1.14e-03	0.003
1. PB	Q9JHB4	WD repeat-containing protein 31	0.00e+00	1.64e-07	1.91e-05
1. PB	Q13216	DNA excision repair protein ERCC-8	5.77e-10	6.82e-07	2.08e-07
1. PB	Q9NYS7	WD repeat and SOCS box-containing protein 2	0.00e+00	5.03e-05	1.27e-08
1. PB	Q6TMK6	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	NA	6.53e-06	7.65e-12
1. PB	P0CS32	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.87e-02	1.54e-08
1. PB	P38123	COMPASS component SWD3	0.00e+00	1.02e-02	2.98e-12
1. PB	B4HRQ6	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	3.77e-04	3.11e-07
1. PB	Q54S59	WD repeat-containing protein 61 homolog	0.00e+00	1.54e-04	9.08e-07
1. PB	Q7KWL3	DDB1- and CUL4-associated factor 13	2.22e-16	2.11e-03	7.19e-08
1. PB	B4MY77	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	4.49e-04	2.57e-07
1. PB	Q75BY3	Pre-mRNA-splicing factor PRP46	0.00e+00	1.52e-02	2.85e-12
1. PB	Q9DAJ4	WD repeat domain-containing protein 83	0.00e+00	3.61e-06	7.11e-13
1. PB	Q7PS24	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	1.67e-04	5.13e-09
1. PB	Q13347	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	9.34e-04	1.17e-06
1. PB	A5DVY3	Eukaryotic translation initiation factor 3 subunit I	4.55e-15	5.14e-05	0.041
1. PB	Q86W42	THO complex subunit 6 homolog	0.00e+00	2.88e-03	5.40e-05
1. PB	Q4R7Y4	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	6.84e-11	3.60e-09
1. PB	Q9Y4P3	Transducin beta-like protein 2	5.94e-09	2.74e-02	1.23e-04
1. PB	Q96EE3	Nucleoporin SEH1	2.88e-11	5.33e-03	0.033
1. PB	Q5ZLK1	DDB1- and CUL4-associated factor 13	5.55e-16	1.45e-02	6.43e-04
1. PB	S8ASK6	WD40 repeat protein poxJ	NA	1.97e-04	1.04e-05
1. PB	O18640	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.78e-14	4.00e-10
1. PB	Q5E9A4	mRNA export factor	6.66e-16	7.81e-06	1.74e-05
1. PB	Q26544	WD repeat-containing protein SL1-17	NA	1.19e-03	1.07e-06
1. PB	A7TH19	Eukaryotic translation initiation factor 3 subunit I	1.78e-15	4.07e-04	2.04e-05
1. PB	P25387	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.61e-11	1.94e-12
1. PB	P79147	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	0.00e+00	5.06e-04	6.15e-19
1. PB	A8PWQ8	Probable cytosolic iron-sulfur protein assembly protein 1	1.78e-14	2.94e-03	0.020
1. PB	Q9BVC4	Target of rapamycin complex subunit LST8	0.00e+00	2.56e-02	2.42e-04
1. PB	Q8JZX3	POC1 centriolar protein homolog A	1.74e-14	6.14e-03	1.68e-15
1. PB	Q8NA23	WD repeat-containing protein 31	0.00e+00	3.97e-07	3.40e-04
1. PB	P62884	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	2.10e-13	6.38e-19
1. PB	Q9VLN1	WD repeat-containing protein 82	1.26e-13	8.65e-03	0.001
1. PB	Q40507	Guanine nucleotide-binding protein subunit beta	0.00e+00	8.76e-04	5.78e-10
1. PB	Q9HAD4	WD repeat-containing protein 41	0.00e+00	7.87e-04	0.045
1. PB	O64740	Protein transport protein SEC13 homolog B	3.22e-15	3.27e-04	0.042
1. PB	O24076	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.57e-10	6.72e-13
1. PB	Q8NBT0	POC1 centriolar protein homolog A	2.74e-12	6.39e-03	2.68e-16
1. PB	Q17QU5	Target of rapamycin complex subunit LST8	0.00e+00	1.77e-02	9.31e-05
1. PB	Q25306	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	2.85e-14	7.01e-18
1. PB	Q4R6D2	mRNA export factor	5.55e-16	8.21e-05	1.36e-05
1. PB	Q9W5Z5	WD repeat and SOCS box-containing protein 1	0.00e+00	1.06e-02	3.63e-06
1. PB	Q6UXN9	WD repeat-containing protein 82	0.00e+00	5.55e-03	0.001
1. PB	Q9R099	Transducin beta-like protein 2	5.72e-09	1.60e-03	2.90e-04
1. PB	Q6P5M2	WD repeat-containing protein 61	0.00e+00	2.51e-04	4.67e-15
1. PB	P17343	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	4.54e-04	3.30e-16
1. PB	Q9VU65	POC1 centriolar protein homolog	4.31e-12	3.89e-06	4.25e-16
1. PB	Q93134	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	2.42e-13	2.53e-09
1. PB	P61965	WD repeat-containing protein 5	0.00e+00	2.54e-03	1.46e-26
1. PB	Q6CI08	Eukaryotic translation initiation factor 3 subunit I	2.00e-15	3.26e-02	0.016
1. PB	Q6BSL7	Eukaryotic translation initiation factor 3 subunit I	4.55e-15	2.54e-04	1.55e-05
1. PB	Q08706	Guanine nucleotide-binding protein subunit beta	0.00e+00	1.70e-04	1.92e-13
1. PB	Q498M4	WD repeat-containing protein 5	0.00e+00	2.54e-03	1.46e-26
1. PB	Q17GR9	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	7.90e-03	1.58e-07
1. PB	A1D7I5	Eukaryotic translation initiation factor 3 subunit I	1.55e-15	1.37e-02	1.34e-04
1. PB	Q96J01	THO complex subunit 3	0.00e+00	1.14e-07	3.00e-05
1. PB	Q8C570	mRNA export factor	5.55e-16	5.26e-05	1.29e-05
1. PB	B5X212	Probable cytosolic iron-sulfur protein assembly protein ciao1-B	0.00e+00	3.13e-05	1.25e-04
1. PB	Q5M786	WD repeat-containing protein 5	0.00e+00	2.31e-03	4.54e-26
1. PB	P0CS33	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.87e-02	1.54e-08
1. PB	Q4P6E2	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	3.34e-04	1.54e-04
1. PB	P29829	Guanine nucleotide-binding protein subunit beta-2	0.00e+00	4.95e-06	1.94e-07
1. PB	Q54KL5	WD repeat-containing protein 5 homolog	0.00e+00	3.29e-03	5.10e-27
1. PB	B3RNR8	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	2.24e-05	2.98e-07
1. PB	P41838	Poly(A)+ RNA export protein	1.11e-16	2.33e-06	5.04e-05
1. PB	Q86TI4	WD repeat-containing protein 86	0	1.17e-158	0.0
1. PB	P63244	Receptor of activated protein C kinase 1	0.00e+00	6.84e-11	3.60e-09
1. PB	Q7T2F6	WD repeat and SOCS box-containing protein 1	0.00e+00	4.04e-03	1.08e-08
1. PB	Q0V8J1	WD repeat and SOCS box-containing protein 2	0.00e+00	6.32e-05	9.00e-09
1. PB	Q99KN2	Probable cytosolic iron-sulfur protein assembly protein CIAO1	0.00e+00	5.55e-03	4.12e-06
1. PB	P62872	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	1.52e-05	1.20e-11
1. PB	Q5RF99	mRNA export factor	5.55e-16	1.50e-05	1.80e-05
1. PB	Q9FKT5	THO complex subunit 3	0.00e+00	3.40e-06	3.94e-08
1. PB	Q5ZJH5	WD repeat-containing protein 61	0.00e+00	6.79e-03	4.51e-10
1. PB	P63246	Receptor of activated protein C kinase 1	0.00e+00	6.84e-11	3.60e-09
1. PB	Q9M2Z2	COMPASS-like H3K4 histone methylase component WDR5A	0.00e+00	1.52e-09	1.67e-24
1. PB	Q4FZW5	Nucleoporin SEH1-A	9.20e-11	1.69e-03	0.013
1. PB	Q9AYE4	Target of rapamycin complex subunit LST8	0.00e+00	1.18e-03	4.63e-18
1. PB	Q5U4Y8	Nucleoporin SEH1	6.22e-09	2.94e-03	0.020
1. PB	Q3UDP0	WD repeat-containing protein 41	0.00e+00	6.68e-06	3.89e-04
1. PB	Q759L2	Eukaryotic translation initiation factor 3 subunit I	1.78e-15	1.96e-06	0.001
1. PB	P63243	Receptor of activated protein C kinase 1	0.00e+00	6.84e-11	3.60e-09
1. PB	B4JW81	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	3.13e-04	3.70e-04
1. PB	Q5R7R2	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	5.28e-04	3.55e-06
1. PB	Q292E8	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	2.27e-03	1.86e-08
1. PB	P78406	mRNA export factor	6.66e-16	1.50e-05	1.80e-05
1. PB	Q28DW0	Probable cytosolic iron-sulfur protein assembly protein ciao1	0.00e+00	2.77e-04	1.70e-07
1. PB	P93340	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.30e-10	2.50e-13
1. PB	P20484	Protein MAK11	1.52e-12	2.17e-02	7.88e-05
1. PB	Q5ZMV7	WD repeat-containing protein 82	0.00e+00	8.58e-04	6.92e-04
1. PB	A5GFN6	mRNA export factor	5.55e-16	1.54e-05	2.10e-05
1. PB	Q5E959	Serine-threonine kinase receptor-associated protein	5.40e-14	6.07e-06	9.03e-05
1. PB	P63245	Receptor of activated protein C kinase 1	0.00e+00	6.84e-11	3.60e-09
1. PB	Q10282	Guanine nucleotide-binding protein subunit beta	0.00e+00	3.57e-04	1.13e-14
1. PB	Q5ZL33	Serine-threonine kinase receptor-associated protein	9.99e-12	8.29e-06	1.08e-05
1. PB	Q9DCJ1	Target of rapamycin complex subunit LST8	0.00e+00	7.36e-03	1.62e-04
1. PB	Q5E966	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.27e-03	1.94e-06
1. PB	P79959	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	5.32e-05	1.30e-11
1. PB	Q10281	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	4.19e-13	1.68e-16
1. PB	Q9Z2K5	Target of rapamycin complex subunit LST8	0.00e+00	1.51e-03	6.40e-04
1. PB	Q3KQ62	WD repeat domain-containing protein 83	1.55e-15	2.64e-09	5.23e-11
1. PB	P49177	Guanine nucleotide-binding protein subunit beta	0.00e+00	8.59e-06	7.99e-14
1. PB	A7YY75	Nucleoporin SEH1	3.34e-11	1.35e-03	0.033
1. PB	Q2UQ34	Eukaryotic translation initiation factor 3 subunit I	1.11e-15	2.30e-02	1.11e-04
1. PB	A0A1W5T363	WD40 repeat protein poxJ	NA	1.97e-04	1.04e-05
1. PB	Q5M7T1	Probable cytosolic iron-sulfur protein assembly protein CIAO1	0.00e+00	4.76e-03	2.93e-06
1. PB	Q5JTN6	WD repeat-containing protein 38	0.00e+00	5.52e-14	3.13e-36
1. PB	A5DGL8	Eukaryotic translation initiation factor 3 subunit I	1.11e-15	3.00e-03	5.11e-07
1. PB	Q9Z1Z2	Serine-threonine kinase receptor-associated protein	4.66e-14	8.19e-06	1.14e-05
1. PB	P62879	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	1.22e-04	7.30e-15
1. PB	Q6NV31	WD repeat-containing protein 82	0.00e+00	1.12e-03	0.001
1. PB	Q32PJ6	Probable cytosolic iron-sulfur protein assembly protein CIAO1	0.00e+00	4.21e-04	6.14e-07
1. PB	Q8R537	Peroxisomal targeting signal 2 receptor	0.00e+00	8.73e-03	1.36e-09
1. PB	Q3SWS8	mRNA export factor	6.66e-16	8.65e-07	1.62e-05
1. PB	Q5GIS3	Guanine nucleotide-binding protein subunit beta	0.00e+00	1.09e-04	6.89e-14
1. PB	Q6CP71	Polyadenylation factor subunit 2	3.73e-10	1.74e-03	2.59e-11
1. PB	Q61ZF6	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	4.54e-04	3.30e-16
1. PB	Q6GMD2	WD repeat-containing protein 61	0.00e+00	1.72e-04	2.50e-10
1. PB	Q7ZV55	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.65e-04	1.47e-08
1. PB	O94394	Uncharacterized WD repeat-containing protein C126.01c	5.44e-14	1.84e-04	2.35e-13
1. PB	B3NQR5	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	1.12e-03	8.33e-08
1. PB	P93339	Guanine nucleotide-binding protein subunit beta	NA	1.16e-04	1.19e-08
1. PB	Q9HAV0	Guanine nucleotide-binding protein subunit beta-4	0.00e+00	1.73e-05	2.85e-12
1. PB	B3MC74	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	2.69e-02	3.94e-09
1. PB	Q6GNF1	Nucleoporin SEH1-B	8.50e-11	2.00e-03	0.003
1. PB	Q54H44	WD repeat domain-containing protein 83 homolog	2.89e-15	2.96e-02	1.53e-08
1. PB	Q6DH44	WD repeat domain-containing protein 83	0.00e+00	5.54e-13	5.90e-16
1. PB	Q8R2U0	Nucleoporin SEH1	1.77e-11	4.17e-03	0.028
1. PB	Q54QU5	WD repeat-containing protein 89 homolog	0.00e+00	4.39e-04	0.001
1. PB	O42249	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	1.66e-12	1.95e-09
1. PB	Q7ZWF0	mRNA export factor	1.68e-11	6.30e-06	4.69e-06
1. PB	Q21215	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	3.30e-10	3.16e-11
1. PB	Q6CMA2	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	3.43e-03	3.17e-06
1. PB	P68040	Receptor of activated protein C kinase 1	0.00e+00	6.84e-11	3.60e-09
1. PB	P54313	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	1.22e-04	7.30e-15
1. PB	Q803V5	Target of rapamycin complex subunit lst8	0.00e+00	2.85e-03	1.82e-04
1. PB	P62873	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	1.52e-05	1.20e-11
1. PB	Q9FFA7	WD repeat-containing protein RUP2	1.11e-16	6.59e-03	0.046
1. PB	Q6FJZ9	Pre-mRNA-splicing factor PRP46	0.00e+00	2.05e-02	2.40e-21
1. PB	P83774	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	6.07e-12	2.85e-21
1. PB	P26308	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	1.03e-05	9.67e-13
1. PB	O94620	Pre-mRNA-splicing factor cwf17	7.65e-13	5.40e-04	2.14e-19
1. PB	Q8CFD5	DNA excision repair protein ERCC-8	8.31e-13	1.78e-06	9.69e-06
1. PB	Q1LV15	Dynein assembly factor with WDR repeat domains 1	0.00e+00	1.51e-02	7.84e-33
1. PB	Q4V7A0	WD repeat-containing protein 61	0.00e+00	1.87e-02	1.69e-07
1. PB	Q01369	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.71e-07	6.35e-13
1. PB	O24456	Receptor for activated C kinase 1A	0.00e+00	2.23e-12	5.80e-14
1. PB	Q8VE80	THO complex subunit 3	0.00e+00	3.08e-07	2.67e-05
1. PB	P46800	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	8.77e-11	1.45e-18
1. PB	O35353	Guanine nucleotide-binding protein subunit beta-4	0.00e+00	7.63e-06	1.05e-09
1. PB	Q5IH81	Eukaryotic translation initiation factor 3 subunit I	7.67e-14	1.22e-03	8.11e-08
1. PB	Q5EBE8	Eukaryotic translation initiation factor 3 subunit I	1.33e-15	2.15e-02	4.09e-07
1. PB	Q2TBP4	POC1 centriolar protein homolog A	2.87e-12	5.17e-03	2.14e-17
1. PB	Q5AI86	Eukaryotic translation initiation factor 3 subunit I	4.00e-15	7.59e-03	0.020
1. PB	Q61011	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	0.00e+00	1.84e-04	1.01e-17
1. PB	Q29RH4	THO complex subunit 3	0.00e+00	8.34e-07	2.97e-05
1. PB	P62883	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	2.10e-13	6.38e-19
1. PB	P93397	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	5.11e-04	2.36e-09
1. PB	Q6CKE8	Pre-mRNA-splicing factor PRP46	0.00e+00	5.38e-03	2.87e-14
1. PB	Q9NV06	DDB1- and CUL4-associated factor 13	4.44e-16	5.01e-03	0.003
1. PB	Q6PH57	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	8.39e-06	5.89e-16
1. PB	Q7K1Y4	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	7.22e-04	3.40e-07
1. PB	B5FZ19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.34e-02	1.95e-07
1. PB	Q5U4D9	THO complex subunit 6 homolog	0.00e+00	2.90e-04	1.27e-04
1. PB	Q12417	Pre-mRNA-splicing factor PRP46	4.55e-15	2.09e-02	6.09e-19
1. PB	Q5RAN6	Nucleoporin SEH1	1.19e-11	2.00e-03	0.032
1. PB	Q5RE95	WD repeat-containing protein 5B	0.00e+00	5.87e-08	2.52e-26
1. PB	Q39836	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.10e-08	3.78e-12
1. PB	Q9Y3F4	Serine-threonine kinase receptor-associated protein	2.01e-13	5.19e-06	3.33e-05
1. PB	O00628	Peroxisomal targeting signal 2 receptor	0.00e+00	3.80e-03	1.69e-09
1. PB	Q4V8C4	WD repeat-containing protein 5B	0.00e+00	2.32e-08	2.00e-28
1. PB	Q86VZ2	WD repeat-containing protein 5B	0.00e+00	1.08e-08	5.12e-27
1. PB	P97865	Peroxisomal targeting signal 2 receptor	0.00e+00	1.74e-03	2.08e-09
1. PB	P49026	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	3.45e-10	7.55e-14
1. PB	Q5BLX8	WD repeat domain-containing protein 83	0.00e+00	5.93e-06	4.94e-13
1. PB	P62871	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	1.52e-05	1.20e-11
1. PB	Q3Y8L7	Dynein assembly factor with WDR repeat domains 1	0.00e+00	5.93e-06	4.86e-37
1. PB	Q7ZYQ6	DDB1- and CUL4-associated factor 13	6.66e-16	9.05e-04	0.012
1. PB	Q6PBD6	WD repeat-containing protein 61	0.00e+00	4.12e-04	1.23e-10
1. PB	Q93ZG3	WD repeat-containing protein ATCSA-1	1.58e-09	3.02e-02	9.38e-06
1. PB	P62874	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	1.52e-05	1.20e-11
1. PB	Q9SY00	COMPASS-like H3K4 histone methylase component WDR5B	1.11e-16	9.96e-04	7.01e-27
1. PB	P69103	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	3.93e-13	9.09e-16
1. PB	P29387	Guanine nucleotide-binding protein subunit beta-4	0.00e+00	4.49e-06	1.60e-09
1. PB	P49027	Guanine nucleotide-binding protein subunit beta-like protein A	0.00e+00	7.74e-10	1.08e-11
1. PB	Q5BIM8	DNA excision repair protein ERCC-8	1.59e-12	1.97e-05	1.07e-04
1. PB	Q8SRB0	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.13e-04	5.73e-08
1. PB	O54929	WD repeat and SOCS box-containing protein 2	0.00e+00	9.19e-05	6.78e-09
1. PB	Q9QZD9	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	7.07e-04	1.14e-06
1. PB	B4QFZ8	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	2.44e-03	2.11e-07
1. PB	Q55AR8	U5 small nuclear ribonucleoprotein 40 kDa protein	3.58e-13	2.08e-03	6.65e-12
1. PB	P52287	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	0.00e+00	2.06e-04	1.58e-17
1. PB	P16520	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	0.00e+00	8.88e-05	7.36e-18
1. PB	Q55DA2	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	1.54e-02	3.17e-06
1. PB	Q9C1X0	Uncharacterized WD repeat-containing protein C713.05	0.00e+00	3.27e-04	1.09e-08
1. PB	O42248	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	2.26e-12	2.55e-09
1. PB	O80990	Protein CIA1	0.00e+00	2.96e-02	1.77e-12
1. PB	P11017	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	1.22e-04	7.30e-15
1. PB	G0SEA3	mRNA export factor GLE2	4.92e-12	6.20e-03	0.002
1. PB	Q38942	Protein RAE1	0.00e+00	1.93e-08	0.002
1. PB	Q09150	Meiotic recombination protein rec14	0.00e+00	5.28e-04	4.63e-07
1. PB	A1DP19	Nuclear distribution protein nudF	0.00e+00	1.17e-03	7.22e-18
1. PB	Q5I0B4	Target of rapamycin complex subunit lst8	0.00e+00	3.50e-03	0.002
1. PB	B4P7Q3	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	5.57e-05	1.75e-07
1. PB	Q9USR0	DNA excision repair protein ckn1	3.89e-12	4.21e-04	0.032
1. PB	Q8W1K8	Protein Mut11	8.22e-15	1.29e-08	1.34e-19
1. PB	Q640J6	WD repeat-containing protein 82-A	0.00e+00	5.28e-04	0.002
1. PB	Q5XGI5	WD repeat domain-containing protein 83	0.00e+00	4.21e-10	3.35e-16
1. PB	P38011	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	6.17e-10	8.64e-14
1. PB	B5X9P2	Probable cytosolic iron-sulfur protein assembly protein ciao1-A	0.00e+00	1.08e-04	1.79e-04
1. PB	Q2KIG2	WD repeat-containing protein 5	0.00e+00	4.08e-03	1.40e-26
1. PB	O54927	WD repeat and SOCS box-containing protein 1	0.00e+00	1.12e-02	1.83e-07
1. PB	Q39336	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	4.35e-12	6.62e-14
1. PB	Q6FL15	Eukaryotic translation initiation factor 3 subunit I	8.88e-16	1.76e-04	0.001
1. PB	Q9W2E7	Protein Rae1	4.44e-16	1.59e-04	0.006
1. PB	Q6NVS5	DDB1- and CUL4-associated factor 13	5.55e-16	2.59e-03	0.007
1. PB	Q9W328	Protein LST8 homolog	0.00e+00	4.22e-02	0.009
1. PB	P69104	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	3.93e-13	9.09e-16
1. PB	Q9LV28	Receptor for activated C kinase 1C	0.00e+00	1.01e-10	3.40e-14
1. PB	P62880	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	1.22e-04	7.30e-15
1. PB	Q6AY87	THO complex subunit 6 homolog	0.00e+00	4.49e-04	3.94e-04
1. PB	O43017	Set1 complex component swd3	0.00e+00	7.62e-04	3.34e-16
1. PB	O45040	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	6.61e-05	2.62e-15
1. PB	Q9BRX9	WD repeat domain-containing protein 83	0.00e+00	7.26e-07	1.90e-15
1. PB	Q8L4M1	THO complex subunit 6	0.00e+00	4.66e-03	6.99e-06
1. PB	A3LX18	Eukaryotic translation initiation factor 3 subunit I	3.89e-15	7.79e-04	6.67e-04
2. P	Q9XW12	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	7.00e-05	NA
2. P	Q75BS2	Protein transport protein SEC13	1.11e-15	1.65e-02	NA
2. P	Q9WVA3	Mitotic checkpoint protein BUB3	0.00e+00	1.54e-07	NA
2. P	A8QBF3	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	3.48e-02	NA
2. P	Q9H6Y2	WD repeat-containing protein 55	3.85e-11	1.27e-04	NA
2. P	Q5RB58	Mitotic checkpoint protein BUB3	0.00e+00	2.48e-07	NA
2. P	A5DHD9	Protein transport protein SEC13	1.89e-15	3.65e-03	NA
2. P	Q9BQA1	Methylosome protein 50	0.00e+00	1.64e-03	NA
2. P	Q502M6	Ankyrin repeat domain-containing protein 29	9.61e-01	1.94e-05	NA
2. P	P0CS51	Protein transport protein SEC13	1.42e-14	1.34e-02	NA
2. P	Q9D1M0	Protein SEC13 homolog	1.67e-15	2.21e-05	NA
2. P	P26449	Cell cycle arrest protein BUB3	4.88e-15	1.44e-03	NA
2. P	Q9H977	WD repeat-containing protein 54	2.73e-12	4.43e-02	NA
2. P	Q5VU92	DDB1- and CUL4-associated factor 12-like protein 1	6.92e-12	7.36e-03	NA
2. P	Q9LJN8	Mitotic checkpoint protein BUB3.1	0.00e+00	8.55e-07	NA
2. P	A8XJ40	Protein SEC13 homolog	6.28e-11	8.90e-06	NA
2. P	O22467	Histone-binding protein MSI1	4.56e-11	7.66e-03	NA
2. P	O94319	Protein transport protein sec13	1.22e-15	1.35e-04	NA
2. P	Q8N6D5	Ankyrin repeat domain-containing protein 29	9.51e-01	2.97e-06	NA
2. P	Q1DZQ0	Protein transport protein SEC13	3.00e-15	3.29e-03	NA
2. P	Q6FNV4	Protein transport protein SEC13-1	2.78e-15	4.30e-02	NA
2. P	Q0UNA9	Protein transport protein SEC13	4.66e-15	4.64e-02	NA
2. P	P0CS50	Protein transport protein SEC13	1.67e-14	1.34e-02	NA
2. P	Q5FVP5	WD repeat-containing protein 89	1.46e-11	1.12e-03	NA
2. P	Q54DS8	Protein SEC13 homolog	4.44e-16	7.22e-04	NA
2. P	Q9LYK6	Protein ANTHESIS POMOTING FACTOR 1	5.25e-12	7.46e-04	NA
2. P	Q12021	Radiation-sensitive protein 28	5.00e-08	2.49e-03	NA
2. P	Q6BZX5	Protein transport protein SEC13	3.11e-15	6.70e-04	NA
2. P	Q9V3J4	Protein SEC13 homolog	9.66e-11	4.08e-03	NA
2. P	Q9SRI1	Protein transport protein SEC13 homolog A	1.89e-15	6.92e-05	NA
2. P	Q91VI7	Ribonuclease inhibitor	9.96e-01	4.82e-02	NA
2. P	O42860	Mitotic checkpoint protein bub3	0.00e+00	4.84e-04	NA
2. P	Q9KZX7	Virginiamycin B lyase	8.87e-14	4.64e-02	NA
2. P	Q9USL1	Uncharacterized WD repeat-containing protein C18B5.10c	0.00e+00	1.95e-04	NA
2. P	A5DXE2	Protein transport protein SEC13	3.22e-15	2.37e-02	NA
2. P	Q6GL39	WD repeat-containing protein 82	1.11e-16	2.06e-04	NA
2. P	Q5XFW8	Protein SEC13 homolog	3.94e-11	1.48e-05	NA
2. P	O43684	Mitotic checkpoint protein BUB3	0.00e+00	5.22e-08	NA
2. P	Q6P6B7	Ankyrin repeat domain-containing protein 16	9.52e-01	6.59e-03	NA
2. P	Q3ZCC9	Protein SEC13 homolog	3.74e-10	3.11e-07	NA
2. P	Q9D0R9	WD repeat-containing protein 89	6.81e-11	1.44e-03	NA
2. P	Q4WNK7	Protein transport protein sec13	2.11e-15	4.51e-02	NA
2. P	P53024	Protein transport protein SEC13	5.55e-16	6.63e-04	NA
2. P	Q6CSZ5	Protein transport protein SEC13	1.67e-15	5.45e-06	NA
2. P	Q9BYB4	Guanine nucleotide-binding protein subunit beta-like protein 1	5.55e-16	1.11e-02	NA
2. P	Q7K2X8	Nucleoporin seh1	2.90e-09	6.52e-03	NA
2. P	Q4PCB8	Protein transport protein SEC13	8.85e-14	4.76e-03	NA
2. P	Q54BI5	WD repeat-containing protein 53 homolog	0.00e+00	1.41e-02	NA
2. P	Q93454	mRNA export factor rae-1	1.39e-11	3.85e-04	NA
2. P	P40066	mRNA export factor GLE2	1.11e-16	2.44e-02	NA
2. P	Q5E9I7	Methylosome protein 50	6.31e-13	5.72e-03	NA
2. P	Q965S8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.41e-02	NA
2. P	Q58DT8	WD repeat-containing protein 55	3.91e-11	1.85e-02	NA
2. P	Q4QR85	Methylosome protein 50	0.00e+00	3.54e-03	NA
2. P	P55735	Protein SEC13 homolog	6.64e-11	5.58e-06	NA
2. P	Q0CHM0	Protein transport protein sec13	2.00e-15	1.11e-03	NA
2. P	Q1JQB2	Mitotic checkpoint protein BUB3	0.00e+00	1.54e-07	NA
2. P	O42858	Set1 complex component swd1	3.81e-10	4.10e-02	NA
2. P	Q9C701	Mitotic checkpoint protein BUB3.2	0.00e+00	2.12e-07	NA
2. P	A9VQJ9	Virginiamycin B lyase	5.76e-10	6.85e-04	NA
2. P	Q54DM1	Mitotic checkpoint protein bub3	0.00e+00	5.70e-05	NA
2. P	Q5RBZ3	WD repeat-containing protein 89	1.40e-11	2.22e-03	NA
2. P	A3LNW3	Protein transport protein SEC13	3.55e-15	1.10e-03	NA
2. P	A2QHM1	Protein transport protein sec13	1.89e-15	2.51e-02	NA
2. P	Q96FK6	WD repeat-containing protein 89	1.67e-11	7.30e-04	NA
2. P	Q9YGY3	Mitotic checkpoint protein BUB3	0.00e+00	9.10e-07	NA
2. P	Q5RBZ2	Methylosome protein 50	0.00e+00	1.61e-04	NA
2. P	Q10099	Nucleoporin seh1	5.77e-15	1.09e-04	NA
2. P	A8WVD2	Nucleoporin SEH1	8.88e-15	3.16e-02	NA
2. P	Q9N4A7	Protein SEC13 homolog	5.02e-11	2.90e-06	NA
2. P	Q5F3R7	DDB1- and CUL4-associated factor 12	7.82e-10	5.01e-03	NA
2. P	Q6BIR1	Protein transport protein SEC13	3.89e-15	1.23e-04	NA
2. P	Q5UQ06	Putative ankyrin repeat protein R789	NA	2.69e-02	NA
2. P	Q6NUD0	Methylosome protein 50	1.77e-12	1.07e-02	NA
2. P	Q5B563	Protein transport protein sec13	1.89e-15	2.13e-02	NA
2. P	Q5R9T6	WD repeat-containing protein 55	3.44e-11	1.43e-04	NA
2. P	Q5AEF2	Protein transport protein SEC13	4.22e-15	1.05e-02	NA
2. P	Q6CKX3	Eukaryotic translation initiation factor 3 subunit I	1.89e-15	4.64e-05	NA
2. P	Q99J09	Methylosome protein 50	0.00e+00	3.69e-03	NA
2. P	A1L112	WD repeat-containing protein 55	1.95e-11	1.73e-03	NA
2. P	P17978	Virginiamycin B lyase	8.52e-14	1.23e-02	NA
3. B	Q09406	Autophagic-related protein 16.2	1.60e-14	NA	2.27e-06
3. B	B4KGX9	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.44e-05
3. B	Q8YRI1	Uncharacterized WD repeat-containing protein alr3466	3.33e-16	NA	2.08e-47
3. B	Q5R664	Coatomer subunit beta'	8.47e-08	NA	1.66e-17
3. B	B4JWA1	Lissencephaly-1 homolog	0.00e+00	NA	1.41e-23
3. B	Q29HG9	Protein LST8 homolog	0.00e+00	NA	0.003
3. B	A2R3Z3	Mitochondrial division protein 1	2.90e-14	NA	1.14e-15
3. B	Q05048	Cleavage stimulation factor subunit 1	5.00e-15	NA	5.11e-05
3. B	A1L271	Guanine nucleotide-binding protein subunit beta-5a	0.00e+00	NA	1.78e-13
3. B	O43172	U4/U6 small nuclear ribonucleoprotein Prp4	1.11e-16	NA	6.18e-17
3. B	P87177	Uncharacterized WD repeat-containing protein C3D6.12	1.64e-09	NA	2.66e-12
3. B	A8XL02	Ribosome biogenesis protein WDR12 homolog	9.84e-10	NA	1.36e-05
3. B	P53197	APC/C activator protein CDH1	7.55e-15	NA	6.02e-04
3. B	B3NPW0	Lissencephaly-1 homolog	0.00e+00	NA	3.66e-23
3. B	Q17I16	WD repeat-containing protein on Y chromosome	2.98e-06	NA	0.004
3. B	F4JHT3	BEACH domain-containing protein A2	NA	NA	0.003
3. B	Q1DIW7	Mitochondrial division protein 1	1.18e-13	NA	4.89e-16
3. B	Q9ULI1	NACHT and WD repeat domain-containing protein 2	1.47e-05	NA	0.005
3. B	Q15061	WD repeat-containing protein 43	3.91e-06	NA	3.30e-05
3. B	Q7RXH4	Eukaryotic translation initiation factor 3 subunit I	8.88e-16	NA	5.30e-04
3. B	P35606	Coatomer subunit beta'	8.48e-08	NA	1.50e-17
3. B	P62881	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	NA	6.08e-13
3. B	A1D3F5	Ribosome biogenesis protein erb1	1.17e-10	NA	0.005
3. B	Q92636	Protein FAN	4.00e-12	NA	1.43e-12
3. B	Q12788	Transducin beta-like protein 3	7.97e-10	NA	2.18e-14
3. B	C5FP68	Probable E3 ubiquitin ligase complex SCF subunit sconB	2.32e-09	NA	9.66e-27
3. B	Q8IZQ1	WD repeat and FYVE domain-containing protein 3	NA	NA	0.003
3. B	B8PD53	Nuclear distribution protein PAC1-2	NA	NA	5.22e-26
3. B	Q8MYE8	Probable proteasomal ATPase-associated factor 1	4.00e-14	NA	4.05e-08
3. B	Q32LN7	WD repeat-containing protein 61	0.00e+00	NA	7.86e-08
3. B	P41318	Target of rapamycin complex subunit LST8	0.00e+00	NA	5.81e-10
3. B	Q149M9	NACHT domain- and WD repeat-containing protein 1	1.08e-05	NA	2.53e-06
3. B	Q6NZH4	Lissencephaly-1 homolog	0.00e+00	NA	1.35e-28
3. B	C7Z6H2	Nuclear distribution protein PAC1	0.00e+00	NA	7.20e-18
3. B	Q8SQS4	Transcription initiation factor TFIID subunit 5	7.77e-16	NA	6.99e-11
3. B	B0LSW3	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	NA	6.70e-28
3. B	P49846	Transcription initiation factor TFIID subunit 5	1.35e-13	NA	8.12e-20
3. B	Q22071	F-box/WD repeat-containing protein mec-15	1.11e-16	NA	1.32e-04
3. B	Q5FW06	DDB1- and CUL4-associated factor 10	2.49e-13	NA	0.007
3. B	Q9R1K5	Fizzy-related protein homolog	1.93e-11	NA	2.52e-06
3. B	A2QP30	Nuclear distribution protein nudF	5.00e-15	NA	9.04e-18
3. B	Q8YV57	Uncharacterized WD repeat-containing protein all2124	4.64e-08	NA	3.01e-33
3. B	Q4I7X1	Polyadenylation factor subunit 2	7.19e-09	NA	1.48e-11
3. B	Q8HXX0	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	3.27e-28
3. B	Q9P775	Uncharacterized WD repeat-containing protein C17D11.16	1.17e-09	NA	4.01e-04
3. B	Q80T85	DDB1- and CUL4-associated factor 5	1.19e-04	NA	0.027
3. B	Q499N3	WD repeat-containing protein 18	3.65e-11	NA	8.79e-06
3. B	A3LNI7	Nuclear distribution protein PAC1	6.66e-16	NA	7.29e-10
3. B	O43071	Pre-mRNA-processing factor 17	2.83e-11	NA	5.27e-06
3. B	Q0VC24	Ribosome biogenesis protein WDR12	3.08e-12	NA	1.56e-08
3. B	Q05583	Cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	4.25e-05
3. B	Q6ZS30	Neurobeachin-like protein 1	2.25e-02	NA	1.09e-04
3. B	O74453	Shk1 kinase-binding protein 15	9.52e-13	NA	0.026
3. B	P16371	Protein groucho	1.73e-12	NA	7.98e-04
3. B	E7FEV0	WD repeat-containing protein 81	2.16e-05	NA	0.026
3. B	Q9D0I6	WD repeat, SAM and U-box domain-containing protein 1	2.22e-16	NA	1.02e-04
3. B	A6ZMA9	Ribosome biogenesis protein ERB1	1.25e-06	NA	0.038
3. B	Q0U1B1	Nuclear distribution protein PAC1	0.00e+00	NA	2.40e-20
3. B	Q4WVS4	Mitochondrial division protein 1	4.70e-14	NA	8.66e-16
3. B	Q5QP82	DDB1- and CUL4-associated factor 10	4.36e-12	NA	0.010
3. B	Q54MZ3	Anaphase-promoting complex subunit cdc20	1.86e-09	NA	1.84e-04
3. B	Q90ZL4	Lissencephaly-1 homolog	0.00e+00	NA	7.86e-29
3. B	A6ZPA6	Nuclear distribution protein PAC1	5.14e-12	NA	6.44e-10
3. B	A8QB65	Ribosome biogenesis protein WDR12 homolog	6.94e-12	NA	6.71e-09
3. B	Q9C270	Periodic tryptophan protein 2 homolog	5.48e-09	NA	7.58e-16
3. B	Q94AD8	F-box/WD-40 repeat-containing protein At5g21040	3.15e-11	NA	1.95e-08
3. B	Q54N86	F-box/WD repeat-containing protein A-like protein	6.83e-09	NA	1.49e-05
3. B	Q5R1S9	Chromatin assembly factor 1 subunit B	1.55e-09	NA	6.57e-04
3. B	O17468	Protein HIRA homolog	6.93e-07	NA	3.68e-04
3. B	P61480	Ribosome biogenesis protein WDR12	3.20e-12	NA	6.94e-12
3. B	Q6P1W0	Denticleless protein homolog	1.60e-08	NA	3.30e-05
3. B	O75037	Kinesin-like protein KIF21B	2.06e-05	NA	8.62e-16
3. B	Q99973	Telomerase protein component 1	2.38e-04	NA	4.76e-13
3. B	Q54LT8	Serine-threonine kinase receptor-associated protein	1.11e-16	NA	5.00e-09
3. B	Q94A40	Coatomer subunit alpha-1	1.44e-06	NA	1.75e-11
3. B	O13286	WD repeat-containing protein srw1	6.66e-15	NA	3.86e-04
3. B	Q6C553	Protein HIR1	9.27e-05	NA	0.031
3. B	B0Y7H6	Probable catabolite repression protein creC	5.48e-08	NA	0.001
3. B	Q0J3D9	Coatomer subunit alpha-3	1.63e-06	NA	4.01e-12
3. B	Q8TAF3	WD repeat-containing protein 48	2.29e-11	NA	3.60e-19
3. B	O93277	WD repeat-containing protein 1	1.88e-13	NA	1.66e-04
3. B	Q9D565	WD repeat-containing protein 64	1.36e-05	NA	1.10e-04
3. B	F4HZB2	Protein SPIRRIG	NA	NA	0.005
3. B	Q9M3B4	Protein ROOT INITIATION DEFECTIVE 3	5.63e-09	NA	2.40e-10
3. B	Q7Z4S6	Kinesin-like protein KIF21A	3.26e-05	NA	1.05e-12
3. B	Q5ZKU8	p21-activated protein kinase-interacting protein 1-like	8.24e-14	NA	6.03e-08
3. B	Q6NLV4	Flowering time control protein FY	4.42e-08	NA	1.26e-14
3. B	Q2TBS9	WD40 repeat-containing protein SMU1	2.44e-15	NA	7.44e-20
3. B	A7ETB3	Mitochondrial division protein 1	7.45e-13	NA	4.06e-17
3. B	Q55FJ2	WD repeat-containing protein 91 homolog	3.76e-08	NA	4.75e-04
3. B	Q0D6V7	Ribosome biogenesis protein BOP1 homolog	4.32e-10	NA	0.005
3. B	Q01277	Probable E3 ubiquitin ligase complex SCF subunit scon-2	2.89e-09	NA	7.74e-21
3. B	Q9VU68	Actin-interacting protein 1	4.42e-13	NA	0.002
3. B	Q86A97	EARP-interacting protein homolog	7.15e-11	NA	4.14e-05
3. B	O88879	Apoptotic protease-activating factor 1	3.36e-08	NA	3.89e-15
3. B	C6L7U1	Putative E3 ubiquitin-protein ligase LIN-1	5.94e-06	NA	0.023
3. B	Q28I85	POC1 centriolar protein homolog A	2.10e-13	NA	4.87e-17
3. B	Q29KQ0	Ribosome biogenesis protein WDR12 homolog	2.42e-12	NA	1.72e-09
3. B	P25382	Ribosome assembly protein 4	0.00e+00	NA	1.50e-22
3. B	Q5I0B9	Autophagy-related protein 16	3.72e-14	NA	3.42e-07
3. B	Q921C3	Bromodomain and WD repeat-containing protein 1	2.28e-05	NA	7.21e-13
3. B	F1MNN4	F-box/WD repeat-containing protein 7	0.00e+00	NA	1.49e-40
3. B	Q7RY68	Polyadenylation factor subunit 2	1.43e-08	NA	1.36e-13
3. B	A0DB19	Lissencephaly-1 homolog 1	0.00e+00	NA	3.06e-23
3. B	Q54Y96	WD40 repeat-containing protein smu1	1.89e-15	NA	1.97e-14
3. B	O42478	Transducin-like enhancer protein 4	4.42e-09	NA	3.68e-06
3. B	Q6NNP0	Autophagy-related protein 16	2.01e-12	NA	6.39e-12
3. B	Q9GZL7	Ribosome biogenesis protein WDR12	3.90e-12	NA	9.22e-09
3. B	D4DG66	Nuclear distribution protein PAC1	0.00e+00	NA	3.61e-13
3. B	O60336	Mitogen-activated protein kinase-binding protein 1	2.45e-05	NA	0.024
3. B	P56094	General transcriptional corepressor TUP1	9.35e-09	NA	8.47e-18
3. B	A2CEH0	POC1 centriolar protein homolog B	1.15e-12	NA	1.40e-16
3. B	Q58D00	F-box/WD repeat-containing protein 2	7.30e-11	NA	6.07e-14
3. B	Q9Y0T2	F-box/WD repeat-containing protein A	1.66e-07	NA	3.86e-13
3. B	Q8VBV4	F-box/WD repeat-containing protein 7	0.00e+00	NA	1.18e-40
3. B	P53622	Coatomer subunit alpha	3.97e-08	NA	3.40e-12
3. B	Q5A7Q6	Nuclear distribution protein PAC1	1.11e-16	NA	8.09e-10
3. B	Q4X1Y0	Polyadenylation factor subunit 2	8.98e-09	NA	8.75e-08
3. B	Q9FNZ2	Zinc finger CCCH domain-containing protein 48	1.11e-16	NA	5.93e-10
3. B	Q08E38	Pre-mRNA-processing factor 19	1.11e-16	NA	2.48e-15
3. B	Q9NSI6	Bromodomain and WD repeat-containing protein 1	1.58e-04	NA	2.79e-13
3. B	P0CS45	Mitochondrial division protein 1	1.16e-07	NA	1.71e-15
3. B	Q54YD8	Coatomer subunit beta'	3.46e-07	NA	6.76e-15
3. B	O60508	Pre-mRNA-processing factor 17	1.02e-10	NA	1.06e-10
3. B	Q54RP0	UDP-galactose:fucoside alpha-3-galactosyltransferase	4.86e-14	NA	4.33e-11
3. B	O75529	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	5.22e-15	NA	5.10e-20
3. B	Q8WWQ0	PH-interacting protein	1.12e-06	NA	5.79e-18
3. B	Q60525	Telomerase Cajal body protein 1	8.74e-10	NA	0.008
3. B	Q6ZNJ1	Neurobeachin-like protein 2	NA	NA	0.024
3. B	Q94BM7	Protein SPA1-RELATED 4	1.32e-11	NA	9.41e-06
3. B	Q6ZQL4	WD repeat-containing protein 43	9.71e-07	NA	4.22e-05
3. B	B6K1G6	Probable cytosolic Fe-S cluster assembly factor SJAG_02895	2.50e-14	NA	1.47e-06
3. B	B8P4B0	Nuclear distribution protein PAC1-1	0.00e+00	NA	2.16e-26
3. B	Q5IS43	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	3.81e-27
3. B	Q4WEI5	Histone acetyltransferase type B subunit 2	5.44e-11	NA	1.62e-04
3. B	Q8H594	Ribosome biogenesis protein WDR12 homolog	2.91e-11	NA	7.26e-09
3. B	A7RHG8	Ribosome biogenesis protein WDR12 homolog (Fragment)	2.24e-12	NA	3.32e-08
3. B	C3XVT5	Lissencephaly-1 homolog	0.00e+00	NA	2.41e-27
3. B	Q8HXL3	WD repeat-containing protein 62	2.43e-05	NA	4.76e-04
3. B	Q96DI7	U5 small nuclear ribonucleoprotein 40 kDa protein	0.00e+00	NA	1.47e-16
3. B	B8M7Q5	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.67e-09	NA	6.02e-27
3. B	Q2UA71	Histone acetyltransferase type B subunit 2	5.29e-11	NA	8.58e-04
3. B	Q9DCE5	p21-activated protein kinase-interacting protein 1	4.79e-13	NA	1.95e-08
3. B	Q8BHD1	POC1 centriolar protein homolog B	5.71e-10	NA	1.92e-17
3. B	C5GVJ9	Nuclear distribution protein PAC1	1.21e-12	NA	1.54e-19
3. B	A1CBP8	Mitochondrial division protein 1	3.84e-14	NA	4.25e-16
3. B	Q6CGP9	Polyadenylation factor subunit 2	6.19e-09	NA	5.66e-07
3. B	F4IIK6	Non-functional target of rapamycin complex subunit LST8-2	0.00e+00	NA	7.15e-10
3. B	Q9VKQ3	Ribosome biogenesis protein WDR12 homolog	1.65e-12	NA	6.96e-08
3. B	Q0P593	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	1.08e-39
3. B	Q8VYZ5	Periodic tryptophan protein 2	1.50e-08	NA	4.47e-12
3. B	Q0CLJ4	Ribosome biogenesis protein ytm1	5.39e-11	NA	0.004
3. B	P54686	Actin-interacting protein 1	3.11e-15	NA	1.32e-06
3. B	Q5XFW6	WD repeat-containing protein 6	1.83e-08	NA	0.002
3. B	A8NEG8	Nuclear distribution protein PAC1	0.00e+00	NA	5.95e-24
3. B	P58404	Striatin-4	8.96e-13	NA	1.62e-08
3. B	A8Q2R5	WD repeat-containing protein 48 homolog	1.81e-11	NA	1.22e-14
3. B	C5DY07	Nuclear distribution protein PAC1	0.00e+00	NA	1.13e-08
3. B	Q04727	Transducin-like enhancer protein 4	4.34e-09	NA	3.82e-06
3. B	P58405	Striatin-3	2.60e-12	NA	5.05e-06
3. B	Q5BJ90	Ribosome biogenesis protein wdr12	2.68e-12	NA	1.43e-07
3. B	B2AY28	Ribosome biogenesis protein ERB1	8.61e-11	NA	0.039
3. B	A2QI22	Ribosome biogenesis protein ytm1	3.82e-11	NA	7.63e-05
3. B	Q68EI0	WD repeat-containing protein 18	4.90e-11	NA	2.12e-04
3. B	O82266	Protein SLOW WALKER 1	2.97e-09	NA	5.91e-04
3. B	Q6BU94	Pre-mRNA-splicing factor PRP46	3.44e-13	NA	1.61e-15
3. B	Q5TTP0	WD repeat-containing protein on Y chromosome	7.30e-07	NA	0.003
3. B	Q5XX13	F-box/WD repeat-containing protein 10	1.88e-06	NA	2.68e-15
3. B	B6QC06	Nuclear distribution protein nudF 2	0.00e+00	NA	4.65e-16
3. B	B4NW98	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.53e-04
3. B	Q2UFN8	Probable E3 ubiquitin ligase complex SCF subunit sconB	4.51e-09	NA	8.32e-26
3. B	Q06679	U3 small nucleolar RNA-associated protein 4	4.35e-08	NA	0.045
3. B	Q9ERG2	Striatin-3	3.20e-12	NA	2.26e-06
3. B	Q62440	Transducin-like enhancer protein 1	4.20e-09	NA	2.09e-05
3. B	Q2HBX6	Nuclear distribution protein PAC1-1	0.00e+00	NA	3.55e-18
3. B	Q07141	Transducin-like enhancer protein 4	3.00e-12	NA	8.39e-06
3. B	Q148I1	Proteasomal ATPase-associated factor 1	7.43e-14	NA	1.95e-07
3. B	A2RRU3	U3 small nucleolar RNA-associated protein 15 homolog	5.96e-10	NA	5.33e-13
3. B	Q9VPH8	Retinoblastoma-binding protein 5 homolog	1.13e-07	NA	7.04e-04
3. B	B0DWM8	Ribosome biogenesis protein YTM1	3.10e-11	NA	8.29e-04
3. B	O22785	Pre-mRNA-processing factor 19 homolog 2	8.78e-11	NA	1.98e-09
3. B	Q8L4J2	Cleavage stimulation factor subunit 50	2.22e-15	NA	0.005
3. B	Q1DR81	Probable cytosolic iron-sulfur protein assembly protein 1	3.22e-15	NA	0.024
3. B	P53699	Cell division control protein 4	0.00e+00	NA	4.91e-27
3. B	Q19124	Autophagic-related protein 16.1	1.69e-14	NA	2.06e-04
3. B	Q54W52	Ribosome biogenesis protein WDR12 homolog	1.27e-11	NA	0.036
3. B	A6ZPA9	Ribosome biogenesis protein YTM1	7.54e-12	NA	5.91e-05
3. B	Q5EA99	p21-activated protein kinase-interacting protein 1	9.47e-13	NA	3.69e-09
3. B	F4HTH8	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2	4.93e-08	NA	3.87e-20
3. B	Q13610	Periodic tryptophan protein 1 homolog	1.89e-10	NA	0.003
3. B	Q9JMJ4	Pre-mRNA-processing factor 19	1.11e-16	NA	5.79e-15
3. B	Q6P5U7	NACHT and WD repeat domain-containing protein 2	1.35e-05	NA	0.013
3. B	Q8BH44	Coronin-2B	4.79e-07	NA	2.87e-04
3. B	O76734	General transcriptional corepressor tupA	2.41e-11	NA	1.77e-16
3. B	Q93847	WD repeat-containing protein wdr-5.2	0.00e+00	NA	3.01e-20
3. B	C8ZH19	Nuclear distribution protein PAC1	8.07e-12	NA	1.80e-09
3. B	Q2TAY7	WD40 repeat-containing protein SMU1	2.11e-15	NA	7.44e-20
3. B	P0CS44	Mitochondrial division protein 1	1.07e-06	NA	1.71e-15
3. B	Q1LZ08	WD repeat-containing protein 48 homolog	1.47e-11	NA	6.71e-18
3. B	Q9T014	Protein SPA1-RELATED 2	1.57e-09	NA	0.002
3. B	O43379	WD repeat-containing protein 62	2.05e-05	NA	3.63e-04
3. B	A7TNS8	CCR4-associated factor 4 homolog	1.89e-13	NA	2.93e-17
3. B	Q6DDF0	WD repeat-containing protein 37	3.08e-12	NA	4.64e-09
3. B	Q8K3E5	Jouberin	1.59e-06	NA	3.86e-05
3. B	Q9LV35	Actin-interacting protein 1-2	4.87e-12	NA	0.002
3. B	Q4R8H1	F-box-like/WD repeat-containing protein TBL1X	0.00e+00	NA	8.18e-17
3. B	B5X3Z6	Lissencephaly-1 homolog A	0.00e+00	NA	8.34e-28
3. B	Q7RY30	Nuclear distribution protein nudF-2	0.00e+00	NA	1.21e-18
3. B	Q04660	Ribosome biogenesis protein ERB1	1.24e-06	NA	0.028
3. B	D4AM37	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.46e-10	NA	1.33e-26
3. B	Q5REG7	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	8.94e-28
3. B	Q64LD2	WD repeat-containing protein 25	1.28e-11	NA	0.001
3. B	O55106	Striatin	1.67e-12	NA	3.55e-04
3. B	Q86JF2	BEACH domain-containing protein lvsB	NA	NA	0.003
3. B	Q9JMJ2	F-box/WD repeat-containing protein 4	3.33e-16	NA	0.007
3. B	A2QPW4	Probable cytosolic iron-sulfur protein assembly protein 1	1.51e-09	NA	0.037
3. B	Q759U7	Nuclear distribution protein PAC1	0.00e+00	NA	2.85e-07
3. B	Q62623	Cell division cycle protein 20 homolog	4.80e-12	NA	3.87e-05
3. B	Q8VDD9	PH-interacting protein	1.40e-06	NA	3.29e-18
3. B	C4JZS6	Nuclear distribution protein PAC1-1	0.00e+00	NA	9.77e-21
3. B	B4GAJ1	Lissencephaly-1 homolog	0.00e+00	NA	4.04e-23
3. B	P0CS39	Protein HIR1	1.26e-06	NA	0.019
3. B	P42527	Myosin heavy chain kinase A	8.62e-11	NA	1.33e-24
3. B	Q5REE6	Ribosome biogenesis protein WDR12	2.81e-12	NA	6.86e-09
3. B	P0CS36	Histone acetyltransferase type B subunit 2	4.55e-15	NA	3.39e-05
3. B	Q969H0	F-box/WD repeat-containing protein 7	0.00e+00	NA	1.24e-40
3. B	A7S338	Lissencephaly-1 homolog	0.00e+00	NA	2.58e-25
3. B	Q676U5	Autophagy-related protein 16-1	1.74e-13	NA	4.24e-06
3. B	P78972	WD repeat-containing protein slp1	3.45e-11	NA	0.042
3. B	Q652L2	Protein HIRA	1.77e-06	NA	0.001
3. B	B8NGT5	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.18e-10	NA	7.51e-26
3. B	Q40687	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	1.59e-09
3. B	P36130	CCR4-associated factor 4	1.12e-13	NA	1.94e-17
3. B	Q9QXL2	Kinesin-like protein KIF21A	2.15e-07	NA	3.30e-13
3. B	Q6PFM9	WD repeat-containing protein 48	2.72e-11	NA	1.16e-18
3. B	Q9NNW5	WD repeat-containing protein 6	2.24e-08	NA	0.005
3. B	Q6DFF9	Mitogen-activated protein kinase-binding protein 1	3.30e-05	NA	0.007
3. B	D1ZEM6	Nuclear distribution protein PAC1-2	1.96e-11	NA	3.02e-14
3. B	Q9UTN4	Polyadenylation factor subunit 2	5.08e-10	NA	7.37e-14
3. B	Q5BK30	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	1.27e-35
3. B	O94423	Meiotic fizzy-related protein 1	1.10e-12	NA	0.025
3. B	Q9I9H8	Apoptotic protease-activating factor 1	6.51e-10	NA	2.41e-17
3. B	C7GWC1	Nuclear distribution protein PAC1	1.11e-16	NA	9.03e-09
3. B	O13168	Transducin-like enhancer protein 3-B	3.11e-11	NA	8.46e-04
3. B	Q8W117	Suppressor of mec-8 and unc-52 protein homolog 1	6.66e-16	NA	8.53e-15
3. B	Q8N1V2	Cilia- and flagella-associated protein 52	2.10e-12	NA	1.74e-06
3. B	Q5DFU0	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	0.002
3. B	Q810D6	Glutamate-rich WD repeat-containing protein 1	1.77e-14	NA	0.010
3. B	O14170	WD repeat-containing protein pop2	0.00e+00	NA	2.67e-27
3. B	Q54R82	Mitogen-activated protein kinase kinase kinase A	4.16e-11	NA	2.82e-21
3. B	Q6ZQQ6	WD repeat-containing protein 87	NA	NA	2.38e-04
3. B	A6RUL1	Eukaryotic translation initiation factor 3 subunit I	9.99e-16	NA	1.42e-05
3. B	Q95JL5	Cilia- and flagella-associated protein 52	9.19e-13	NA	1.95e-06
3. B	O35142	Coatomer subunit beta'	6.58e-08	NA	7.97e-17
3. B	Q9WVB2	Transducin-like enhancer protein 2	3.63e-12	NA	1.46e-05
3. B	Q9QXE7	F-box-like/WD repeat-containing protein TBL1X	0.00e+00	NA	1.55e-18
3. B	P0CS47	Polyadenylation factor subunit 2	1.71e-08	NA	7.43e-13
3. B	Q9BZK7	F-box-like/WD repeat-containing protein TBL1XR1	0.00e+00	NA	5.62e-16
3. B	Q7ZXZ2	U3 small nucleolar RNA-associated protein 15 homolog	7.65e-10	NA	4.53e-10
3. B	P90648	Myosin heavy chain kinase B	1.17e-10	NA	5.29e-29
3. B	P91341	Periodic tryptophan protein 2 homolog	6.62e-09	NA	6.32e-09
3. B	G0SC29	Ribosome assembly protein 4	0.00e+00	NA	1.92e-20
3. B	Q54ZP5	WD repeat-containing protein 48 homolog	2.09e-04	NA	1.75e-04
3. B	Q91WQ5	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	3.44e-15	NA	1.10e-20
3. B	P97260	Sterol regulatory element-binding protein cleavage-activating protein	2.82e-10	NA	7.25e-12
3. B	A5D7H2	Striatin-3	3.63e-12	NA	1.58e-05
3. B	B4J8H6	WD repeat-containing protein 48 homolog	1.32e-11	NA	3.44e-19
3. B	A7THX0	Mitochondrial division protein 1	7.13e-13	NA	3.39e-14
3. B	B3RQN1	Ribosome biogenesis protein WDR12 homolog	3.92e-12	NA	2.18e-08
3. B	O14186	Uncharacterized WD repeat-containing protein C4F8.11	1.83e-06	NA	0.001
3. B	O13923	Coronin-like protein crn1	5.85e-06	NA	0.008
3. B	Q54U63	BEACH domain-containing protein lvsC	4.11e-03	NA	0.033
3. B	Q9C1X1	Periodic tryptophan protein 2 homolog	2.87e-09	NA	6.93e-11
3. B	Q4P8R5	Mitochondrial division protein 1	7.48e-07	NA	1.61e-14
3. B	A6ZQL5	Mitochondrial division protein 1	8.76e-13	NA	4.72e-17
3. B	Q9BV38	WD repeat-containing protein 18	2.30e-09	NA	3.01e-06
3. B	P49695	Probable serine/threonine-protein kinase PkwA	1.95e-14	NA	1.30e-34
3. B	Q95RJ9	F-box-like/WD repeat-containing protein ebi	0.00e+00	NA	1.90e-18
3. B	O74319	Transcription initiation factor TFIID subunit taf73	2.01e-14	NA	7.04e-14
3. B	P41811	Coatomer subunit beta'	6.34e-08	NA	2.51e-10
3. B	A8JAN3	Centriole proteome protein 16	8.70e-04	NA	1.99e-06
3. B	Q3ULA2	F-box/WD repeat-containing protein 1A	9.29e-12	NA	5.65e-29
3. B	Q6BUA6	Nuclear distribution protein PAC1	7.77e-16	NA	1.49e-11
3. B	B4LUA5	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.86e-04
3. B	Q05B17	WD repeat-containing protein 48	2.89e-11	NA	3.23e-18
3. B	Q39190	Protein pleiotropic regulator PRL2	5.44e-15	NA	7.57e-14
3. B	Q4VBE8	WD repeat-containing protein 18	2.42e-11	NA	4.96e-07
3. B	B4KRQ4	WD repeat-containing protein 48 homolog	1.86e-11	NA	2.57e-18
3. B	Q8I0F4	Lissencephaly-1 homolog	0.00e+00	NA	1.60e-27
3. B	B0XM00	Nuclear distribution protein nudF	0.00e+00	NA	3.85e-17
3. B	P73594	WD repeat-containing protein slr1409	0.00e+00	NA	1.64e-10
3. B	P49178	Guanine nucleotide-binding protein subunit beta	6.94e-13	NA	2.71e-09
3. B	F4IH25	Ribosome biogenesis protein BOP1 homolog	1.85e-09	NA	0.004
3. B	Q5U2W5	Transducin beta-like protein 3	7.24e-10	NA	1.52e-15
3. B	Q32PG3	WD repeat-containing protein 48	2.79e-11	NA	3.64e-19
3. B	P43033	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	NA	5.23e-28
3. B	Q6FJS0	Polyadenylation factor subunit 2	2.68e-10	NA	4.71e-13
3. B	B8N4F5	Probable catabolite repression protein creC	1.57e-06	NA	8.21e-04
3. B	Q00808	Vegetative incompatibility protein HET-E-1	4.92e-08	NA	7.84e-40
3. B	A0AUS0	WD repeat, SAM and U-box domain-containing protein 1	1.16e-11	NA	1.73e-05
3. B	B1ANS9	WD repeat-containing protein 64	1.18e-06	NA	2.97e-05
3. B	A8IR43	Ribosome biogenesis protein WDR12 homolog	2.77e-11	NA	0.002
3. B	C0S902	Nuclear distribution protein PAC1	1.40e-10	NA	1.86e-21
3. B	A2QVV2	Probable catabolite repression protein creC	4.87e-06	NA	0.002
3. B	Q8N136	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	7.39e-38
3. B	A1CTE6	Probable catabolite repression protein creC	8.54e-07	NA	0.001
3. B	Q6NS57	Mitogen-activated protein kinase-binding protein 1	2.06e-05	NA	0.023
3. B	Q2UM42	Probable catabolite repression protein creC	1.21e-06	NA	8.21e-04
3. B	Q5RBW3	Coronin-7	1.68e-06	NA	0.034
3. B	Q0UXP3	Ribosome biogenesis protein YTM1	3.75e-11	NA	0.012
3. B	Q8IWB7	WD repeat and FYVE domain-containing protein 1	3.40e-10	NA	1.16e-04
3. B	Q0U2T3	Mitochondrial division protein 1	3.18e-12	NA	9.52e-17
3. B	O75083	WD repeat-containing protein 1	2.34e-13	NA	3.17e-05
3. B	P87060	WD repeat-containing protein pop1	0.00e+00	NA	1.96e-23
3. B	P0CS43	Nuclear distribution protein PAC1	0.00e+00	NA	3.80e-32
3. B	B6GZD3	Nuclear distribution protein nudF 2	0.00e+00	NA	1.21e-20
3. B	O94560	Uncharacterized WD repeat-containing protein C1773.01	1.42e-12	NA	1.58e-04
3. B	Q8N0X2	Sperm-associated antigen 16 protein	1.03e-12	NA	6.68e-15
3. B	P54319	Phospholipase A-2-activating protein	2.87e-09	NA	2.64e-11
3. B	P38262	SIR4-interacting protein SIF2	0.00e+00	NA	4.87e-05
3. B	A8IZG4	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	1.60e-06
3. B	Q7ZVA0	WD40 repeat-containing protein SMU1	1.89e-15	NA	5.09e-19
3. B	O60137	Set1 complex component swd2	6.62e-11	NA	0.014
3. B	B2RZ17	F-box/WD repeat-containing protein 2	1.50e-10	NA	9.93e-14
3. B	Q8K450	Sperm-associated antigen 16 protein	1.44e-15	NA	1.13e-16
3. B	Q9USZ0	Uncharacterized WD repeat-containing protein C1306.02	8.90e-07	NA	8.25e-04
3. B	Q9M0V4	U3 snoRNP-associated protein-like YAO	4.77e-15	NA	9.33e-07
3. B	Q0WV90	Topless-related protein 1	2.35e-05	NA	0.005
3. B	P57737	Coronin-7	3.15e-06	NA	0.009
3. B	A2AKB9	DDB1- and CUL4-associated factor 10	8.33e-12	NA	0.010
3. B	Q54SA5	WD repeat-containing protein 55 homolog	3.66e-14	NA	2.63e-07
3. B	P70483	Striatin	2.21e-12	NA	5.83e-04
3. B	Q9SV01	F-box/WD-40 repeat-containing protein At3g52030	1.33e-15	NA	0.005
3. B	B0XFT7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	6.80e-08
3. B	A7EKM8	Nuclear distribution protein PAC1	1.54e-10	NA	1.52e-18
3. B	Q08924	Regulator of Ty1 transposition protein 10	3.31e-07	NA	1.19e-04
3. B	Q5F3K4	WD repeat-containing protein 48	2.52e-11	NA	5.26e-19
3. B	Q70M86	Striatin Pro11	5.53e-07	NA	0.007
3. B	Q4V7Z1	POC1 centriolar protein homolog B	1.17e-09	NA	1.52e-18
3. B	B4HWV6	Ribosome biogenesis protein WDR12 homolog	2.73e-12	NA	3.63e-08
3. B	Q5SQM0	Echinoderm microtubule-associated protein-like 6	8.30e-05	NA	0.008
3. B	Q75DC5	Ribosome biogenesis protein ERB1	1.03e-06	NA	0.037
3. B	Q15542	Transcription initiation factor TFIID subunit 5	2.34e-12	NA	6.66e-25
3. B	Q8N9V3	WD repeat, SAM and U-box domain-containing protein 1	1.11e-16	NA	5.19e-07
3. B	Q5RFF8	Notchless protein homolog 1	0.00e+00	NA	2.86e-22
3. B	Q5ZMC3	WD repeat, SAM and U-box domain-containing protein 1	2.22e-16	NA	1.08e-06
3. B	A2QPZ4	Ribosome biogenesis protein erb1	3.00e-07	NA	0.012
3. B	Q6H8D6	Putative coatomer subunit beta'-3	9.30e-08	NA	1.27e-15
3. B	Q6FKK3	Ribosome biogenesis protein YTM1	1.11e-16	NA	2.67e-06
3. B	Q6LA54	Uncharacterized WD repeat-containing protein C3H5.08c	3.06e-06	NA	0.008
3. B	B3N534	Ribosome biogenesis protein WDR12 homolog	2.40e-12	NA	1.47e-08
3. B	Q9UKB1	F-box/WD repeat-containing protein 11	2.33e-12	NA	6.86e-29
3. B	O14775	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	NA	8.23e-13
3. B	Q54J37	Striatin homolog	7.73e-12	NA	2.21e-04
3. B	Q2UGK1	Ribosome biogenesis protein ytm1	6.65e-11	NA	0.001
3. B	P87314	Protein hir1	1.52e-07	NA	0.030
3. B	Q8BH57	WD repeat-containing protein 48	2.42e-11	NA	8.23e-19
3. B	Q3MKM6	U3 snoRNP-associated protein-like EMB2271	2.33e-15	NA	5.94e-06
3. B	B0XYC8	Eukaryotic translation initiation factor 3 subunit I	1.55e-15	NA	1.23e-04
3. B	B9WD30	Nuclear distribution protein PAC1	2.22e-16	NA	1.20e-08
3. B	Q27GK7	Topless-related protein 4	4.96e-05	NA	0.001
3. B	B8AP31	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	1.59e-09
3. B	Q6PNB6	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	NA	7.63e-13
3. B	Q12220	U3 small nucleolar RNA-associated protein 12	1.42e-08	NA	3.12e-12
3. B	Q5AXW3	Mitochondrial division protein 1	4.96e-14	NA	1.39e-17
3. B	A5DJX5	Nuclear distribution protein PAC1	1.11e-16	NA	1.29e-08
3. B	Q0CXH9	Eukaryotic translation initiation factor 3 subunit I	1.22e-15	NA	7.40e-05
3. B	O74184	Target of rapamycin complex subunit wat1	0.00e+00	NA	1.56e-08
3. B	Q8N157	Jouberin	4.81e-06	NA	0.020
3. B	Q06506	Ribosomal RNA-processing protein 9	8.64e-13	NA	0.005
3. B	A1C7E4	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.63e-09	NA	1.34e-25
3. B	O55029	Coatomer subunit beta'	8.37e-08	NA	1.60e-17
3. B	Q0V8F1	Coronin-7	2.59e-06	NA	0.012
3. B	Q920I9	WD repeat-containing protein 7	2.23e-06	NA	0.002
3. B	Q09990	F-box/WD repeat-containing protein lin-23	4.66e-11	NA	3.23e-32
3. B	Q5APF0	Ribosome biogenesis protein YTM1	1.49e-11	NA	0.002
3. B	Q9CX97	WD repeat-containing protein 55	1.82e-11	NA	0.011
3. B	Q3UKJ7	WD40 repeat-containing protein SMU1	4.53e-11	NA	7.44e-20
3. B	B6Q4Z5	Probable E3 ubiquitin ligase complex SCF subunit sconB	2.28e-09	NA	5.13e-29
3. B	Q20168	Probable coatomer subunit beta'	2.26e-07	NA	2.18e-10
3. B	D4D8P3	Probable E3 ubiquitin ligase complex SCF subunit sconB	2.04e-14	NA	1.14e-26
3. B	Q9Y297	F-box/WD repeat-containing protein 1A	1.18e-11	NA	4.08e-29
3. B	Q3SZD4	WD repeat-containing protein 18	5.14e-11	NA	7.14e-08
3. B	B4GT01	Ribosome biogenesis protein WDR12 homolog	2.95e-12	NA	2.45e-09
3. B	Q9NRL3	Striatin-4	6.41e-13	NA	7.49e-08
3. B	P57775	F-box/WD repeat-containing protein 4	6.66e-16	NA	0.003
3. B	Q5ZMV9	GATOR complex protein WDR24	2.84e-05	NA	0.034
3. B	A2QCU8	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.96e-09	NA	4.42e-26
3. B	Q96KV7	WD repeat-containing protein 90	5.26e-05	NA	7.99e-08
3. B	Q229Z6	POC1 centriolar protein homolog	5.78e-09	NA	7.89e-15
3. B	O13982	Uncharacterized WD repeat-containing protein C25H1.08c	0.00e+00	NA	1.16e-06
3. B	C1GB49	Nuclear distribution protein PAC1	2.53e-12	NA	7.75e-21
3. B	P0DPA1	WD repeat-containing protein DDB_G0349043	1.39e-13	NA	8.91e-06
3. B	Q54MP8	Bromodomain and WD repeat-containing DDB_G0285837	9.88e-07	NA	4.20e-06
3. B	Q9SJT9	Coatomer subunit alpha-2	9.79e-08	NA	2.57e-11
3. B	Q8BU03	Periodic tryptophan protein 2 homolog	3.01e-08	NA	6.17e-10
3. B	A1CJY4	Eukaryotic translation initiation factor 3 subunit I	1.55e-15	NA	5.15e-05
3. B	P36037	Protein DOA1	1.00e-06	NA	9.86e-12
3. B	Q80ZD0	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	NA	5.78e-13
3. B	O13282	Transcription initiation factor TFIID subunit 5	2.09e-14	NA	1.22e-21
3. B	Q4WX90	Eukaryotic translation initiation factor 3 subunit I	1.67e-15	NA	1.23e-04
3. B	B4P6P9	Lissencephaly-1 homolog	0.00e+00	NA	3.66e-23
3. B	O94289	Ubiquitin homeostasis protein lub1	6.20e-08	NA	8.97e-09
3. B	O94365	U3 small nucleolar RNA-associated protein 15	6.36e-10	NA	4.29e-06
3. B	Q3SZK1	Angio-associated migratory cell protein	0.00e+00	NA	5.57e-12
3. B	B6GZA1	Probable E3 ubiquitin ligase complex SCF subunit sconB	8.97e-11	NA	7.16e-23
3. B	B3MJV8	Ribosome biogenesis protein WDR12 homolog	2.15e-12	NA	1.51e-07
3. B	Q5RFQ3	Periodic tryptophan protein 2 homolog	2.45e-08	NA	6.62e-11
3. B	B4KKN1	Ribosome biogenesis protein WDR12 homolog	1.67e-12	NA	1.37e-08
3. B	Q8BX17	Gem-associated protein 5	3.92e-06	NA	0.005
3. B	Q20059	WD repeat-containing protein 48 homolog	7.95e-11	NA	5.58e-06
3. B	A0JP70	WD repeat-containing protein 90	7.39e-05	NA	6.58e-08
3. B	Q2UGU1	Nuclear distribution protein nudF	4.33e-15	NA	1.85e-18
3. B	O13046	WD repeat and HMG-box DNA-binding protein 1	4.33e-06	NA	0.008
3. B	Q9UKT8	F-box/WD repeat-containing protein 2	1.66e-10	NA	5.49e-14
3. B	A4R2Q6	Ribosome biogenesis protein YTM1	9.35e-11	NA	0.002
3. B	Q94AI7	Protein TOPLESS	2.37e-04	NA	0.005
3. B	B3MET8	WD repeat-containing protein 48 homolog	1.42e-11	NA	5.43e-18
3. B	Q9LXN4	Protein HIRA	4.35e-06	NA	0.001
3. B	Q6PAX7	WD repeat-containing protein 1-B	1.01e-12	NA	3.84e-05
3. B	Q5BDL3	Ribosome biogenesis protein erb1	1.13e-10	NA	0.025
3. B	Q9Y2I8	WD repeat-containing protein 37	2.93e-12	NA	1.69e-09
3. B	B3LJT5	Nuclear distribution protein PAC1	1.11e-16	NA	7.17e-10
3. B	O42937	Probable coatomer subunit beta'	2.14e-08	NA	1.79e-12
3. B	Q8IZU2	WD repeat-containing protein 17	1.03e-07	NA	5.25e-12
3. B	Q5ACW8	Protein HIR1	3.04e-05	NA	0.013
3. B	Q16MY0	WD repeat-containing protein 48 homolog	1.09e-11	NA	9.16e-13
3. B	Q6ZPG2	WD repeat-containing protein 90	1.14e-04	NA	2.76e-08
3. B	P63005	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	NA	6.70e-28
3. B	Q9Y4E6	WD repeat-containing protein 7	2.04e-06	NA	8.55e-04
3. B	B4I195	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.31e-05
3. B	O60907	F-box-like/WD repeat-containing protein TBL1X	0.00e+00	NA	9.86e-17
3. B	A1Z8D0	Periodic tryptophan protein 1 homolog	1.84e-13	NA	0.003
3. B	Q8CIE6	Coatomer subunit alpha	1.39e-06	NA	9.36e-11
3. B	D1ZEB4	Nuclear distribution protein PAC1-1	0.00e+00	NA	1.36e-17
3. B	B8N9H4	Nuclear distribution protein nudF	0.00e+00	NA	1.85e-18
3. B	Q5RD06	POC1 centriolar protein homolog B	4.67e-13	NA	2.15e-17
3. B	Q55563	Uncharacterized WD repeat-containing protein sll0163	9.17e-08	NA	5.45e-31
3. B	B0XAF3	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	0.002
3. B	Q2H139	Mitochondrial division protein 1	1.32e-13	NA	3.88e-20
3. B	D3ZW91	POC1 centriolar protein homolog B	8.03e-11	NA	2.27e-17
3. B	O62621	Coatomer subunit beta'	8.00e-08	NA	1.84e-13
3. B	Q9H2Y7	Zinc finger protein 106	2.10e-05	NA	1.09e-29
3. B	A2QEV8	Eukaryotic translation initiation factor 3 subunit I	1.18e-14	NA	8.12e-05
3. B	O62471	Protein qui-1	1.26e-06	NA	2.64e-12
3. B	A6ZZZ8	CCR4-associated factor 4	5.90e-14	NA	1.63e-16
3. B	Q9Y6I7	WD repeat and SOCS box-containing protein 1	0.00e+00	NA	1.81e-08
3. B	Q9WUC8	Pleiotropic regulator 1	5.27e-13	NA	3.30e-21
3. B	Q5RKI0	WD repeat-containing protein 1	2.25e-13	NA	1.52e-04
3. B	O61585	Katanin p80 WD40 repeat-containing subunit B1	2.37e-09	NA	1.82e-19
3. B	B2VZH2	Ribosome biogenesis protein ytm1	4.25e-11	NA	0.025
3. B	Q5ZME8	WD40 repeat-containing protein SMU1	2.11e-15	NA	2.32e-20
3. B	P74598	Uncharacterized WD repeat-containing protein sll1491	2.44e-15	NA	6.92e-11
3. B	Q17BB0	Ribosome biogenesis protein WDR12 homolog	5.98e-12	NA	1.16e-06
3. B	B0W517	Ribosome biogenesis protein WDR12 homolog	1.35e-10	NA	3.73e-08
3. B	Q06440	Coronin-like protein	8.23e-06	NA	0.001
3. B	Q5MNU5	Sterol regulatory element-binding protein cleavage-activating protein	1.14e-09	NA	4.02e-12
3. B	Q17N69	Lissencephaly-1 homolog	0.00e+00	NA	4.25e-24
3. B	Q8N5D0	WD and tetratricopeptide repeats protein 1	2.28e-05	NA	0.012
3. B	Q54SD4	Probable histone-binding protein rbbD	1.78e-15	NA	0.001
3. B	B4P7H8	WD repeat-containing protein 48 homolog	1.95e-11	NA	9.79e-18
3. B	Q6C709	Pre-mRNA-splicing factor PRP46	0.00e+00	NA	2.58e-13
3. B	Q8C7V3	U3 small nucleolar RNA-associated protein 15 homolog	8.81e-10	NA	1.03e-12
3. B	Q6DFC6	WD repeat-containing protein 75	1.30e-07	NA	0.005
3. B	Q758R7	Mitochondrial division protein 1	6.33e-13	NA	3.14e-16
3. B	P43034	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	NA	5.60e-28
3. B	P27612	Phospholipase A-2-activating protein	4.43e-06	NA	1.10e-11
3. B	A9UP22	Ribosome biogenesis protein WDR12 homolog	2.33e-11	NA	7.34e-07
3. B	A1DDL6	Mitochondrial division protein 1	7.70e-14	NA	2.62e-15
3. B	Q6FT96	Mitochondrial division protein 1	8.73e-13	NA	2.13e-14
3. B	Q9FE91	Zinc finger CCCH domain-containing protein 62	3.33e-16	NA	2.97e-15
3. B	Q9UT85	Uncharacterized WD repeat-containing protein C343.04c	2.02e-13	NA	2.09e-05
3. B	A8PTE4	Mitochondrial division protein 1	1.32e-08	NA	5.83e-17
3. B	Q9UQ03	Coronin-2B	3.96e-08	NA	2.75e-04
3. B	Q9VAT2	DDB1- and CUL4-associated factor 10 homolog	5.26e-07	NA	0.035
3. B	O75717	WD repeat and HMG-box DNA-binding protein 1	5.08e-05	NA	0.004
3. B	Q8L828	Coatomer subunit beta'-3	6.98e-08	NA	7.97e-16
3. B	B3MEY6	Lissencephaly-1 homolog	0.00e+00	NA	2.15e-23
3. B	A4REK3	Protein transport protein SEC13	1.11e-16	NA	0.050
3. B	A1DHW6	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.29e-09	NA	9.02e-26
3. B	O14727	Apoptotic protease-activating factor 1	1.37e-09	NA	3.62e-14
3. B	Q2U5Z8	Mitochondrial division protein 1	4.74e-14	NA	7.91e-17
3. B	Q94BQ3	Protein ALTERED SEED GERMINATION 2	4.88e-04	NA	0.016
3. B	Q7YR70	Angio-associated migratory cell protein	0.00e+00	NA	1.20e-11
3. B	A6S0T8	Ribosome biogenesis protein ytm1	5.94e-11	NA	3.97e-04
3. B	B2B766	Nuclear distribution protein PAC1-2	0.00e+00	NA	8.73e-15
3. B	Q2KJH4	WD repeat-containing protein 1	2.12e-13	NA	6.91e-07
3. B	Q5BE22	Pre-mRNA-splicing factor prp46	0.00e+00	NA	1.95e-22
3. B	G8SD34	NAD(+) hydrolase ApTIR	4.19e-12	NA	3.11e-12
3. B	Q7ZW33	U3 small nucleolar RNA-associated protein 15 homolog	1.16e-11	NA	2.83e-08
3. B	Q756D0	Ribosome biogenesis protein YTM1	0.00e+00	NA	2.16e-06
3. B	O42469	Transducin-like enhancer protein 1	4.19e-09	NA	1.93e-05
3. B	Q9W7F2	WD repeat-containing protein 1-A	1.43e-12	NA	0.003
3. B	D5GBI7	Nuclear distribution protein PAC1	0.00e+00	NA	2.46e-17
3. B	Q13033	Striatin-3	3.29e-12	NA	6.93e-06
3. B	Q6DRF9	WD repeat-containing protein 55	2.79e-13	NA	0.008
3. B	P0CS49	Pre-mRNA-splicing factor PRP46	0.00e+00	NA	3.39e-17
3. B	Q5RHI5	Denticleless protein homolog	7.33e-08	NA	6.80e-07
3. B	O74855	Ribosome assembly protein 4	0.00e+00	NA	7.34e-18
3. B	O43815	Striatin	2.06e-12	NA	4.08e-04
3. B	P74442	Uncharacterized WD repeat-containing protein slr0143	7.22e-06	NA	1.24e-15
3. B	Q2GTM8	Eukaryotic translation initiation factor 3 subunit I	6.66e-16	NA	5.33e-06
3. B	Q9C827	Coatomer subunit beta'-2	1.01e-07	NA	6.87e-15
3. B	B4Q9T6	Ribosome biogenesis protein WDR12 homolog	2.61e-12	NA	8.70e-08
3. B	Q7PP77	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.26e-06
3. B	Q6FWT9	Nuclear distribution protein PAC1	0.00e+00	NA	1.48e-07
3. B	A6QM06	Sterol regulatory element-binding protein cleavage-activating protein	4.35e-10	NA	3.39e-12
3. B	B4LS78	Ribosome biogenesis protein WDR12 homolog	2.18e-12	NA	8.68e-08
3. B	Q5ZK69	Proteasomal ATPase-associated factor 1	7.34e-14	NA	6.15e-10
3. B	A8PWB6	Ribosome biogenesis protein BOP1 homolog	2.62e-09	NA	0.016
3. B	Q3MHE2	U4/U6 small nuclear ribonucleoprotein Prp4	1.11e-16	NA	1.53e-16
3. B	Q6FJ73	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	2.01e-06
3. B	A4R3M4	Nuclear distribution protein PAC1	0.00e+00	NA	5.98e-17
3. B	Q6P2Y2	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	2.59e-34
3. B	Q7T0P4	POC1 centriolar protein homolog A	1.21e-11	NA	3.33e-17
3. B	C0NRC6	Nuclear distribution protein PAC1	0.00e+00	NA	3.00e-21
3. B	Q5XGE2	U3 small nucleolar RNA-associated protein 15 homolog	5.23e-10	NA	2.87e-10
3. B	A0CH87	Lissencephaly-1 homolog 2	0.00e+00	NA	8.79e-24
3. B	P91343	Ribosome biogenesis protein WDR12 homolog	1.85e-09	NA	2.28e-04
3. B	Q9U2A9	Ribosome biogenesis protein BOP1 homolog	3.03e-09	NA	0.046
3. B	C5MJE8	Nuclear distribution protein PAC1	1.11e-16	NA	2.77e-12
3. B	Q6ZMY6	WD repeat-containing protein 88	2.60e-10	NA	1.16e-14
3. B	B0WYR6	WD repeat-containing protein on Y chromosome	6.02e-07	NA	2.57e-04
3. B	P47025	Mitochondrial division protein 1	1.40e-12	NA	3.79e-17
3. B	P40217	Eukaryotic translation initiation factor 3 subunit I	4.44e-15	NA	8.88e-04
3. B	Q9UTC7	Uncharacterized WD repeat-containing protein C227.12	0.00e+00	NA	7.97e-13
3. B	A8X8C6	WD repeat-containing protein tag-125	0.00e+00	NA	1.71e-24
3. B	C5DF48	Nuclear distribution protein PAC1	0.00e+00	NA	1.38e-08
3. B	Q9NWT1	p21-activated protein kinase-interacting protein 1	3.50e-13	NA	9.06e-09
3. B	Q61FW2	F-box/WD repeat-containing protein sel-10	0.00e+00	NA	1.69e-35
3. B	P39014	F-box protein MET30	9.86e-09	NA	6.56e-29
3. B	Q9P7I3	Mitochondrial division protein 1	1.06e-13	NA	7.66e-19
3. B	P18851	Guanine nucleotide-binding protein subunit beta	7.59e-14	NA	1.57e-12
3. B	P0CS48	Pre-mRNA-splicing factor PRP46	0.00e+00	NA	5.53e-18
3. B	Q6CB13	Mitochondrial division protein 1	2.89e-15	NA	1.39e-23
3. B	Q8NHY2	E3 ubiquitin-protein ligase COP1	1.53e-12	NA	4.02e-07
3. B	Q9P7C0	Uncharacterized WD repeat-containing protein C2E1P5.05	1.60e-09	NA	0.032
3. B	Q54PP7	BEACH domain-containing protein lvsF	3.00e-09	NA	0.005
3. B	Q9UM11	Fizzy-related protein homolog	1.02e-11	NA	0.001
3. B	Q80ZK9	WD and tetratricopeptide repeats protein 1	7.87e-06	NA	0.036
3. B	Q8TC44	POC1 centriolar protein homolog B	8.03e-11	NA	1.04e-17
3. B	Q12770	Sterol regulatory element-binding protein cleavage-activating protein	1.78e-09	NA	6.94e-12
3. B	P0CS38	Protein HIR1	7.49e-07	NA	0.019
3. B	P25635	Periodic tryptophan protein 2	1.01e-08	NA	1.82e-16
3. B	Q6DTM3	Jouberin	1.32e-06	NA	2.50e-05
3. B	B4QHG6	Lissencephaly-1 homolog	0.00e+00	NA	2.11e-23
3. B	Q9D2V7	Coronin-7	1.48e-06	NA	0.002
3. B	B7PY76	Ribosome biogenesis protein WDR12 homolog	7.04e-12	NA	1.29e-07
3. B	Q9DC48	Pre-mRNA-processing factor 17	1.01e-10	NA	2.21e-10
3. B	Q23256	WD repeat-containing protein wdr-5.3	0.00e+00	NA	2.39e-24
3. B	Q17963	WD repeat-containing protein wdr-5.1	0.00e+00	NA	1.05e-20
3. B	B4GSH1	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	4.13e-04
3. B	B2VWG7	Nuclear distribution protein PAC1	0.00e+00	NA	7.76e-20
3. B	A8WGE3	Coronin-2B	3.51e-08	NA	4.08e-04
3. B	Q4R2Z6	WD repeat-containing protein 48	4.91e-12	NA	3.12e-19
3. B	C4YFX2	Transcriptional repressor TUP1	1.11e-16	NA	4.06e-17
3. B	C4R6H3	Nuclear distribution protein PAC1	4.44e-16	NA	1.21e-05
3. B	Q8YTC2	Uncharacterized WD repeat-containing protein alr2800	3.92e-09	NA	2.97e-38
3. B	Q9DAW6	U4/U6 small nuclear ribonucleoprotein Prp4	1.11e-16	NA	7.97e-17
3. B	Q4WLM7	Nuclear distribution protein nudF	0.00e+00	NA	3.85e-17
3. B	P62882	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	NA	4.18e-13
3. B	P07834	Cell division control protein 4	9.75e-14	NA	4.91e-18
3. B	A7Z052	WD repeat-containing protein 6	2.13e-08	NA	0.010
3. B	Q55E54	Coronin-B	1.45e-04	NA	8.00e-04
3. B	Q9S7H3	Cell division cycle 20.3, cofactor of APC complex	2.34e-10	NA	0.003
3. B	Q8TED0	U3 small nucleolar RNA-associated protein 15 homolog	6.63e-10	NA	1.71e-13
3. B	P43254	E3 ubiquitin-protein ligase COP1	3.51e-13	NA	3.27e-07
3. B	Q9CAA0	Coatomer subunit beta'-1	9.22e-08	NA	2.24e-14
3. B	P0CS46	Polyadenylation factor subunit 2	1.28e-07	NA	6.79e-13
3. B	Q04725	Transducin-like enhancer protein 2	2.29e-09	NA	2.63e-04
3. B	P78706	Transcriptional repressor rco-1	4.11e-15	NA	1.50e-18
3. B	Q6RI45	Bromodomain and WD repeat-containing protein 3	6.66e-07	NA	1.10e-13
3. B	Q9ERH3	WD repeat-containing protein 7	1.78e-06	NA	0.004
3. B	Q4R4I8	Coatomer subunit beta'	7.52e-08	NA	1.56e-17
3. B	B4KT48	Lissencephaly-1 homolog	0.00e+00	NA	9.48e-23
3. B	A5DL92	Ribosome biogenesis protein YTM1	1.14e-11	NA	2.43e-06
3. B	Q9EPV5	Apoptotic protease-activating factor 1	2.02e-09	NA	1.27e-14
3. B	O35242	Protein FAN	6.74e-12	NA	3.83e-09
3. B	Q9PTR5	Lissencephaly-1 homolog	0.00e+00	NA	5.17e-28
3. B	B6HP56	Nuclear distribution protein nudF 1	0.00e+00	NA	1.67e-18
3. B	Q9EQ15	Guanine nucleotide-binding protein subunit beta-like protein 1	7.77e-16	NA	0.003
3. B	P0CS37	Histone acetyltransferase type B subunit 2	5.00e-15	NA	3.39e-05
3. B	A0A2R8RWN9	F-box and WD repeat domain-containing 11-B	1.89e-12	NA	2.22e-28
3. B	Q3TLR7	Denticleless protein homolog	2.49e-08	NA	0.001
3. B	Q6H8D5	Coatomer subunit beta'-2	9.59e-08	NA	7.28e-16
3. B	Q6CJ50	Mitochondrial division protein 1	4.43e-13	NA	4.01e-17
3. B	Q9AUR7	Coatomer subunit alpha-2	9.12e-08	NA	1.47e-12
3. B	Q8CBE3	WD repeat-containing protein 37	3.14e-12	NA	6.87e-09
3. B	Q8BG40	Katanin p80 WD40 repeat-containing subunit B1	8.25e-10	NA	2.69e-20
3. B	Q42384	Protein pleiotropic regulatory locus 1	0.00e+00	NA	8.82e-19
3. B	O48716	Protein JINGUBANG	5.98e-12	NA	1.40e-15
3. B	Q9UMS4	Pre-mRNA-processing factor 19	1.11e-16	NA	8.40e-15
3. B	P16649	General transcriptional corepressor TUP1	7.08e-08	NA	1.40e-18
3. B	Q55FR9	Coatomer subunit alpha	1.21e-07	NA	3.54e-11
3. B	A1DMI8	Probable catabolite repression protein creC	8.29e-07	NA	0.005
3. B	Q8RXA7	DENN domain and WD repeat-containing protein SCD1	9.99e-08	NA	2.46e-16
3. B	O88466	Zinc finger protein 106	2.13e-05	NA	2.58e-29
3. B	Q0CJD8	Mitochondrial division protein 1	4.64e-14	NA	2.13e-16
3. B	Q13685	Angio-associated migratory cell protein	0.00e+00	NA	6.26e-12
3. B	Q9R1A8	E3 ubiquitin-protein ligase COP1	3.49e-12	NA	6.42e-07
3. B	Q04726	Transducin-like enhancer protein 3	4.25e-09	NA	6.52e-04
3. B	Q5SUS0	F-box/WD repeat-containing protein 10	1.55e-06	NA	8.36e-17
3. B	Q6PE01	U5 small nuclear ribonucleoprotein 40 kDa protein	0.00e+00	NA	1.45e-16
3. B	Q9BQ87	F-box-like/WD repeat-containing protein TBL1Y	0.00e+00	NA	8.63e-15
3. B	Q5ZJW8	Denticleless protein homolog	1.03e-06	NA	2.06e-04
3. B	Q3E906	Cell division cycle 20.5, cofactor of APC complex	5.38e-10	NA	0.001
3. B	A8XSW2	WD repeat-containing protein 48 homolog	4.50e-10	NA	9.57e-06
3. B	Q9JIT3	Transducin-like enhancer protein 3	6.18e-09	NA	7.28e-04
3. B	A4IIX9	WD repeat-containing protein 37	1.89e-15	NA	2.37e-09
3. B	A0JPH4	Sterol regulatory element-binding protein cleavage-activating protein	2.12e-06	NA	1.68e-10
3. B	O35828	Coronin-7	1.60e-06	NA	0.002
3. B	Q9SZQ5	WD repeat-containing protein VIP3	0.00e+00	NA	3.60e-07
3. B	Q4X0A9	Probable E3 ubiquitin ligase complex SCF subunit sconB	4.45e-09	NA	6.69e-26
3. B	Q8VEJ4	Notchless protein homolog 1	0.00e+00	NA	1.38e-21
3. B	Q99KP6	Pre-mRNA-processing factor 19	2.22e-16	NA	5.79e-15
3. B	C5FWH1	Nuclear distribution protein PAC1	0.00e+00	NA	5.83e-15
3. B	B4N0L0	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	7.82e-05
3. B	Q27954	Coatomer subunit alpha	1.63e-06	NA	9.27e-11
3. B	Q5RAW8	WD repeat-containing protein 48	2.67e-11	NA	3.92e-19
3. B	B5DG67	Ribosome biogenesis protein wdr12	5.87e-12	NA	9.99e-06
3. B	Q5BJQ6	Cleavage stimulation factor subunit 1	4.33e-15	NA	7.81e-05
3. B	Q5XI13	Glutamate-rich WD repeat-containing protein 1	1.89e-14	NA	0.039
3. B	P14197	WD repeat-containing protein AAC3	4.44e-16	NA	0.006
3. B	Q6GM65	Phospholipase A-2-activating protein	1.81e-07	NA	5.83e-13
3. B	A6ZMK5	Eukaryotic translation initiation factor 3 subunit I	5.55e-15	NA	8.88e-04
3. B	Q16K15	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	4.23e-06
3. B	Q7KNS3	Lissencephaly-1 homolog	0.00e+00	NA	2.11e-23
3. B	Q9FNN2	WD repeat-containing protein 26 homolog	8.38e-10	NA	7.03e-08
3. B	A2RRU4	Sterol regulatory element-binding protein cleavage-activating protein	1.18e-09	NA	8.15e-12
3. B	Q9NVX2	Notchless protein homolog 1	0.00e+00	NA	4.06e-22
3. B	Q6P1V3	WD repeat and SOCS box-containing protein 1	1.11e-16	NA	5.59e-08
3. B	Q9V3J8	Protein will die slowly	0.00e+00	NA	1.29e-27
3. B	Q6GPC6	F-box-like/WD repeat-containing protein TBL1XR1-B	0.00e+00	NA	3.52e-16
3. B	Q9FN19	WD40 repeat-containing protein HOS15	0.00e+00	NA	1.57e-15
3. B	Q6CU55	Nuclear distribution protein PAC1	0.00e+00	NA	1.22e-07
3. B	F4KB17	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3	2.82e-10	NA	1.71e-14
3. B	A7MB12	U3 small nucleolar RNA-associated protein 15 homolog	8.32e-12	NA	4.31e-13
3. B	Q6KAU8	Protein Atg16l2	5.55e-14	NA	2.18e-09
3. B	Q28YY2	WD repeat-containing protein 48 homolog	1.78e-11	NA	2.14e-18
3. B	Q6FLI3	CCR4-associated factor 4 homolog	1.17e-14	NA	2.17e-14
3. B	Q2TZG4	Polyadenylation factor subunit 2	8.26e-09	NA	1.37e-09
3. B	Q6CG48	Nuclear distribution protein PAC1	0.00e+00	NA	3.35e-16
3. B	P39946	Nuclear distribution protein PAC1	1.11e-16	NA	6.44e-10
3. B	A4RJV3	Mitochondrial division protein 1	6.47e-14	NA	8.72e-19
3. B	Q29L19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	4.13e-04
3. B	O74845	Set3 complex subunit hif2	0.00e+00	NA	0.005
3. B	P79083	Eukaryotic translation initiation factor 3 subunit I	7.77e-16	NA	4.00e-05
3. B	C4JPW9	Nuclear distribution protein PAC1-2	0.00e+00	NA	1.42e-18
3. B	Q32LP9	Coronin-2A	6.61e-07	NA	3.42e-04
3. B	Q9SZA4	Cell division cycle 20.1, cofactor of APC complex	3.66e-10	NA	2.17e-05
3. B	Q6S7B0	Transcription initiation factor TFIID subunit 5	4.70e-14	NA	2.81e-21
3. B	Q5ZMA2	Pre-mRNA-processing factor 19	1.11e-16	NA	4.40e-14
3. B	Q1JQD2	Glutamate-rich WD repeat-containing protein 1	2.02e-10	NA	0.013
3. B	Q54IY5	Component of gems protein 5	1.98e-05	NA	0.002
3. B	Q99LL5	Periodic tryptophan protein 1 homolog	2.76e-10	NA	0.001
3. B	C4Q0P6	Lissencephaly-1 homolog	0.00e+00	NA	9.58e-30
3. B	Q8TEQ6	Gem-associated protein 5	4.26e-06	NA	0.002
3. B	A5DWF4	Ribosome biogenesis protein ERB1	2.62e-06	NA	0.006
3. B	O22212	U4/U6 small nuclear ribonucleoprotein PRP4-like protein	8.51e-12	NA	5.79e-14
3. B	A1CF18	Nuclear distribution protein nudF 2	9.99e-16	NA	1.04e-16
3. B	Q6Q0C0	E3 ubiquitin-protein ligase TRAF7	3.44e-14	NA	1.02e-25
3. B	Q562E7	WD repeat-containing protein 81	9.40e-06	NA	0.012
3. B	U4PCM1	pre-mRNA 3' end processing protein pfs-2	1.36e-07	NA	7.58e-21
3. B	O95170	CMT1A duplicated region transcript 1 protein	1.11e-09	NA	1.39e-15
3. B	B0X2V9	WD repeat-containing protein 48 homolog	4.54e-11	NA	9.44e-15
3. B	Q8K4P0	pre-mRNA 3' end processing protein WDR33	1.71e-04	NA	3.19e-11
3. B	B4MU54	Ribosome biogenesis protein WDR12 homolog	2.37e-12	NA	5.86e-08
3. B	Q6GQT6	Sterol regulatory element-binding protein cleavage-activating protein	1.13e-09	NA	7.45e-12
3. B	Q9Y263	Phospholipase A-2-activating protein	3.75e-09	NA	4.92e-12
3. B	Q4V837	Denticleless protein homolog A	1.59e-08	NA	3.68e-06
3. B	Q58D20	Notchless protein homolog 1	0.00e+00	NA	7.34e-21
3. B	Q09731	UBP9-binding protein bun107	1.70e-07	NA	7.35e-13
3. B	O88342	WD repeat-containing protein 1	2.38e-13	NA	0.002
3. B	Q5ND34	WD repeat-containing protein 81	9.01e-06	NA	0.001
3. B	Q0CY32	Probable E3 ubiquitin ligase complex SCF subunit sconB	7.41e-10	NA	2.84e-24
3. B	Q8C092	Transcription initiation factor TFIID subunit 5	2.13e-12	NA	8.25e-25
3. B	Q9GZS3	WD repeat-containing protein 61	0.00e+00	NA	8.69e-08
3. B	Q6CU59	Ribosome biogenesis protein YTM1	0.00e+00	NA	3.56e-05
3. B	Q9URY0	Ribosome biogenesis protein ytm1	5.11e-12	NA	2.24e-04
3. B	Q922V4	Pleiotropic regulator 1	5.18e-13	NA	1.51e-21
3. B	Q12834	Cell division cycle protein 20 homolog	4.77e-12	NA	2.80e-05
3. B	B0XQ42	Ribosome biogenesis protein erb1	1.12e-10	NA	0.024
3. B	Q6GPU3	Denticleless protein homolog B	3.26e-07	NA	1.42e-05
3. B	Q9FLX9	Notchless protein homolog	0.00e+00	NA	8.15e-21
3. B	Q5ZIU8	Katanin p80 WD40 repeat-containing subunit B1	1.03e-09	NA	8.89e-17
3. B	Q75LV5	U3 snoRNP-associated protein-like YAOH	2.89e-14	NA	1.19e-06
3. B	Q13112	Chromatin assembly factor 1 subunit B	9.72e-10	NA	1.87e-05
3. B	Q2UPK0	Ribosome biogenesis protein erb1	7.84e-11	NA	0.035
3. B	P93107	Flagellar WD repeat-containing protein Pf20	1.11e-16	NA	2.53e-14
3. B	Q8BX09	Retinoblastoma-binding protein 5	2.74e-10	NA	5.26e-04
3. B	A6R3K5	Ribosome biogenesis protein YTM1	2.69e-11	NA	1.13e-04
3. B	Q6ZQA0	Neurobeachin-like protein 2	NA	NA	0.026
3. B	Q04724	Transducin-like enhancer protein 1	4.20e-09	NA	2.12e-05
3. B	Q7T394	Lissencephaly-1 homolog A	0.00e+00	NA	4.28e-28
3. B	Q40153	LEC14B protein	9.42e-11	NA	0.005
3. B	Q7ZXK9	Notchless protein homolog 1	0.00e+00	NA	8.63e-19
3. B	Q5RAC9	Autophagy-related protein 16-1	1.79e-13	NA	1.11e-05
3. B	D3Z902	F-box/WD repeat-containing protein 7	0.00e+00	NA	1.46e-40
3. B	O08653	Telomerase protein component 1	1.44e-03	NA	3.71e-11
3. B	Q9NDC9	Lissencephaly-1 homolog	0.00e+00	NA	7.19e-28
3. B	Q59WJ4	Polyadenylation factor subunit 2	9.05e-12	NA	6.92e-12
3. B	Q59VP7	Ribosome biogenesis protein ERB1	2.10e-06	NA	0.029
3. B	Q5RDY7	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	NA	5.94e-13
3. B	Q09715	Transcriptional repressor tup11	3.44e-15	NA	9.37e-27
3. B	Q1HPW4	Eukaryotic translation initiation factor 3 subunit I	4.88e-15	NA	2.84e-04
3. B	Q5H7C0	Cell division cycle protein 20 homolog	4.72e-12	NA	4.31e-05
3. B	Q7S8R5	Mitochondrial division protein 1	6.41e-14	NA	7.89e-19
3. B	Q9LV27	Target of rapamycin complex subunit LST8-1	0.00e+00	NA	2.77e-15
3. B	Q9FND4	WD repeat-containing protein WDS homolog	1.19e-10	NA	4.62e-07
3. B	B4MY65	Lissencephaly-1 homolog	0.00e+00	NA	1.40e-22
3. B	Q6PBY0	Guanine nucleotide-binding protein subunit beta-5b	0.00e+00	NA	1.08e-11
3. B	A9V790	Lissencephaly-1 homolog	0.00e+00	NA	2.16e-25
3. B	Q5FWQ6	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	3.20e-35
3. B	Q7SZM9	F-box-like/WD repeat-containing protein TBL1XR1-A	0.00e+00	NA	3.53e-16
3. B	Q08122	Transducin-like enhancer protein 3	4.43e-09	NA	6.57e-04
3. B	C5JD40	Nuclear distribution protein PAC1	2.89e-12	NA	1.54e-19
3. B	Q91WM3	U3 small nucleolar RNA-interacting protein 2	2.22e-16	NA	5.83e-16
3. B	Q62441	Transducin-like enhancer protein 4	4.35e-09	NA	3.82e-06
3. B	Q9LTJ6	WD repeat-containing protein RUP1	7.77e-13	NA	0.045
3. B	B4Q354	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.35e-05
3. B	Q4P553	Histone acetyltransferase type B subunit 2	5.53e-11	NA	1.18e-04
3. B	Q5RCG7	Angio-associated migratory cell protein	0.00e+00	NA	5.83e-12
3. B	Q9AV81	Pre-mRNA-processing factor 19	5.66e-15	NA	3.25e-09
3. B	Q5AZX0	Polyadenylation factor subunit 2	4.98e-13	NA	1.12e-08
3. B	Q5REE0	U3 small nucleolar RNA-associated protein 15 homolog	4.37e-10	NA	1.59e-12
3. B	P46680	Actin-interacting protein 1	1.05e-12	NA	0.018
3. B	P87053	F-box/WD repeat-containing protein pof1	7.72e-12	NA	3.70e-27
3. B	Q8C4J7	Transducin beta-like protein 3	5.65e-10	NA	1.24e-14
3. B	Q8BHB4	WD repeat-containing protein 3	4.63e-09	NA	3.18e-14
3. B	Q4WT34	Pre-mRNA-splicing factor prp46	0.00e+00	NA	6.19e-22
3. B	Q9JJ66	Cell division cycle protein 20 homolog	5.46e-12	NA	6.87e-05
3. B	O13166	Transducin-like enhancer protein 3-A	3.55e-09	NA	3.98e-04
3. B	Q20636	Guanine nucleotide-binding protein subunit beta-2	0.00e+00	NA	5.34e-13
3. B	Q2HJH6	U5 small nuclear ribonucleoprotein 40 kDa protein	0.00e+00	NA	9.22e-17
3. B	A0A2R8QFQ6	F-box and WD repeat domain-containing 11-A	4.19e-12	NA	2.28e-29
3. B	Q9GL51	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	1.46e-27
3. B	Q0DYP5	Zinc finger CCCH domain-containing protein 17	1.11e-16	NA	1.41e-12
3. B	Q9ZU34	Actin-interacting protein 1-1	2.79e-12	NA	7.27e-06
3. B	P38129	Transcription initiation factor TFIID subunit 5	2.02e-12	NA	1.98e-21
3. B	C6HTE8	Nuclear distribution protein PAC1	0.00e+00	NA	3.00e-21
3. B	P27133	Coronin-A	6.92e-09	NA	0.002
3. B	Q7S7L4	Nuclear distribution protein nudF-1	3.38e-12	NA	1.02e-13
3. B	P0CY34	Transcriptional repressor TUP1	1.11e-16	NA	4.07e-17
3. B	B0XTS1	Probable E3 ubiquitin ligase complex SCF subunit sconB	5.05e-09	NA	6.69e-26
3. B	Q8CGF6	WD repeat-containing protein 47	1.57e-10	NA	2.17e-08
3. B	Q6S003	Kinesin-related protein 8	8.59e-04	NA	3.47e-05
3. B	P0CS42	Nuclear distribution protein PAC1	0.00e+00	NA	3.80e-32
3. B	B3MVL6	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	5.37e-05
3. B	O14053	U3 small nucleolar RNA-associated protein 21 homolog	1.27e-09	NA	6.54e-05
3. B	Q4WTI3	Ribosome biogenesis protein erb1	1.10e-10	NA	0.024
3. B	Q5F201	Cilia- and flagella-associated protein 52	2.44e-12	NA	9.83e-08
3. B	Q5NVD0	U4/U6 small nuclear ribonucleoprotein Prp4	1.11e-16	NA	5.47e-17
3. B	Q05946	U3 small nucleolar RNA-associated protein 13	1.43e-10	NA	1.86e-17
3. B	A0A1P8AW69	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1	7.63e-09	NA	1.48e-20
3. B	Q66J51	Eukaryotic translation initiation factor 3 subunit I	2.22e-16	NA	2.90e-07
3. B	P93471	E3 ubiquitin-protein ligase COP1	4.13e-13	NA	6.22e-06
3. B	Q6CBI8	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	0.002
3. B	Q803D2	Lissencephaly-1 homolog B	0.00e+00	NA	3.98e-29
3. B	E9Q4P1	WD repeat and FYVE domain-containing protein 1	3.60e-10	NA	9.59e-05
3. B	Q9UNX4	WD repeat-containing protein 3	4.01e-09	NA	4.25e-14
3. B	Q54WA3	Peroxisomal targeting signal 2 receptor	0.00e+00	NA	1.15e-08
3. B	Q9AUR8	Coatomer subunit alpha-1	1.58e-06	NA	5.95e-12
3. B	A6H603	NACHT domain- and WD repeat-containing protein 1	7.09e-05	NA	7.59e-06
3. B	D4A929	WD repeat-containing protein 81	1.04e-05	NA	0.002
3. B	Q8IV35	WD repeat-containing protein 49	1.39e-07	NA	6.59e-05
3. B	Q9QXL1	Kinesin-like protein KIF21B	1.70e-05	NA	2.73e-14
3. B	P40968	Pre-mRNA-processing factor 17	2.33e-15	NA	2.37e-05
3. B	Q2KIY3	WD repeat and FYVE domain-containing protein 1	6.24e-10	NA	8.71e-05
3. B	Q12024	Ribosome biogenesis protein YTM1	1.11e-16	NA	5.91e-05
3. B	A8PD13	Ribosome biogenesis protein YTM1	1.87e-11	NA	0.019
3. B	Q3U3T8	WD repeat-containing protein 62	2.08e-05	NA	0.001
3. B	Q4R8E7	Dynein assembly factor with WDR repeat domains 1	0.00e+00	NA	8.89e-38
3. B	A7RM20	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.035
3. B	A1CQI9	Ribosome biogenesis protein erb1	1.27e-10	NA	0.046
3. B	F1M5N7	Kinesin-like protein KIF21B	1.81e-05	NA	2.27e-14
3. B	F6ZT52	POC1 centriolar protein homolog B	1.07e-09	NA	9.62e-22
3. B	Q9XF57	Peroxisome biogenesis protein 7	0.00e+00	NA	6.85e-05
3. B	Q9S7I8	Cell division cycle 20.2, cofactor of APC complex	3.67e-10	NA	2.45e-05
3. B	Q76B40	WD40 repeat-containing protein SMU1	4.60e-11	NA	7.44e-20
3. B	Q9BRP4	Proteasomal ATPase-associated factor 1	6.24e-14	NA	1.08e-12
3. B	Q9LJR3	Protein SPA1-RELATED 3	3.05e-11	NA	1.66e-06
3. B	Q8C0J2	Autophagy-related protein 16-1	3.73e-14	NA	7.91e-06
3. B	P35605	Coatomer subunit beta'	7.26e-08	NA	1.48e-17
3. B	Q5B4R1	Ribosome biogenesis protein ytm1	5.90e-11	NA	0.036
3. B	Q9VZF4	F-box/WD repeat-containing protein 7	1.89e-15	NA	8.70e-38
3. B	A2AHJ4	Bromodomain and WD repeat-containing protein 3	2.96e-06	NA	5.62e-13
3. B	B7FNU7	Lissencephaly-1 homolog	1.40e-13	NA	5.03e-25
3. B	B3NSK1	WD repeat-containing protein 48 homolog	1.92e-11	NA	9.10e-18
3. B	Q7ZVF0	POC1 centriolar protein homolog A	1.25e-11	NA	2.33e-19
3. B	Q8H0T9	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4	4.03e-10	NA	1.16e-15
3. B	Q6BVZ3	Polyadenylation factor subunit 2	4.16e-12	NA	6.45e-15
3. B	Q5XUX1	F-box/WD repeat-containing protein 9	1.11e-15	NA	6.97e-05
3. B	Q55E58	Probable serine/threonine-protein kinase pats1	NA	NA	0.014
3. B	B6QC56	Nuclear distribution protein nudF 1	0.00e+00	NA	1.99e-14
3. B	C4YPI7	Nuclear distribution protein PAC1	2.22e-16	NA	8.09e-10
3. B	Q4V7Y7	Katanin p80 WD40 repeat-containing subunit B1	1.63e-08	NA	3.52e-19
3. B	A8XZJ9	Lissencephaly-1 homolog	1.97e-13	NA	9.11e-27
3. B	Q9P4R5	Catabolite repression protein creC	1.13e-08	NA	5.86e-04
3. B	B4HND9	WD repeat-containing protein 48 homolog	1.86e-11	NA	1.40e-17
3. B	Q2T9T9	F-box/WD repeat-containing protein 9	1.33e-15	NA	2.40e-07
3. B	D3BUN1	Lissencephaly-1 homolog	0.00e+00	NA	3.15e-28
3. B	Q8BHJ5	F-box-like/WD repeat-containing protein TBL1XR1	0.00e+00	NA	5.13e-16
3. B	Q922B6	E3 ubiquitin-protein ligase TRAF7	3.33e-15	NA	5.77e-26
3. B	Q4ICM0	Nuclear distribution protein PAC1	0.00e+00	NA	4.84e-15
3. B	Q0D0X6	Nuclear distribution protein nudF	0.00e+00	NA	1.43e-20
3. B	B2AEZ5	Nuclear distribution protein PAC1-1	0.00e+00	NA	2.06e-16
3. B	Q5B8Y3	Eukaryotic translation initiation factor 3 subunit I	1.11e-15	NA	4.25e-04
3. B	Q9FNZ1	Zinc finger CCCH domain-containing protein 63	1.11e-16	NA	1.31e-13
3. B	Q6DIF4	WD repeat-containing protein 1	6.80e-13	NA	3.11e-05
3. B	O02195	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.31e-05
3. B	Q9NZJ0	Denticleless protein homolog	3.84e-08	NA	0.001
3. B	Q99LC2	Cleavage stimulation factor subunit 1	4.44e-15	NA	7.81e-05
3. B	A5DST9	Ribosome biogenesis protein YTM1	1.95e-11	NA	0.003
3. B	A0A1L8HX76	WD repeat-containing protein 18	2.26e-11	NA	5.52e-08
3. B	Q6ZD63	Chromatin assembly factor 1 subunit FAS2 homolog	9.35e-09	NA	0.010
3. B	O02482	Transcription factor unc-37	8.20e-14	NA	0.012
3. B	B4GIJ0	WD repeat-containing protein 48 homolog	1.81e-11	NA	2.14e-18
3. B	Q5FVN8	WD repeat, SAM and U-box domain-containing protein 1	9.69e-12	NA	2.25e-05
3. B	A6RRD4	Ribosome biogenesis protein erb1	3.62e-11	NA	0.017
3. B	Q54SF9	Myosin heavy chain kinase D	8.47e-12	NA	5.94e-17
3. B	Q1DJF7	Ribosome biogenesis protein YTM1	2.22e-16	NA	3.37e-08
3. B	G5EES6	Ubiquitin fusion degradation protein 3 homolog	1.05e-06	NA	7.49e-08
3. B	Q291L9	Lissencephaly-1 homolog	0.00e+00	NA	4.04e-23
3. B	Q96WV5	Putative coatomer subunit alpha	5.35e-07	NA	1.07e-11
3. B	Q5RF51	U5 small nuclear ribonucleoprotein 40 kDa protein	0.00e+00	NA	1.04e-15
3. B	Q5F3D7	U3 small nucleolar RNA-associated protein 15 homolog	8.24e-10	NA	1.43e-10
3. B	Q68FJ6	p21-activated protein kinase-interacting protein 1-like	7.96e-12	NA	5.78e-11
3. B	A7ECP3	Ribosome biogenesis protein ytm1	6.75e-11	NA	0.022
3. B	Q6DJD8	Coronin-2B	2.34e-08	NA	0.001
3. B	P63004	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	NA	6.70e-28
3. B	G5EEG7	Smu-1 suppressor of mec-8 and unc-52 protein	1.44e-15	NA	2.42e-11
3. B	P90587	66 kDa stress protein	9.19e-13	NA	4.41e-04
3. B	Q8MY12	Myosin heavy chain kinase C	1.64e-12	NA	8.12e-22
3. B	Q2GT28	Nuclear distribution protein PAC1-2	0.00e+00	NA	3.81e-19
3. B	A7EF03	Eukaryotic translation initiation factor 3 subunit I	9.99e-16	NA	1.04e-05
3. B	P97499	Telomerase protein component 1	6.61e-05	NA	1.15e-11
3. B	Q2HJ56	Periodic tryptophan protein 1 homolog	1.65e-10	NA	0.013
3. B	Q94BR4	Pre-mRNA-processing factor 19 homolog 1	6.44e-15	NA	3.79e-08
3. B	A7TMF9	Ribosome biogenesis protein YTM1	6.12e-12	NA	7.82e-06
3. B	B4QB64	WD repeat-containing protein 48 homolog	1.47e-11	NA	1.36e-17
3. B	Q55BM1	Probable inactive protein kinase DDB_G0270444	2.22e-05	NA	6.19e-06
3. B	B5X3C4	Lissencephaly-1 homolog B	0.00e+00	NA	1.84e-26
3. B	B2ZZS9	WD repeat-containing protein 55	8.36e-13	NA	1.18e-04
3. B	Q6NRT3	WD40 repeat-containing protein SMU1	2.11e-15	NA	7.87e-20
3. B	O43818	U3 small nucleolar RNA-interacting protein 2	1.11e-16	NA	8.72e-16
3. B	Q96JK2	DDB1- and CUL4-associated factor 5	7.22e-05	NA	0.027
3. B	E9Q349	WD repeat-containing protein 25	1.19e-11	NA	0.002
3. B	B8M0Q1	Nuclear distribution protein nudF	0.00e+00	NA	1.25e-13
3. B	Q10051	Pre-mRNA-processing factor 19	1.11e-16	NA	1.06e-12
3. B	Q2KJJ5	Transducin beta-like protein 3	5.76e-10	NA	9.04e-15
3. B	Q10272	Pre-rRNA-processing protein crb3/ipi3	1.47e-10	NA	4.63e-06
3. B	Q9LF27	Ribosome biogenesis protein WDR12 homolog	1.98e-11	NA	1.51e-07
3. B	O74340	Protein sof1	2.22e-16	NA	2.93e-04
3. B	Q9UT73	Uncharacterized WD repeat-containing protein C343.17c	1.71e-09	NA	0.001
3. B	Q2KID6	Pleiotropic regulator 1	3.23e-13	NA	2.50e-21
3. B	C5PFX0	Nuclear distribution protein PAC1	1.13e-12	NA	4.45e-16
3. B	O14435	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	7.15e-14
3. B	Q99M63	WD40 repeat-containing protein SMU1	1.89e-15	NA	7.95e-20
3. B	P53196	26S proteasome regulatory subunit RPN14	2.63e-12	NA	1.19e-04
3. B	Q6NX08	Ribosome biogenesis protein wdr12	2.92e-12	NA	2.29e-08
3. B	Q9BVA0	Katanin p80 WD40 repeat-containing subunit B1	1.08e-09	NA	2.54e-20
3. B	P87141	Target of rapamycin complex 1 subunit mip1	9.88e-08	NA	3.30e-04
3. B	O43660	Pleiotropic regulator 1	3.80e-13	NA	3.21e-21
3. B	B3S4I5	Lissencephaly-1 homolog	0.00e+00	NA	2.34e-27
3. B	Q8NA75	DDB1- and CUL4-associated factor 4-like protein 2	1.67e-14	NA	0.037
3. B	Q4P9P9	Nuclear distribution protein PAC1	0.00e+00	NA	2.65e-25
3. B	B4LQ21	Lissencephaly-1 homolog	0.00e+00	NA	1.89e-23
3. B	Q9FKR9	Zinc finger CCCH domain-containing protein 59	1.33e-15	NA	8.61e-13
3. B	Q5XJS5	THO complex subunit 6 homolog	0.00e+00	NA	6.57e-04
3. B	Q9D0N7	Chromatin assembly factor 1 subunit B	1.96e-09	NA	2.82e-04
3. B	Q9UUG8	Transcriptional repressor tup12	2.89e-15	NA	9.18e-20
3. B	B4JPT9	Ribosome biogenesis protein WDR12 homolog	2.15e-12	NA	6.53e-08
3. B	P53621	Coatomer subunit alpha	1.27e-06	NA	1.30e-10
3. B	B4MFM2	WD repeat-containing protein 48 homolog	1.34e-11	NA	4.82e-18
3. B	Q9USN3	Probable U3 small nucleolar RNA-associated protein 13	3.19e-11	NA	3.86e-20
3. B	Q32SG6	Protein HIRA	1.16e-06	NA	0.005
3. B	Q91854	Beta-TrCP	0.00e+00	NA	1.82e-29
3. B	P78798	Peroxisomal targeting signal 2 receptor	0.00e+00	NA	0.002
3. B	Q7ZVL2	GATOR complex protein WDR24	2.45e-07	NA	0.002
3. B	Q6P4J8	WD40 repeat-containing protein SMU1	1.89e-15	NA	4.59e-20
3. B	Q96MR6	Cilia- and flagella-associated protein 57	9.15e-06	NA	0.042
3. B	Q74ZN0	Protein HIR1	1.11e-07	NA	0.010
3. B	Q5VQ78	Coatomer subunit beta'-1	4.63e-08	NA	6.52e-16
3. B	A6NE52	WD repeat-containing protein 97	4.64e-04	NA	0.021
3. B	A3LQ86	Ribosome biogenesis protein YTM1	8.06e-12	NA	5.13e-05
3. B	Q15269	Periodic tryptophan protein 2 homolog	2.99e-08	NA	5.30e-11
3. B	Q54S79	WD repeat-containing protein 3 homolog	1.92e-09	NA	4.71e-12
3. B	Q54PE0	Periodic tryptophan protein 2 homolog	8.05e-09	NA	1.88e-10
3. B	B4HSL3	Lissencephaly-1 homolog	0.00e+00	NA	2.11e-23
3. B	Q803X4	DDB1- and CUL4-associated factor 13	4.44e-16	NA	0.006
3. B	Q09855	F-box/WD repeat-containing protein pof11	5.68e-13	NA	1.09e-24
3. B	O13615	Pre-mRNA-splicing factor prp5	0.00e+00	NA	7.10e-18
3. B	Q9FUY2	Transcriptional corepressor LEUNIG	2.55e-10	NA	9.08e-10
3. B	A6ZYM0	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	4.21e-05
3. B	Q60584	F-box/WD repeat-containing protein 2	1.15e-14	NA	8.30e-14
3. B	P42841	Polyadenylation factor subunit 2	1.30e-12	NA	7.41e-12
3. B	Q00659	Probable E3 ubiquitin ligase complex SCF subunit sconB	2.53e-09	NA	7.23e-26
3. B	D4AZ50	Nuclear distribution protein PAC1	0.00e+00	NA	3.61e-13
3. B	Q9ERF3	WD repeat-containing protein 61	0.00e+00	NA	8.08e-08
3. B	Q5R650	WD repeat-containing protein 37	5.15e-12	NA	4.52e-09
3. B	B4P116	Ribosome biogenesis protein WDR12 homolog	2.39e-12	NA	4.46e-08
3. B	Q6NVM2	Katanin p80 WD40 repeat-containing subunit B1	6.39e-10	NA	2.03e-19
3. B	Q5BDJ5	Probable cytosolic iron-sulfur protein assembly protein 1	2.22e-16	NA	0.035
3. B	P40042	Regulator of rDNA transcription protein 13	2.17e-13	NA	8.67e-05
3. B	Q7QJ33	Ribosome biogenesis protein WDR12 homolog	6.37e-12	NA	3.42e-06
3. B	Q4WN25	Probable catabolite repression protein creC	3.56e-06	NA	0.001
3. B	Q9BQ67	Glutamate-rich WD repeat-containing protein 1	1.91e-14	NA	0.014
3. B	Q6C4I9	Ribosome biogenesis protein ERB1	1.67e-06	NA	0.017
3. B	Q54ED4	Glutamate-rich WD repeat-containing protein 1	1.61e-08	NA	0.009
3. B	P59328	WD repeat and HMG-box DNA-binding protein 1	9.89e-06	NA	3.05e-04
3. B	Q9C0J8	pre-mRNA 3' end processing protein WDR33	2.02e-04	NA	1.87e-11
3. B	D3TLL6	Lissencephaly-1 homolog	0.00e+00	NA	1.45e-26
3. B	A1CUD6	Nuclear distribution protein nudF 1	0.00e+00	NA	3.54e-17
3. B	A8ILK1	Cilia- and flagella-associated protein 52	4.23e-12	NA	0.001
3. B	Q0CKB1	Probable catabolite repression protein creC	2.41e-06	NA	0.002
3. B	O94967	WD repeat-containing protein 47	1.76e-10	NA	3.08e-08
3. B	Q15291	Retinoblastoma-binding protein 5	3.34e-07	NA	4.78e-04
3. B	P20053	U4/U6 small nuclear ribonucleoprotein PRP4	0.00e+00	NA	1.00e-09
3. B	Q55DM1	BEACH domain-containing protein lvsA	NA	NA	4.82e-04
3. B	Q5SRY7	F-box/WD repeat-containing protein 11	1.11e-16	NA	3.28e-29
3. B	B3N4C7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	4.67e-05
3. B	Q9VPR4	Protein Notchless	0.00e+00	NA	3.62e-21
3. B	B7PS00	Lissencephaly-1 homolog	0.00e+00	NA	9.03e-26
3. B	Q7ZUV2	Katanin p80 WD40 repeat-containing subunit B1	3.09e-11	NA	2.34e-19
3. B	Q4PSE4	Cell division cycle 20.4, cofactor of APC complex	5.73e-10	NA	1.37e-04
3. B	B4JB43	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.60e-04
3. B	Q93794	F-box/WD repeat-containing protein sel-10	0.00e+00	NA	1.35e-34
3. B	Q05BV3	Echinoderm microtubule-associated protein-like 5	1.55e-05	NA	0.025
3. B	Q8NAA4	Protein Atg16l2	1.33e-13	NA	1.69e-08
3. B	O15736	Protein tipD	3.97e-14	NA	1.12e-11
3. B	P73595	Uncharacterized WD repeat-containing protein slr1410	4.36e-13	NA	9.05e-10
3. B	Q9JJA4	Ribosome biogenesis protein WDR12	3.41e-12	NA	1.09e-11
3. B	Q00664	Nuclear distribution protein nudF	0.00e+00	NA	2.35e-17
3. B	Q4RJN5	Lissencephaly-1 homolog	0.00e+00	NA	5.54e-29
3. B	A1CH75	Ribosome biogenesis protein ytm1	5.98e-11	NA	5.26e-06