Summary

Q86TZ1

Homolog: O15294.
Function: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit.

Statistics

Total GO Annotation: 291
Unique PROST Go: 65
Unique BLAST Go: 216

Total Homologs: 239
Unique PROST Homologs: 63
Unique BLAST Homologs: 174

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was O15294 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit) with a FATCAT P-Value: 0.0 and RMSD of 2.92 angstrom. The sequence alignment identity is 14.8%.
Structural alignment shown in left. Query protein Q86TZ1 colored as red in alignment, homolog O15294 colored as blue. Query protein Q86TZ1 is also shown in right top, homolog O15294 showed in right bottom. They are colored based on secondary structures. 

  Q86TZ1 MMKYYDLAKFTIYQIAE-------M--DKGLSELSPMQ-QALIYSFCENHDKAIEVLDGISW-NRAEMT-MCALLAKVQMKAKRTKEAVEVLKKALDAIS 88
  O15294 ------MAS-SVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERH--CMQL-----WRQEPDNTGVLLLLSSIHFQCRR-----------LDRSA 75

  Q86TZ1 HSD----K-GPDATAISADCLYNLGLCYMEEGNLQMT---YKLAI---TD-------LTTAI----SMD--KNSY-TAF-YN--------------RAL- 147
  O15294 HFSTLAIKQNP----LLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALG 171

  Q86TZ1 -------CYTKIRELQ--MAL--TDYGIV--------LLLDATE---TVKLNTFLNRGLIYVELGQYGFALED---FKQA------AL-ISRTNGSLCHA 215
  O15294 RLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPN-FLD---AYINLGN---VLKEARIFDRAVAAYLRALSLS-PNHAVVHG 263

  Q86TZ1 TAMC-HHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYG------------------H-DE----AT-KQAQ---KDFL----KALHINPAYIKA 283
  O15294 NLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAA 363

  Q86TZ1 RISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYL-AYEGRAVVCLQMGNNFAAMQDINAAMKISTTA-----EFL---TNRGVIHEFMGHKQNAMKDYQDA 374
  O15294 HSNLASVLQQQGKLQEALMHYKEAIRISP-TFADAYS-------NMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTA 455

  Q86TZ1 ITLNPKYSLAYFNAG---NIY-----FHHRQ---FSQASDYFSK-AL-KFDPENE--YVL---MNRAIT----N------TILKK--YEEAKE------- 437
  O15294 LKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGR 555

  Q86TZ1 --------DFAN-----VIESCPFWAAVYFNRAHF-YYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDLEDYASVI--- 520
  O15294 LRVGYVSSDFGNHPTSHLMQSIP---GMH-NPDKFEVFC---Y---------ALS--PDDGT--NFRVKV----------MAEANHFIDL----SQIPCN 621

  Q86TZ1 ---------------------------------------------------------------------------------------------------- 520
  O15294 GKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVI 721

  Q86TZ1 ---------------------------------------------------------------------------------------------------- 520
  O15294 DFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGE 821

  Q86TZ1 ---------------------------------------------------------------------------------------------------- 520
  O15294 EVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVC 921

  Q86TZ1 ---------------------------------------------------------------------------------------------------- 520
  O15294 LDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYL 1021

  Q86TZ1 ------------------------- 520
  O15294 QMWEHYAAGNKPDHMIKPVEVTESA 1046

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0016567 protein ubiquitination
1. PB GO:0005819 spindle
1. PB GO:0070979 protein K11-linked ubiquitination
1. PB GO:0051301 cell division
1. PB GO:0005829 cytosol
1. PB GO:0031145 anaphase-promoting complex-dependent catabolic process
1. PB GO:0019903 protein phosphatase binding
1. PB GO:0045842 positive regulation of mitotic metaphase/anaphase transition
1. PB GO:0005680 anaphase-promoting complex
1. PB GO:0007091 metaphase/anaphase transition of mitotic cell cycle
2. P GO:0140374 antiviral innate immune response
2. P GO:0071360 cellular response to exogenous dsRNA
2. P GO:0030659 cytoplasmic vesicle membrane
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0031347 regulation of defense response
2. P GO:0005874 microtubule
2. P GO:0035458 cellular response to interferon-beta
2. P GO:0006886 intracellular protein transport
2. P GO:0010087 phloem or xylem histogenesis
2. P GO:0050688 regulation of defense response to virus
2. P GO:0010154 fruit development
2. P GO:0000159 protein phosphatase type 2A complex
2. P GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
2. P GO:0000963 mitochondrial RNA processing
2. P GO:0032091 negative regulation of protein binding
2. P GO:0048367 shoot system development
2. P GO:0080156 mitochondrial mRNA modification
2. P GO:0061509 asymmetric protein localization to old mitotic spindle pole body
2. P GO:0009793 embryo development ending in seed dormancy
2. P GO:0051097 negative regulation of helicase activity
2. P GO:0010239 chloroplast mRNA processing
2. P GO:0043248 proteasome assembly
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0019888 protein phosphatase regulator activity
2. P GO:0007052 mitotic spindle organization
2. P GO:0030952 establishment or maintenance of cytoskeleton polarity
2. P GO:0007405 neuroblast proliferation
2. P GO:0045070 positive regulation of viral genome replication
2. P GO:1990756 ubiquitin ligase-substrate adaptor activity
2. P GO:1990813 meiotic centromeric cohesion protection
2. P GO:0031030 negative regulation of septation initiation signaling
2. P GO:0007096 regulation of exit from mitosis
2. P GO:0044732 mitotic spindle pole body
2. P GO:0051607 defense response to virus
2. P GO:0071357 cellular response to type I interferon
2. P GO:0002244 hematopoietic progenitor cell differentiation
2. P GO:0045071 negative regulation of viral genome replication
2. P GO:0008637 apoptotic mitochondrial changes
2. P GO:0007420 brain development
2. P GO:0042775 mitochondrial ATP synthesis coupled electron transport
2. P GO:0000339 RNA cap binding
2. P GO:0046907 intracellular transport
2. P GO:0110085 mitotic actomyosin contractile ring
2. P GO:0000373 Group II intron splicing
2. P GO:0009737 response to abscisic acid
2. P GO:0000278 mitotic cell cycle
2. P GO:0003729 mRNA binding
2. P GO:0030071 regulation of mitotic metaphase/anaphase transition
2. P GO:0043657 host cell
2. P GO:0035457 cellular response to interferon-alpha
2. P GO:0042325 regulation of phosphorylation
2. P GO:0006470 protein dephosphorylation
2. P GO:0005739 mitochondrion
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0045087 innate immune response
2. P GO:0043240 Fanconi anaemia nuclear complex
2. P GO:0009615 response to virus
2. P GO:0005721 pericentric heterochromatin
2. P GO:0008266 poly(U) RNA binding
2. P GO:0015631 tubulin binding
2. P GO:0032875 regulation of DNA endoreduplication
2. P GO:0090443 FAR/SIN/STRIPAK complex
2. P GO:0019060 intracellular transport of viral protein in host cell
2. P GO:0022624 proteasome accessory complex
2. P GO:0031462 Cul2-RING ubiquitin ligase complex
3. B GO:0045730 respiratory burst
3. B GO:0021766 hippocampus development
3. B GO:0030837 negative regulation of actin filament polymerization
3. B GO:0016176 superoxide-generating NADPH oxidase activator activity
3. B GO:0031307 integral component of mitochondrial outer membrane
3. B GO:0097237 cellular response to toxic substance
3. B GO:0048829 root cap development
3. B GO:0032922 circadian regulation of gene expression
3. B GO:0071539 protein localization to centrosome
3. B GO:0009736 cytokinin-activated signaling pathway
3. B GO:0045862 positive regulation of proteolysis
3. B GO:0030150 protein import into mitochondrial matrix
3. B GO:0045039 protein insertion into mitochondrial inner membrane
3. B GO:0000030 mannosyltransferase activity
3. B GO:0060296 regulation of cilium beat frequency involved in ciliary motility
3. B GO:0035327
3. B GO:0030943 mitochondrion targeting sequence binding
3. B GO:0051787 misfolded protein binding
3. B GO:0046548 retinal rod cell development
3. B GO:1901800 positive regulation of proteasomal protein catabolic process
3. B GO:0015450 protein-transporting ATPase activity
3. B GO:0035020 regulation of Rac protein signal transduction
3. B GO:0061052 negative regulation of cell growth involved in cardiac muscle cell development
3. B GO:0034451 centriolar satellite
3. B GO:0061077 chaperone-mediated protein folding
3. B GO:0046686 response to cadmium ion
3. B GO:0060471 cortical granule exocytosis
3. B GO:0051131 chaperone-mediated protein complex assembly
3. B GO:0098586 cellular response to virus
3. B GO:0110146 magnetosome membrane
3. B GO:0097255 R2TP complex
3. B GO:0009100 glycoprotein metabolic process
3. B GO:0010187 negative regulation of seed germination
3. B GO:0000791 euchromatin
3. B GO:0055087 Ski complex
3. B GO:1902855 regulation of non-motile cilium assembly
3. B GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0097363 protein O-GlcNAc transferase activity
3. B GO:0004860 protein kinase inhibitor activity
3. B GO:0016175 superoxide-generating NAD(P)H oxidase activity
3. B GO:0005929 cilium
3. B GO:0120293 dynein axonemal particle
3. B GO:0005528 FK506 binding
3. B GO:0005788 endoplasmic reticulum lumen
3. B GO:0048487 beta-tubulin binding
3. B GO:0006041 glucosamine metabolic process
3. B GO:0098850 extrinsic component of synaptic vesicle membrane
3. B GO:0004722 protein serine/threonine phosphatase activity
3. B GO:0038108 negative regulation of appetite by leptin-mediated signaling pathway
3. B GO:0009740 gibberellic acid mediated signaling pathway
3. B GO:0042030 ATPase inhibitor activity
3. B GO:0060324 face development
3. B GO:0003085 negative regulation of systemic arterial blood pressure
3. B GO:0032465 regulation of cytokinesis
3. B GO:0001895 retina homeostasis
3. B GO:0010017 red or far-red light signaling pathway
3. B GO:1901918 negative regulation of exoribonuclease activity
3. B GO:0005524 ATP binding
3. B GO:1905584 outer hair cell apoptotic process
3. B GO:0060170 ciliary membrane
3. B GO:0016020 membrane
3. B GO:0098761 cellular response to interleukin-7
3. B GO:0043981 histone H4-K5 acetylation
3. B GO:0106307
3. B GO:0030674 protein-macromolecule adaptor activity
3. B GO:0006801 superoxide metabolic process
3. B GO:0071816 tail-anchored membrane protein insertion into ER membrane
3. B GO:0042588 zymogen granule
3. B GO:0002230 positive regulation of defense response to virus by host
3. B GO:0072380 TRC complex
3. B GO:0007098 centrosome cycle
3. B GO:0048854 brain morphogenesis
3. B GO:0034464 BBSome
3. B GO:1900038 negative regulation of cellular response to hypoxia
3. B GO:0035176 social behavior
3. B GO:0007346 regulation of mitotic cell cycle
3. B GO:0065003 protein-containing complex assembly
3. B GO:0030544 Hsp70 protein binding
3. B GO:0000003 reproduction
3. B GO:0006111 regulation of gluconeogenesis
3. B GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding
3. B GO:0005790 smooth endoplasmic reticulum
3. B GO:0030534 adult behavior
3. B GO:1904278 positive regulation of wax biosynthetic process
3. B GO:1903428 positive regulation of reactive oxygen species biosynthetic process
3. B GO:1903646 positive regulation of chaperone-mediated protein folding
3. B GO:0034976 response to endoplasmic reticulum stress
3. B GO:0016262 protein N-acetylglucosaminyltransferase activity
3. B GO:0005783 endoplasmic reticulum
3. B GO:0032728 positive regulation of interferon-beta production
3. B GO:0031072 heat shock protein binding
3. B GO:1904288 BAT3 complex binding
3. B GO:0009657 plastid organization
3. B GO:0000281 mitotic cytokinesis
3. B GO:1905515 non-motile cilium assembly
3. B GO:0060544 regulation of necroptotic process
3. B GO:0006986 response to unfolded protein
3. B GO:0005741 mitochondrial outer membrane
3. B GO:0090315 negative regulation of protein targeting to membrane
3. B GO:0070417 cellular response to cold
3. B GO:0016485 protein processing
3. B GO:0051492 regulation of stress fiber assembly
3. B GO:0001917 photoreceptor inner segment
3. B GO:0006493 protein O-linked glycosylation
3. B GO:0021756 striatum development
3. B GO:0051085 chaperone cofactor-dependent protein refolding
3. B GO:1903912 negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
3. B GO:0043984 histone H4-K16 acetylation
3. B GO:0006110 regulation of glycolytic process
3. B GO:0032010 phagolysosome
3. B GO:0009408 response to heat
3. B GO:0017122 protein N-acetylglucosaminyltransferase complex
3. B GO:0006742 NADP catabolic process
3. B GO:0030433 ubiquitin-dependent ERAD pathway
3. B GO:0051087 chaperone binding
3. B GO:0120162 positive regulation of cold-induced thermogenesis
3. B GO:0097730 non-motile cilium
3. B GO:1904591 positive regulation of protein import
3. B GO:1903071 positive regulation of ER-associated ubiquitin-dependent protein catabolic process
3. B GO:0016358 dendrite development
3. B GO:0010286 heat acclimation
3. B GO:0061512 protein localization to cilium
3. B GO:0042554 superoxide anion generation
3. B GO:0070286 axonemal dynein complex assembly
3. B GO:0009910 negative regulation of flower development
3. B GO:0006626 protein targeting to mitochondrion
3. B GO:1903546 protein localization to photoreceptor outer segment
3. B GO:0008022 protein C-terminus binding
3. B GO:2000377 regulation of reactive oxygen species metabolic process
3. B GO:0032868 response to insulin
3. B GO:0072686 mitotic spindle
3. B GO:0033137 negative regulation of peptidyl-serine phosphorylation
3. B GO:0031397 negative regulation of protein ubiquitination
3. B GO:0006486 protein glycosylation
3. B GO:0051457 maintenance of protein location in nucleus
3. B GO:0033365 protein localization to organelle
3. B GO:0034975 protein folding in endoplasmic reticulum
3. B GO:0035269 protein O-linked mannosylation
3. B GO:0043621 protein self-association
3. B GO:0045444 fat cell differentiation
3. B GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
3. B GO:1903070 negative regulation of ER-associated ubiquitin-dependent protein catabolic process
3. B GO:0001843 neural tube closure
3. B GO:0002218 activation of innate immune response
3. B GO:0005634 nucleus
3. B GO:0000123 histone acetyltransferase complex
3. B GO:0000242 pericentriolar material
3. B GO:1902325 negative regulation of chlorophyll biosynthetic process
3. B GO:0036064 ciliary basal body
3. B GO:0048015 phosphatidylinositol-mediated signaling
3. B GO:0045494 photoreceptor cell maintenance
3. B GO:0004169 dolichyl-phosphate-mannose-protein mannosyltransferase activity
3. B GO:0007049 cell cycle
3. B GO:0051879 Hsp90 protein binding
3. B GO:0009949 polarity specification of anterior/posterior axis
3. B GO:0031348 negative regulation of defense response
3. B GO:0110148 biomineralization
3. B GO:0043014 alpha-tubulin binding
3. B GO:0060613 fat pad development
3. B GO:0003755 peptidyl-prolyl cis-trans isomerase activity
3. B GO:0032470 positive regulation of endoplasmic reticulum calcium ion concentration
3. B GO:0040018 positive regulation of multicellular organism growth
3. B GO:0034454 microtubule anchoring at centrosome
3. B GO:0009617 response to bacterium
3. B GO:0060090 molecular adaptor activity
3. B GO:0005742 mitochondrial outer membrane translocase complex
3. B GO:0005814 centriole
3. B GO:0036494 positive regulation of translation initiation in response to endoplasmic reticulum stress
3. B GO:0010071 root meristem specification
3. B GO:0060447 bud outgrowth involved in lung branching
3. B GO:0046906 tetrapyrrole binding
3. B GO:0034452 dynactin binding
3. B GO:0031966 mitochondrial membrane
3. B GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
3. B GO:0007286 spermatid development
3. B GO:0042981 regulation of apoptotic process
3. B GO:0021591 ventricular system development
3. B GO:0080182 histone H3-K4 trimethylation
3. B GO:0060271 cilium assembly
3. B GO:0021987 cerebral cortex development
3. B GO:0032391 photoreceptor connecting cilium
3. B GO:1900182 positive regulation of protein localization to nucleus
3. B GO:0007608 sensory perception of smell
3. B GO:0031514 motile cilium
3. B GO:0030968 endoplasmic reticulum unfolded protein response
3. B GO:0005813 centrosome
3. B GO:0035845 photoreceptor cell outer segment organization
3. B GO:0034427 nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5'
3. B GO:0043020 NADPH oxidase complex
3. B GO:0032991 protein-containing complex
3. B GO:0110143 magnetosome
3. B GO:0045793 positive regulation of cell size
3. B GO:0010801 negative regulation of peptidyl-threonine phosphorylation
3. B GO:0046872 metal ion binding
3. B GO:0034260 negative regulation of GTPase activity
3. B GO:0010019 chloroplast-nucleus signaling pathway
3. B GO:0019216 regulation of lipid metabolic process
3. B GO:0048312 intracellular distribution of mitochondria
3. B GO:0070678 preprotein binding
3. B GO:0006620 posttranslational protein targeting to endoplasmic reticulum membrane
3. B GO:0051728 cell cycle switching, mitotic to meiotic cell cycle
3. B GO:1900034 regulation of cellular response to heat
3. B GO:0050893 sensory processing
3. B GO:0006469 negative regulation of protein kinase activity
3. B GO:0106306
3. B GO:0045724 positive regulation of cilium assembly
3. B GO:0009938 negative regulation of gibberellic acid mediated signaling pathway
3. B GO:0035869 ciliary transition zone
3. B GO:0045335 phagocytic vesicle
3. B GO:0061087 positive regulation of histone H3-K27 methylation
3. B GO:0097068 response to thyroxine
3. B GO:0032474 otolith morphogenesis
3. B GO:0046626 regulation of insulin receptor signaling pathway
3. B GO:0071333 cellular response to glucose stimulus
3. B GO:0101031 chaperone complex
3. B GO:0043982 histone H4-K8 acetylation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q86TZ1 Tetratricopeptide repeat protein 6 0 1.50e-140 0.0
1. PB B3DNN5 Anaphase-promoting complex subunit 6 1.49e-14 4.86e-02 8.97e-04
2. P Q9LSQ2 Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial 1.10e-08 8.32e-05 NA
2. P Q9FIT7 Pentatricopeptide repeat-containing protein At5g61990, mitochondrial 4.39e-08 2.30e-03 NA
2. P Q4R5F5 Interferon-induced protein with tetratricopeptide repeats 1 3.94e-11 2.17e-05 NA
2. P Q9D4C6 LRP2-binding protein 3.63e-07 1.98e-02 NA
2. P Q9EQR6 Fanconi anemia group G protein homolog 1.71e-08 3.55e-03 NA
2. P Q58208 TPR repeat-containing protein MJ0798 1.03e-09 6.97e-03 NA
2. P Q6IND7 LRP2-binding protein 6.46e-07 1.89e-02 NA
2. P Q92624 Amyloid protein-binding protein 2 1.96e-10 6.15e-05 NA
2. P O49436 Pentatricopeptide repeat-containing protein At4g20090 2.51e-09 2.45e-02 NA
2. P Q9UT08 Protein phosphatase PP2A regulatory subunit A 1.34e-04 3.51e-02 NA
2. P Q9T0D6 Pentatricopeptide repeat-containing protein At4g11690 1.28e-09 1.06e-03 NA
2. P P41889 Anaphase-promoting complex subunit cut9 1.17e-11 3.98e-02 NA
2. P Q4V8C3 Echinoderm microtubule-associated protein-like 1 9.05e-01 2.41e-02 NA
2. P A5HK05 Amyloid protein-binding protein 2 2.37e-07 3.16e-05 NA
2. P Q569C2 LRP2-binding protein 2.27e-06 6.04e-03 NA
2. P Q5TAA0 Tetratricopeptide repeat protein 22 1.84e-08 6.56e-04 NA
2. P A1A4R8 Cell division cycle protein 23 homolog 5.69e-13 4.10e-03 NA
2. P O83133 TPR repeat-containing protein TP_0095 8.46e-12 1.69e-02 NA
2. P Q9LSK8 Pentatricopeptide repeat-containing protein At3g18020 2.71e-08 5.18e-03 NA
2. P Q5T764 Interferon-induced protein with tetratricopeptide repeats 1B 1.54e-11 1.68e-06 NA
2. P B8Y6I0 Pentatricopeptide repeat-containing protein 10, chloroplastic 5.52e-08 6.97e-03 NA
2. P Q9STS3 Anaphase-promoting complex subunit 8 7.06e-13 1.76e-02 NA
2. P O22714 Pentatricopeptide repeat-containing protein At1g60770 4.07e-09 2.30e-02 NA
2. P P0C8Q3 Pentatricopeptide repeat-containing protein At4g19890 4.75e-11 9.73e-03 NA
2. P Q6NQ83 Pentatricopeptide repeat-containing protein At3g22470, mitochondrial 2.48e-10 2.89e-02 NA
2. P Q3EDA9 Putative pentatricopeptide repeat-containing protein At1g16830 1.05e-09 4.77e-02 NA
2. P Q9MAG8 Putative pentatricopeptide repeat-containing protein At1g53330 1.94e-09 2.38e-04 NA
2. P Q9WVM3 Anaphase-promoting complex subunit 7 1.11e-16 1.07e-02 NA
2. P Q4R3N2 LRP2-binding protein 6.43e-07 3.15e-03 NA
2. P P54389 TPR repeat-containing protein YpiA 7.44e-15 1.70e-04 NA
2. P A5PLI4 LRP2-binding protein 1.53e-05 1.91e-02 NA
2. P Q9ZVX5 Pentatricopeptide repeat-containing protein At2g16880 9.48e-09 8.77e-03 NA
2. P Q13325 Interferon-induced protein with tetratricopeptide repeats 5 3.00e-13 2.01e-13 NA
2. P Q9C6S6 Putative pentatricopeptide repeat-containing protein At1g31840 7.23e-10 2.19e-03 NA
2. P Q8C0Q3 Tetratricopeptide repeat protein 34 4.41e-12 2.26e-04 NA
2. P Q10NT7 ERAD-associated E3 ubiquitin-protein ligase component HRD3 4.38e-08 1.10e-03 NA
2. P Q9UJX2 Cell division cycle protein 23 homolog 2.74e-13 2.59e-03 NA
2. P Q9LW84 Pentatricopeptide repeat-containing protein At3g16010 7.14e-11 8.63e-04 NA
2. P O94556 Anaphase-promoting complex subunit 8 9.38e-13 5.23e-04 NA
2. P P16522 Anaphase-promoting complex subunit CDC23 7.76e-10 4.99e-02 NA
2. P Q9UJX3 Anaphase-promoting complex subunit 7 7.37e-13 1.18e-06 NA
2. P Q0P5A6 26S proteasome non-ATPase regulatory subunit 5 2.05e-04 3.34e-03 NA
2. P Q8VY89 Anaphase-promoting complex subunit 7 2.29e-14 1.29e-08 NA
2. P O49558 Pentatricopeptide repeat-containing protein At4g21170 2.07e-09 1.51e-02 NA
2. P Q9FMQ1 Pentatricopeptide repeat-containing protein At5g12100, mitochondrial 3.42e-08 3.91e-03 NA
2. P E9Q6P5 Tetratricopeptide repeat protein 7B 2.33e-12 3.06e-02 NA
2. P Q9FND8 Pentatricopeptide repeat-containing protein At5g40400 4.65e-09 3.67e-02 NA
2. P Q8BGZ4 Cell division cycle protein 23 homolog 3.08e-13 2.26e-03 NA
2. P Q9SYK1 Pentatricopeptide repeat-containing protein At1g05600 1.43e-08 2.16e-02 NA
2. P Q8GZA6 Pentatricopeptide repeat-containing protein At1g71210, mitochondrial 1.14e-08 1.03e-02 NA
2. P P09913 Interferon-induced protein with tetratricopeptide repeats 2 7.70e-10 6.77e-03 NA
2. P Q64282 Interferon-induced protein with tetratricopeptide repeats 1 6.88e-11 4.97e-10 NA
2. P Q9SAA6 Pentatricopeptide repeat-containing protein At1g11710, mitochondrial 2.32e-09 1.39e-04 NA
2. P Q05BC3 Echinoderm microtubule-associated protein-like 1 8.31e-01 2.14e-02 NA
2. P Q38951 Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform 8.11e-05 4.28e-02 NA
2. P Q8C159 Tetratricopeptide repeat protein 22 1.56e-08 1.08e-02 NA
2. P Q9DAX9 Amyloid protein-binding protein 2 2.26e-10 5.52e-05 NA
2. P Q8RWS8 Pentatricopeptide repeat-containing protein At2g41720 2.92e-08 3.60e-02 NA
2. P P09914 Interferon-induced protein with tetratricopeptide repeats 1 5.60e-11 2.78e-04 NA
2. P A8MYJ7 Tetratricopeptide repeat protein 34 2.02e-11 3.29e-04 NA
2. P Q38950 Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform 1.55e-05 2.20e-02 NA
2. P Q9P2M1 LRP2-binding protein 1.53e-06 4.18e-03 NA
2. P O81629 Protein KINESIN LIGHT CHAIN-RELATED 1 1.89e-15 1.36e-03 NA
3. B Q55ED0 Protein SGT1 homolog 5.87e-08 NA 0.008
3. B Q96301 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 2.33e-14 NA 4.70e-08
3. B F4KCL7 Outer envelope protein 64, mitochondrial 3.07e-02 NA 0.014
3. B Q43468 Hsp70-Hsp90 organizing protein 1 4.71e-09 NA 7.88e-10
3. B Q8XG77 Lipoprotein NlpI 2.55e-07 NA 0.016
3. B P30260 Cell division cycle protein 27 homolog 4.17e-09 NA 3.41e-13
3. B Q75Q39 Mitochondrial import receptor subunit TOM70 3.79e-11 NA 6.68e-06
3. B A7Z061 Cell division cycle protein 27 homolog 5.64e-09 NA 3.13e-13
3. B Q66GN3 Protein NPGR2 1.44e-14 NA 0.003
3. B Q04737 TPR repeat-containing protein slr0751 5.09e-13 NA 1.08e-08
3. B Q8IUR5 Protein O-mannosyl-transferase TMTC1 1.32e-09 NA 3.03e-05
3. B O70145 Neutrophil cytosol factor 2 1.52e-06 NA 0.008
3. B Q7ZWU1 Stress-induced-phosphoprotein 1 3.18e-12 NA 0.005
3. B P0CT30 Small glutamine-rich tetratricopeptide repeat-containing protein 2 1.97e-04 NA 0.010
3. B Q6DCD5 Protein O-mannosyl-transferase TMTC2 1.58e-08 NA 0.006
3. B A1AG68 Lipoprotein NlpI 5.48e-08 NA 0.021
3. B Q9STH1 Hsp70-Hsp90 organizing protein 3 4.67e-09 NA 3.70e-07
3. B O15294 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 0.00e+00 NA 7.18e-17
3. B Q54DA8 Protein STIP1 homolog 6.18e-09 NA 2.54e-06
3. B Q5R8D8 DnaJ homolog subfamily C member 7 2.24e-10 NA 1.05e-05
3. B O23052 Uncharacterized TPR repeat-containing protein At1g05150 5.46e-06 NA 1.33e-06
3. B Q95LZ5 Tetratricopeptide repeat protein 16 2.80e-09 NA 7.15e-05
3. B P53043 Serine/threonine-protein phosphatase T 1.14e-03 NA 0.003
3. B Q96EQ0 Small glutamine-rich tetratricopeptide repeat-containing protein beta 6.66e-05 NA 1.99e-04
3. B Q9XSH5 Peptidyl-prolyl cis-trans isomerase FKBP5 3.68e-04 NA 0.005
3. B Q8BJU0 Small glutamine-rich tetratricopeptide repeat-containing protein alpha 4.66e-05 NA 0.007
3. B Q8RWG2 Protein high chlorophyll fluorescent 107 4.23e-07 NA 0.008
3. B O70593 Small glutamine-rich tetratricopeptide repeat-containing protein alpha 8.31e-06 NA 0.010
3. B Q6ES52 TPR repeat-containing thioredoxin TDX 2.64e-04 NA 4.66e-05
3. B P07213 Mitochondrial import receptor subunit TOM70 1.05e-10 NA 0.001
3. B Q28IV3 RNA polymerase II-associated protein 3 5.35e-05 NA 5.69e-05
3. B Q58823 TPR repeat-containing protein MJ1428 3.21e-14 NA 1.56e-12
3. B Q80XJ3 Tetratricopeptide repeat protein 28 1.73e-07 NA 1.08e-06
3. B Q12118 Small glutamine-rich tetratricopeptide repeat-containing protein 2 2.49e-04 NA 0.018
3. B Q5WA76 U-box domain-containing protein 70 5.19e-07 NA 6.81e-05
3. B Q20683 Tetratricopeptide repeat protein 36 8.69e-05 NA 0.011
3. B Q07617 Sperm-associated antigen 1 7.32e-06 NA 0.030
3. B Q9USI5 Heat shock protein sti1 homolog 1.69e-09 NA 0.034
3. B Q6YZI0 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 3.97e-14 NA 6.01e-07
3. B F4JS25 Suppressor of RPS4-RLD 1 1.69e-05 NA 1.04e-12
3. B Q84XU2 Serine/threonine-protein phosphatase 5 4.16e-04 NA 2.87e-04
3. B Q9N593 Cell division cycle protein 27 homolog 1.09e-10 NA 0.021
3. B Q8NBP0 Tetratricopeptide repeat protein 13 2.94e-08 NA 1.62e-09
3. B Q80W98 Small glutamine-rich tetratricopeptide repeat-containing protein beta 1.54e-05 NA 0.001
3. B Q9HGM9 DnaJ homolog subfamily C member 7 homolog 1.48e-09 NA 5.35e-05
3. B O54981 Stress-induced-phosphoprotein 1 9.69e-11 NA 0.003
3. B Q9XSI2 Peptidyl-prolyl cis-trans isomerase FKBP5 3.48e-03 NA 0.027
3. B Q9MAH1 TPR repeat-containing thioredoxin TTL1 2.45e-08 NA 0.040
3. B Q9M8Y0 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC 1.84e-12 NA 9.34e-14
3. B Q95L05 Peptidyl-prolyl cis-trans isomerase FKBP5 8.11e-05 NA 0.048
3. B Q4V8A2 Cell division cycle protein 27 homolog 3.92e-09 NA 3.15e-13
3. B O16259 Stress-induced-phosphoprotein 1 1.01e-07 NA 3.43e-06
3. B A8BFN4 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 8.60e-04 NA 0.045
3. B Q1C3L9 Lipoprotein NlpI 1.15e-07 NA 0.004
3. B O82422 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 3.64e-14 NA 2.05e-06
3. B P17885 Protein bimA 4.94e-10 NA 4.43e-05
3. B O60184 General transcriptional corepressor ssn6 1.57e-10 NA 0.025
3. B Q5EBF2 Tetratricopeptide repeat protein 36 1.93e-04 NA 0.018
3. B Q57711 TPR repeat-containing protein MJ0941 2.05e-14 NA 8.89e-08
3. B E4P9W4 Lipoprotein NlpI 3.86e-07 NA 0.021
3. B Q9CZW5 Mitochondrial import receptor subunit TOM70 2.90e-12 NA 5.29e-06
3. B P0DO20 Magnetosome protein MamA 7.10e-08 NA 0.038
3. B Q5ZKQ3 RNA polymerase II-associated protein 3 2.58e-05 NA 7.84e-06
3. B Q8VWG7 TPR repeat-containing thioredoxin TDX 6.92e-04 NA 0.002
3. B P19737 TPR repeat-containing protein SYNPCC7002_A0425 1.45e-12 NA 0.002
3. B A6ZRW3 Mitochondrial import receptor subunit TOM70 1.21e-10 NA 0.001
3. B Q8C1F5 Tetratricopeptide repeat protein 16 1.80e-09 NA 2.26e-04
3. B P0AFB4 Lipoprotein NlpI 5.34e-08 NA 0.021
3. B Q7K4B6 Protein O-mannosyl-transferase Tmtc3 7.45e-09 NA 0.003
3. B Q54J83 Anaphase-promoting complex subunit 3 6.49e-08 NA 3.19e-05
3. B Q9VQE9 Protein O-mannosyl-transferase TMTC1 3.72e-07 NA 0.012
3. B Q8NEE8 Tetratricopeptide repeat protein 16 3.64e-09 NA 4.73e-05
3. B Q5I0X7 Tetratricopeptide repeat protein 32 6.68e-08 NA 4.19e-04
3. B P10505 Anaphase-promoting complex subunit 3 6.88e-11 NA 0.002
3. B P23231 Mitochondrial import receptor subunit tom70 6.50e-10 NA 5.94e-08
3. B Q54VG4 Small glutamine-rich tetratricopeptide repeat-containing protein 8.59e-05 NA 7.08e-05
3. B O82039 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 2.03e-14 NA 1.26e-08
3. B Q9DAC7 Tetratricopeptide repeat protein 32 1.56e-07 NA 0.002
3. B Q8LP10 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 3.00e-11 NA 7.22e-06
3. B A8E7I5 Tetratricopeptide repeat protein 36 1.64e-04 NA 4.77e-04
3. B Q6NU95 RNA polymerase II-associated protein 3 3.10e-08 NA 7.20e-05
3. B Q9QYI3 DnaJ homolog subfamily C member 7 2.17e-10 NA 8.67e-05
3. B Q6AZN0 Dynein axonemal assembly factor 4 6.09e-04 NA 0.017
3. B Q5ZI13 DnaJ homolog subfamily C member 3 1.08e-10 NA 1.39e-06
3. B Q9VF81 Protein O-mannosyl-transferase TMTC4 3.83e-09 NA 4.16e-10
3. B A2A6Q5 Cell division cycle protein 27 homolog 5.15e-09 NA 2.56e-13
3. B Q13217 DnaJ homolog subfamily C member 3 1.39e-10 NA 1.62e-06
3. B F8RP11 Hsp70-Hsp90 organizing protein 5.35e-07 NA 6.66e-08
3. B Q58350 TPR repeat-containing protein MJ0940 1.11e-16 NA 0.002
3. B Q57JI4 Lipoprotein NlpI 5.81e-08 NA 0.016
3. B P56558 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 0.00e+00 NA 6.78e-17
3. B Q54IP0 DnaJ homolog subfamily C member 7 homolog 3.69e-11 NA 2.71e-04
3. B Q6ZXV5 Protein O-mannosyl-transferase TMTC3 1.48e-07 NA 3.26e-04
3. B Q3ZBZ8 Stress-induced-phosphoprotein 1 7.49e-11 NA 0.001
3. B Q9R0T3 DnaJ homolog subfamily C member 3 1.47e-10 NA 1.52e-06
3. B Q8VD33 Small glutamine-rich tetratricopeptide repeat-containing protein beta 4.82e-05 NA 0.001
3. B Q0TCU6 Lipoprotein NlpI 5.55e-08 NA 0.021
3. B Q27968 DnaJ homolog subfamily C member 3 6.23e-11 NA 6.04e-07
3. B B7NDE9 Lipoprotein NlpI 3.99e-07 NA 0.021
3. B D5D1H3 Lipoprotein NlpI 5.86e-08 NA 0.021
3. B Q84K11 Serine/threonine-protein phosphatase 5 1.88e-04 NA 8.13e-06
3. B Q96RK4 Bardet-Biedl syndrome 4 protein 2.53e-11 NA 2.42e-06
3. B Q6DFB8 Tetratricopeptide repeat protein 37 2.68e-09 NA 0.003
3. B C4ZSQ4 Lipoprotein NlpI 1.02e-07 NA 0.021
3. B Q7CKI5 Lipoprotein NlpI 6.22e-08 NA 0.004
3. B Q9Z3Q0 Putative adenylate cyclase 3 8.36e-06 NA 0.037
3. B Q8CGY8 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 1.11e-16 NA 8.41e-17
3. B C6EH62 Lipoprotein NlpI 8.96e-08 NA 0.021
3. B Q8LGU6 Cell division cycle protein 27 homolog B 4.04e-09 NA 9.88e-09
3. B B5X0I6 Protein CTR9 homolog 5.21e-11 NA 0.018
3. B Q8S8L9 Uncharacterized TPR repeat-containing protein At2g32450 5.54e-06 NA 1.42e-06
3. B O34452 TPR repeat-containing protein YrrB 1.88e-13 NA 0.001
3. B Q8RVB2 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 2.38e-14 NA 2.32e-09
3. B Q8BRH0 Protein O-mannosyl-transferase TMTC3 4.63e-09 NA 9.20e-06
3. B Q96AY4 Tetratricopeptide repeat protein 28 1.06e-06 NA 5.75e-06
3. B F4I3Z5 Tetratricopeptide repeat protein SKI3 3.01e-12 NA 0.026
3. B Q93YR3 FAM10 family protein At4g22670 2.49e-03 NA 1.64e-04
3. B P31948 Stress-induced-phosphoprotein 1 9.28e-11 NA 0.003
3. B Q6PGP7 Tetratricopeptide repeat protein 37 4.59e-09 NA 5.62e-05
3. B Q99615 DnaJ homolog subfamily C member 7 2.09e-10 NA 1.13e-05
3. B Q9MUK5 Translocon at the outer membrane of chloroplasts 64 2.51e-03 NA 0.007
3. B Q58741 TPR repeat-containing protein MJ1345 6.24e-14 NA 1.16e-09
3. B Q27HV0 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 0.00e+00 NA 7.64e-17
3. B Q9LNB6 Hsp70-Hsp90 organizing protein 1 6.98e-09 NA 9.35e-07
3. B Q31W42 Lipoprotein NlpI 6.31e-08 NA 0.022
3. B Q8NFI4 Putative protein FAM10A5 2.16e-03 NA 8.06e-04
3. B P0AFB2 Lipoprotein NlpI 5.26e-08 NA 0.021
3. B O13797 Small glutamine-rich tetratricopeptide repeat-containing protein 2 7.44e-05 NA 0.038
3. B O94826 Mitochondrial import receptor subunit TOM70 7.11e-11 NA 3.08e-08
3. B O35814 Stress-induced-phosphoprotein 1 6.66e-11 NA 0.004
3. B Q7CPQ1 Lipoprotein NlpI 5.69e-08 NA 0.016
3. B Q3UV71 Protein O-mannosyl-transferase TMTC1 6.79e-09 NA 1.50e-05
3. B Q20144 Protein O-mannosyl-transferase TMTC1 1.17e-07 NA 2.03e-07
3. B F1RBN2 Sperm-associated antigen 1A 2.77e-08 NA 1.98e-05
3. B Q56A06 Protein O-mannosyl-transferase TMTC2 1.43e-08 NA 0.013
3. B B1XGX5 Lipoprotein NlpI 5.40e-08 NA 0.021
3. B O43049 Serine/threonine-protein phosphatase T 1.82e-03 NA 6.93e-06
3. B Q9D706 RNA polymerase II-associated protein 3 1.98e-08 NA 5.25e-06
3. B Q2W8Q0 Magnetosome protein MamA 1.28e-07 NA 0.038
3. B Q1CM50 Lipoprotein NlpI 7.22e-08 NA 0.004
3. B Q60864 Stress-induced-phosphoprotein 1 2.39e-10 NA 0.004
3. B Q28G25 Bardet-Biedl syndrome 4 protein homolog 1.58e-14 NA 3.91e-09
3. B Q3B045 Photosystem I assembly protein Ycf3 7.45e-05 NA 0.019
3. B Q4R8N7 Stress-induced-phosphoprotein 1 8.84e-11 NA 0.003
3. B Q68FQ7 RNA polymerase II-associated protein 3 7.55e-05 NA 1.85e-05
3. B P33746 Sol locus transcriptional repressor 6.14e-09 NA 8.47e-04
3. B Q9H6T3 RNA polymerase II-associated protein 3 2.65e-05 NA 2.10e-05
3. B Q9XT11 Peptidyl-prolyl cis-trans isomerase FKBP5 2.87e-04 NA 0.006
3. B Q9V3X5 Protein O-mannosyl-transferase TMTC2 3.39e-07 NA 5.25e-04
3. B Q06AN9 Cell division cycle protein 27 homolog A 1.61e-10 NA 0.004
3. B Q3KRD5 Mitochondrial import receptor subunit TOM34 4.40e-10 NA 0.002
3. B O06917 TPR repeat-containing protein MJ0263 1.73e-14 NA 0.011
3. B A8XHX1 Tetratricopeptide repeat protein 36 2.85e-04 NA 0.043
3. B P38825 Protein TOM71 4.44e-11 NA 1.38e-06
3. B Q5XEP2 Hsp70-Hsp90 organizing protein 2 2.94e-09 NA 1.49e-05
3. B Q8BG19 Protein O-mannosyl-transferase TMTC4 6.43e-08 NA 9.41e-11
3. B P0AFB3 Lipoprotein NlpI 5.41e-07 NA 0.021
3. B O18158 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 2.28e-13 NA 1.44e-12
3. B P81436 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 1.11e-16 NA 7.37e-17
3. B P19878 Neutrophil cytosol factor 2 1.70e-06 NA 0.021
3. B Q91YW3 DnaJ homolog subfamily C member 3 7.03e-11 NA 4.22e-07
3. B A7RL75 Tetratricopeptide repeat protein 36 homolog 9.43e-04 NA 6.07e-07
3. B Q1JQ97 Bardet-Biedl syndrome 4 protein homolog 1.51e-14 NA 3.29e-07
3. B Q9SUT5 Protein SGT1 homolog B 9.27e-04 NA 0.021
3. B Q84JR9 TPR repeat-containing thioredoxin TTL4 1.63e-07 NA 0.018
3. B P38042 Anaphase-promoting complex subunit CDC27 1.50e-12 NA 1.90e-04
3. B O43765 Small glutamine-rich tetratricopeptide repeat-containing protein alpha 9.31e-05 NA 0.002
3. B Q5T4D3 Protein O-mannosyl-transferase TMTC4 4.92e-08 NA 4.95e-10
3. B Q13451 Peptidyl-prolyl cis-trans isomerase FKBP5 1.57e-04 NA 0.048
3. B Q32LM2 Small glutamine-rich tetratricopeptide repeat-containing protein alpha 7.21e-05 NA 0.002
3. B Q8C1Z7 Bardet-Biedl syndrome 4 protein homolog 2.54e-14 NA 3.38e-08
3. B P0AFB1 Lipoprotein NlpI 9.67e-08 NA 0.021
3. B Q54M21 DnaJ homolog subfamily C member 3 homolog 3.57e-11 NA 2.90e-04
3. B Q8ILC1 STI1-like protein 2.17e-10 NA 8.65e-07