Summary

Q86UD1

Homolog: O18638.
Function: Out at first protein.

Statistics

Total GO Annotation: 145
Unique PROST Go: 145
Unique BLAST Go: 0

Total Homologs: 150
Unique PROST Homologs: 143
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was O18638 (Out at first protein) with a FATCAT P-Value: 0.0 and RMSD of 1.51 angstrom. The sequence alignment identity is 37.2%.
Structural alignment shown in left. Query protein Q86UD1 colored as red in alignment, homolog O18638 colored as blue. Query protein Q86UD1 is also shown in right top, homolog O18638 showed in right bottom. They are colored based on secondary structures. 

  Q86UD1 ---------MRLP--GVP-L-------------ARPAL-LLL--LPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSFT 72
  O18638 MAYGAPQCAQHLPPIGTPTLRQRSVSCYHFFRHSRGFLWFVLCNL-LLTPNI---SDAQLLINVQNQGGEVIQESITSNIGEDLITLEFQKTDGTLITQL 96

  Q86UD1 ADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHLHMD--VAVNFSQGAL-LSPHLHNVCAEAVDAI 169
  O18638 IDFRNEVQILKALVLGEEERGQSQYQVMCFATKFNKGDFISSDAMAKLRQKNPHTIRTPEEDKGRETYTMSSWVQLNRS---LPITRHLQSLCAEATDAT 193

  Q86UD1 YTRQEDVRFWLE-QGVDSSVFEALPKASEQA--EL-PRCRQVGDHGKPCVCRYGLSLAWYPCMLKYCHSR----D--------RPTPYKCGIRSCQKSYS 253
  O18638 YVRDVDLKAWAELPG--SSI-SSLEAATEKFPDALSTRCNEVSSLWAPCLCTLETCIGWYPCGLKYCKGKSVGGDTSGTQQQQQQTNYRCGIKTCRKCTQ 290

  Q86UD1 FDFYVPQRQLCLWDEDPYPG 273
  O18638 FTYYVRQKQQCLWDE----- 305

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0048706 embryonic skeletal system development
2. P GO:0051216 cartilage development
2. P GO:0001934 positive regulation of protein phosphorylation
2. P GO:0042733 embryonic digit morphogenesis
2. P GO:0061384 heart trabecula morphogenesis
2. P GO:0005796 Golgi lumen
2. P GO:0010976 positive regulation of neuron projection development
2. P GO:0061037 negative regulation of cartilage development
2. P GO:0120041 positive regulation of macrophage proliferation
2. P GO:0090501 RNA phosphodiester bond hydrolysis
2. P GO:0060513 prostatic bud formation
2. P GO:0050778 positive regulation of immune response
2. P GO:2001234 negative regulation of apoptotic signaling pathway
2. P GO:0050829 defense response to Gram-negative bacterium
2. P GO:0070447 positive regulation of oligodendrocyte progenitor proliferation
2. P GO:0007218 neuropeptide signaling pathway
2. P GO:0060412 ventricular septum morphogenesis
2. P GO:0006091 generation of precursor metabolites and energy
2. P GO:0005576 extracellular region
2. P GO:0019731 antibacterial humoral response
2. P GO:1903489 positive regulation of lactation
2. P GO:0001837 epithelial to mesenchymal transition
2. P GO:0003149 membranous septum morphogenesis
2. P GO:0005615 extracellular space
2. P GO:0001707 mesoderm formation
2. P GO:0061514 interleukin-34-mediated signaling pathway
2. P GO:0035019 somatic stem cell population maintenance
2. P GO:0005133 interferon-gamma receptor binding
2. P GO:0001839 neural plate morphogenesis
2. P GO:0006954 inflammatory response
2. P GO:0042438 melanin biosynthetic process
2. P GO:0090193 positive regulation of glomerulus development
2. P GO:0061312 BMP signaling pathway involved in heart development
2. P GO:0002227 innate immune response in mucosa
2. P GO:0030336 negative regulation of cell migration
2. P GO:0070378 positive regulation of ERK5 cascade
2. P GO:0061626 pharyngeal arch artery morphogenesis
2. P GO:2000313 regulation of fibroblast growth factor receptor signaling pathway involved in neural plate anterior/posterior pattern formation
2. P GO:0048571 long-day photoperiodism
2. P GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
2. P GO:0060044 negative regulation of cardiac muscle cell proliferation
2. P GO:2000253 positive regulation of feeding behavior
2. P GO:0008343 adult feeding behavior
2. P GO:0001501 skeletal system development
2. P GO:0045651 positive regulation of macrophage differentiation
2. P GO:0005157 macrophage colony-stimulating factor receptor binding
2. P GO:0009755 hormone-mediated signaling pathway
2. P GO:0061098 positive regulation of protein tyrosine kinase activity
2. P GO:0050796 regulation of insulin secretion
2. P GO:0003151 outflow tract morphogenesis
2. P GO:0042755 eating behavior
2. P GO:0001649 osteoblast differentiation
2. P GO:0045087 innate immune response
2. P GO:0051971 positive regulation of transmission of nerve impulse
2. P GO:1905710 positive regulation of membrane permeability
2. P GO:1902747 negative regulation of lens fiber cell differentiation
2. P GO:0060676 ureteric bud formation
2. P GO:0048318 axial mesoderm development
2. P GO:0030298 receptor signaling protein tyrosine kinase activator activity
2. P GO:0060173 limb development
2. P GO:0071222 cellular response to lipopolysaccharide
2. P GO:0045596 negative regulation of cell differentiation
2. P GO:0031779 melanocortin receptor binding
2. P GO:0060325 face morphogenesis
2. P GO:0055009 atrial cardiac muscle tissue morphogenesis
2. P GO:0007259 receptor signaling pathway via JAK-STAT
2. P GO:1902093 positive regulation of flagellated sperm motility
2. P GO:0061518 microglial cell proliferation
2. P GO:0005125 cytokine activity
2. P GO:0002385 mucosal immune response
2. P GO:0008045 motor neuron axon guidance
2. P GO:0009953 dorsal/ventral pattern formation
2. P GO:0045668 negative regulation of osteoblast differentiation
2. P GO:0070092 regulation of glucagon secretion
2. P GO:0060272 embryonic skeletal joint morphogenesis
2. P GO:0019871 sodium channel inhibitor activity
2. P GO:0005102 signaling receptor binding
2. P GO:0030510 regulation of BMP signaling pathway
2. P GO:0048023 positive regulation of melanin biosynthetic process
2. P GO:0032868 response to insulin
2. P GO:0051873 killing by host of symbiont cells
2. P GO:0005184 neuropeptide hormone activity
2. P GO:0048570 notochord morphogenesis
2. P GO:0019229 regulation of vasoconstriction
2. P GO:0032812 positive regulation of epinephrine secretion
2. P GO:0021533 cell differentiation in hindbrain
2. P GO:1904894 positive regulation of receptor signaling pathway via STAT
2. P GO:0046850 regulation of bone remodeling
2. P GO:0050679 positive regulation of epithelial cell proliferation
2. P GO:0070374 positive regulation of ERK1 and ERK2 cascade
2. P GO:0032402 melanosome transport
2. P GO:0090190 positive regulation of branching involved in ureteric bud morphogenesis
2. P GO:0001843 neural tube closure
2. P GO:0001706 endoderm formation
2. P GO:0070996 type 1 melanocortin receptor binding
2. P GO:0031781 type 3 melanocortin receptor binding
2. P GO:0060302 negative regulation of cytokine activity
2. P GO:0021983 pituitary gland development
2. P GO:0070093 negative regulation of glucagon secretion
2. P GO:0072574 hepatocyte proliferation
2. P GO:0061053 somite development
2. P GO:1905006 negative regulation of epithelial to mesenchymal transition involved in endocardial cushion formation
2. P GO:0003203 endocardial cushion morphogenesis
2. P GO:0031640 killing of cells of another organism
2. P GO:0001655 urogenital system development
2. P GO:0060825 fibroblast growth factor receptor signaling pathway involved in neural plate anterior/posterior pattern formation
2. P GO:0003223 ventricular compact myocardium morphogenesis
2. P GO:0051607 defense response to virus
2. P GO:0080154 regulation of fertilization
2. P GO:0048712 negative regulation of astrocyte differentiation
2. P GO:0040030 obsolete regulation of molecular function, epigenetic
2. P GO:0010759 positive regulation of macrophage chemotaxis
2. P GO:0030971 receptor tyrosine kinase binding
2. P GO:0090729 toxin activity
2. P GO:0050832 defense response to fungus
2. P GO:0071514 genomic imprinting
2. P GO:0008083 growth factor activity
2. P GO:0021510 spinal cord development
2. P GO:0060135 maternal process involved in female pregnancy
2. P GO:0048762 mesenchymal cell differentiation
2. P GO:0032099 negative regulation of appetite
2. P GO:0070253 somatostatin secretion
2. P GO:0048646 anatomical structure formation involved in morphogenesis
2. P GO:0030514 negative regulation of BMP signaling pathway
2. P GO:0008284 positive regulation of cell population proliferation
2. P GO:0045657 positive regulation of monocyte differentiation
2. P GO:0010628 positive regulation of gene expression
2. P GO:0051151 negative regulation of smooth muscle cell differentiation
2. P GO:0031782 type 4 melanocortin receptor binding
2. P GO:0043406 positive regulation of MAP kinase activity
2. P GO:0051673 membrane disruption in another organism
2. P GO:0042474 middle ear morphogenesis
2. P GO:0042060 wound healing
2. P GO:0032438 melanosome organization
2. P GO:0060259 regulation of feeding behavior
2. P GO:0072540 T-helper 17 cell lineage commitment
2. P GO:0019955 cytokine binding
2. P GO:0042742 defense response to bacterium
2. P GO:0045779 negative regulation of bone resorption
2. P GO:0042310 vasoconstriction
2. P GO:0005138 interleukin-6 receptor binding
2. P GO:0048714 positive regulation of oligodendrocyte differentiation
2. P GO:0050830 defense response to Gram-positive bacterium
2. P GO:0060394 negative regulation of pathway-restricted SMAD protein phosphorylation
2. P GO:0060425 lung morphogenesis

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q86UD1 Out at first protein homolog 0 3.79e-157 0.0
1. PB Q8QZR4 Out at first protein homolog 0.00e+00 7.13e-43 5.93e-165
1. PB O18638 Out at first protein 0.00e+00 6.17e-10 1.26e-63
1. PB Q6AYE5 Out at first protein homolog 0.00e+00 3.39e-41 5.42e-162
1. PB Q6GPK2 Out at first protein homolog 0.00e+00 5.36e-22 1.20e-120
1. PB Q71SY6 Out at first protein homolog 0.00e+00 1.16e-44 1.68e-135
2. P D2Y265 U11-theraphotoxin-Hhn1a 9.52e-01 4.05e-02 NA
2. P D2Y284 U11-theraphotoxin-Hhn1n 9.25e-01 2.33e-03 NA
2. P O93525 Noggin 8.53e-01 1.80e-02 NA
2. P W4VSA5 U16-barytoxin-Tl1f 9.71e-01 1.11e-02 NA
2. P Q1XGV1 Agouti-signaling protein 6.92e-01 2.10e-04 NA
2. P Q9YHT8 Noggin 6.16e-01 1.48e-04 NA
2. P A8CEM0 Agouti-signaling protein 7.06e-01 1.90e-04 NA
2. P D2Y286 U11-theraphotoxin-Hhn1p 9.46e-01 1.56e-02 NA
2. P A1YL74 Agouti-signaling protein 6.72e-01 3.65e-04 NA
2. P A0A1B0GTR0 Epididymal protein 13 8.09e-01 3.42e-08 NA
2. P D2Y291 U11-theraphotoxin-Hhn1u 9.52e-01 4.07e-03 NA
2. P Q4KM46 Interleukin-34 8.31e-01 7.26e-06 NA
2. P A1YL68 Agouti-signaling protein 7.74e-01 9.38e-06 NA
2. P Q5GAN6 Inactive ribonuclease-like protein 10 3.83e-01 2.37e-05 NA
2. P W4VRY9 U9-barytoxin-Tl1a NA 2.72e-07 NA
2. P Q4VK74 Interferon lambda-2 4.54e-01 3.41e-04 NA
2. P A1YL82 Agouti-signaling protein NA 1.26e-03 NA
2. P A6QL48 Interleukin-34 7.06e-01 4.88e-04 NA
2. P Q9I9H4 Somatolactin 8.92e-01 1.28e-02 NA
2. P A1YL67 Agouti-signaling protein 7.05e-01 1.90e-04 NA
2. P Q8TAA1 Probable ribonuclease 11 4.17e-01 8.16e-03 NA
2. P Q8CGK6 Interferon lambda-3 4.13e-01 1.66e-02 NA
2. P Q1XGU6 Agouti-signaling protein 6.55e-01 3.65e-04 NA
2. P Q1XGU8 Agouti-signaling protein 7.02e-01 1.35e-04 NA
2. P W4VS08 U17-barytoxin-Tl1d 9.85e-01 1.75e-04 NA
2. P A1YL72 Agouti-signaling protein 7.21e-01 3.65e-04 NA
2. P O26903 UPF0305 protein MTH_812 8.60e-01 2.13e-02 NA
2. P Q9DA16 Izumo sperm-egg fusion protein 2 9.45e-01 7.83e-03 NA
2. P D2Y276 U11-theraphotoxin-Hhn1f 9.54e-01 1.80e-02 NA
2. P Q5UK76 Agouti-signaling protein 7.53e-01 1.44e-03 NA
2. P D2Y293 U11-theraphotoxin-Hhn1a 9.47e-01 4.20e-03 NA
2. P A8CEN1 Agouti-signaling protein 7.47e-01 4.59e-05 NA
2. P Q29414 Agouti-signaling protein 6.38e-01 3.99e-03 NA
2. P A6YB85 Alpha-defensin 1 5.91e-01 1.20e-02 NA
2. P D2Y260 U11-theraphotoxin-Hhn1a 9.53e-01 2.11e-02 NA
2. P A1YL66 Agouti-signaling protein 5.70e-01 2.10e-04 NA
2. P P42127 Agouti-signaling protein 4.46e-01 1.53e-04 NA
2. P D2Y259 U11-theraphotoxin-Hhn1a 9.49e-01 1.69e-02 NA
2. P D2Y290 U11-theraphotoxin-Hhn1t 9.59e-01 3.20e-02 NA
2. P Q03288 Agouti-signaling protein 7.97e-01 5.34e-03 NA
2. P P86718 Spiderine-2a 9.10e-01 1.20e-02 NA
2. P A0A125S9G0 Conotoxin Im026 9.69e-01 7.44e-03 NA
2. P Q6L6X6 Interleukin-6 6.36e-01 1.52e-03 NA
2. P B3IXK1 Interferon gamma 9.49e-01 8.33e-03 NA
2. P B1P1H6 U26-theraphotoxin-Cg1a 9.86e-01 5.74e-03 NA
2. P D2Y269 U11-theraphotoxin-Hhn1a 9.49e-01 2.45e-02 NA
2. P D2Y272 U11-theraphotoxin-Hhn1c 9.57e-01 1.69e-03 NA
2. P D2Y299 U9-theraphotoxin-Hhn1a 9.54e-01 2.93e-02 NA
2. P A8CEM7 Agouti-signaling protein 7.58e-01 1.64e-03 NA
2. P D2Y297 U11-theraphotoxin-Hhn1a 9.54e-01 5.34e-03 NA
2. P Q6UXV1 Izumo sperm-egg fusion protein 2 9.23e-01 2.64e-08 NA
2. P P0DJK1 Sarafotoxin-i2 8.16e-01 6.57e-04 NA
2. P D2Y277 U11-theraphotoxin-Hhn1g 9.45e-01 7.14e-03 NA
2. P Q1XGV7 Agouti-signaling protein 5.69e-01 3.53e-04 NA
2. P W4VRU8 U16-barytoxin-Tl1b 9.73e-01 3.13e-03 NA
2. P A8CEM4 Agouti-signaling protein 7.16e-01 6.01e-05 NA
2. P P58457 Kalata-B7 8.65e-01 9.53e-04 NA
2. P W4VSI3 U16-barytoxin-Tl1f 9.54e-01 2.56e-03 NA
2. P P56388 Cocaine- and amphetamine-regulated transcript protein 9.69e-01 2.73e-02 NA
2. P A8CEM9 Agouti-signaling protein 7.42e-01 4.59e-05 NA
2. P A1YL81 Agouti-signaling protein NA 1.26e-03 NA
2. P W4VRY7 U13-barytoxin-Tl1a NA 3.10e-03 NA
2. P A1YL79 Agouti-signaling protein 7.78e-01 4.87e-03 NA
2. P D2Y275 U11-theraphotoxin-Hhn1f 9.51e-01 1.26e-02 NA
2. P D2Y2I0 U11-theraphotoxin-Hhn1w 9.35e-01 2.97e-03 NA
2. P Q6UX46 ALK and LTK ligand 2 8.94e-01 3.41e-03 NA
2. P B1NRR3 Cyclotide vitri-A (Fragment) 6.29e-01 1.80e-02 NA
2. P D2Y295 U11-theraphotoxin-Hhn1a 9.60e-01 2.09e-02 NA
2. P P56473 Agouti-related protein 7.80e-01 4.87e-05 NA
2. P A1YL69 Agouti-signaling protein 6.38e-01 6.01e-05 NA
2. P D2Y263 U11-theraphotoxin-Hhn1a 9.49e-01 2.76e-02 NA
2. P D2Y273 U11-theraphotoxin-Hhn1d 9.55e-01 4.46e-02 NA
2. P Q3BK14 Disintegrin lebestatin 9.31e-01 4.09e-02 NA
2. P P56413 Agouti-related protein 9.01e-01 1.07e-08 NA
2. P P97466 Noggin 7.34e-01 9.12e-04 NA
2. P P49112 Neutrophil cationic peptide 2 9.22e-01 1.52e-02 NA
2. P D2Y294 U11-theraphotoxin-Hhn1a 9.47e-01 4.82e-02 NA
2. P Q62716 Neutrophil antibiotic peptide NP-1 8.79e-01 5.69e-03 NA
2. P B1NRQ9 Cyclotide vibi-I (Fragment) 7.91e-01 3.60e-02 NA
2. P Q6ZYM3 Agouti-signaling protein 5.11e-01 1.95e-02 NA
2. P D2Y2H9 U11-theraphotoxin-Hhn1v 9.48e-01 6.85e-03 NA
2. P Q62715 Neutrophil antibiotic peptide NP-2 9.05e-01 1.37e-02 NA
2. P Q1XGV3 Agouti-signaling protein 6.13e-01 1.90e-04 NA
2. P A1YL70 Agouti-signaling protein 7.31e-01 2.10e-04 NA
2. P D2Y253 U11-theraphotoxin-Hhn1a 9.52e-01 1.14e-02 NA
2. P W4VRU6 U16-barytoxin-Tl1c 9.86e-01 2.70e-02 NA
2. P A8CEM8 Agouti-signaling protein 7.45e-01 6.99e-05 NA
2. P D2Y298 U11-theraphotoxin-Hhn1a 9.50e-01 1.75e-02 NA
2. P Q1XGU9 Agouti-signaling protein 6.58e-01 2.46e-04 NA
2. P O00253 Agouti-related protein 5.70e-01 4.93e-05 NA
2. P W4VRW6 U16-barytoxin-Tl1c 9.70e-01 1.90e-03 NA
2. P D2Y281 U11-theraphotoxin-Hhn1k 9.48e-01 2.07e-02 NA
2. P A1YL77 Agouti-signaling protein 7.71e-01 3.10e-03 NA
2. P A8CEN3 Agouti-signaling protein 5.14e-01 8.82e-05 NA
2. P D2Y280 U11-theraphotoxin-Hhn1j 9.52e-01 7.99e-03 NA
2. P A1YL80 Agouti-signaling protein 7.28e-01 3.10e-03 NA
2. P W4VS15 U16-barytoxin-Tl1c 9.72e-01 1.98e-03 NA
2. P Q1XGV5 Agouti-signaling protein 5.82e-01 3.53e-04 NA
2. P D2Y288 U11-theraphotoxin-Hhn1r 9.77e-01 2.22e-02 NA
2. P Q13253 Noggin 7.75e-01 8.55e-04 NA
2. P B2RZ42 ALK and LTK ligand 2 8.96e-01 3.51e-06 NA
2. P D2Y274 U11-theraphotoxin-Hhn1e 9.53e-01 3.17e-03 NA
2. P A8CEM1 Agouti-signaling protein 4.75e-01 2.13e-04 NA
2. P Q8R1R4 Interleukin-34 7.20e-01 1.35e-03 NA
2. P Q5BHG4 Lactobacillus up-regulated protein 3.01e-01 2.28e-03 NA
2. P A8CEM5 Agouti-signaling protein 7.36e-01 4.59e-05 NA
2. P Q865F0 Agouti-signaling protein 7.05e-01 2.36e-04 NA
2. P P11478 Neutrophil cationic peptide 1 type A 8.74e-01 1.80e-02 NA
2. P Q9QXX2 Interferon gamma 9.68e-01 3.82e-02 NA
2. P D2Y2P8 U11-theraphotoxin-Hhn1b 9.67e-01 1.63e-02 NA
2. P Q64365 Neutrophil cationic peptide 1 type B 9.46e-01 3.04e-02 NA
2. P Q1XGV4 Agouti-signaling protein 7.53e-01 7.74e-04 NA
2. P D2Y254 U11-theraphotoxin-Hhn1a 9.50e-01 8.16e-03 NA
2. P D2Y255 U11-theraphotoxin-Hhn1a 9.47e-01 1.95e-02 NA
2. P Q1XGV6 Agouti-signaling protein 5.70e-01 3.53e-04 NA
2. P D2Y279 U11-theraphotoxin-Hhn1i 9.68e-01 3.04e-02 NA
2. P W4VRV3 U12-barytoxin-Tl1a 9.68e-01 9.74e-04 NA
2. P D2Y2I2 U11-theraphotoxin-Hhn1a 9.51e-01 9.81e-03 NA
2. P Q9W740 Noggin-2 6.57e-01 3.67e-03 NA
2. P P0DJK0 Sarafotoxin-i1 9.01e-01 5.74e-03 NA
2. P W4VSI4 U16-barytoxin-Tl1d 9.90e-01 2.70e-03 NA
2. P D2Y268 U11-theraphotoxin-Hhn1a 9.48e-01 3.46e-02 NA
2. P Q9TU18 Agouti-related protein 8.32e-01 1.05e-05 NA
2. P K7N5K9 U1-theraphotoxin-Sp1a 8.75e-01 3.29e-02 NA
2. P A1YL78 Agouti-signaling protein 7.67e-01 3.10e-03 NA
2. P Q1XGU7 Agouti-signaling protein 7.12e-01 3.65e-04 NA
2. P Q1XGU5 Agouti-signaling protein 7.36e-01 4.31e-04 NA
2. P Q6ZMJ4 Interleukin-34 5.79e-01 6.85e-03 NA
2. P D2Y261 U11-theraphotoxin-Hhn1a 9.50e-01 8.24e-03 NA
2. P Q8CJ42 Prolactin-7B1 7.66e-01 2.13e-02 NA
2. P P0C8A9 Defensin-B5 8.56e-01 5.18e-03 NA
2. P D2Y264 U11-theraphotoxin-Hhn1a 9.62e-01 8.24e-03 NA
2. P Q80UG6 ALK and LTK ligand 2 8.86e-01 1.32e-04 NA
2. P D2Y285 U11-theraphotoxin-Hhn1o 9.31e-01 7.51e-03 NA
2. P D2Y287 U11-theraphotoxin-Hhn1q 9.50e-01 1.29e-02 NA
2. P P79407 Agouti-signaling protein 7.02e-01 3.34e-03 NA
2. P D2Y267 U11-theraphotoxin-Hhn1a 9.53e-01 8.59e-03 NA
2. P D2Y271 U11-theraphotoxin-Hhn1b 9.66e-01 7.99e-03 NA
2. P D2Y270 U11-theraphotoxin-Hhn1a 9.47e-01 3.17e-02 NA
2. P P86719 Spiderine-2b 8.99e-01 7.29e-03 NA
2. P Q1XGV2 Agouti-signaling protein 6.41e-01 4.59e-05 NA
2. P W4VSI1 U17-barytoxin-Tl1d 9.89e-01 2.33e-04 NA
2. P Q1XGV0 Agouti-signaling protein 7.12e-01 2.10e-04 NA
3. B Q9NLA6 Out at first protein NA NA 6.81e-63