Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
O18638
(Out at first protein) with a FATCAT P-Value: 0.0 and RMSD of 1.51 angstrom. The sequence alignment identity is 37.2%.
Structural alignment shown in left. Query protein Q86UD1 colored as red in alignment, homolog O18638 colored as blue.
Query protein Q86UD1 is also shown in right top, homolog O18638 showed in right bottom. They are colored based on secondary structures.
Q86UD1 ---------MRLP--GVP-L-------------ARPAL-LLL--LPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSFT 72 O18638 MAYGAPQCAQHLPPIGTPTLRQRSVSCYHFFRHSRGFLWFVLCNL-LLTPNI---SDAQLLINVQNQGGEVIQESITSNIGEDLITLEFQKTDGTLITQL 96 Q86UD1 ADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHLHMD--VAVNFSQGAL-LSPHLHNVCAEAVDAI 169 O18638 IDFRNEVQILKALVLGEEERGQSQYQVMCFATKFNKGDFISSDAMAKLRQKNPHTIRTPEEDKGRETYTMSSWVQLNRS---LPITRHLQSLCAEATDAT 193 Q86UD1 YTRQEDVRFWLE-QGVDSSVFEALPKASEQA--EL-PRCRQVGDHGKPCVCRYGLSLAWYPCMLKYCHSR----D--------RPTPYKCGIRSCQKSYS 253 O18638 YVRDVDLKAWAELPG--SSI-SSLEAATEKFPDALSTRCNEVSSLWAPCLCTLETCIGWYPCGLKYCKGKSVGGDTSGTQQQQQQTNYRCGIKTCRKCTQ 290 Q86UD1 FDFYVPQRQLCLWDEDPYPG 273 O18638 FTYYVRQKQQCLWDE----- 305
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0048706 | embryonic skeletal system development |
| 2. P | GO:0051216 | cartilage development |
| 2. P | GO:0001934 | positive regulation of protein phosphorylation |
| 2. P | GO:0042733 | embryonic digit morphogenesis |
| 2. P | GO:0061384 | heart trabecula morphogenesis |
| 2. P | GO:0005796 | Golgi lumen |
| 2. P | GO:0010976 | positive regulation of neuron projection development |
| 2. P | GO:0061037 | negative regulation of cartilage development |
| 2. P | GO:0120041 | positive regulation of macrophage proliferation |
| 2. P | GO:0090501 | RNA phosphodiester bond hydrolysis |
| 2. P | GO:0060513 | prostatic bud formation |
| 2. P | GO:0050778 | positive regulation of immune response |
| 2. P | GO:2001234 | negative regulation of apoptotic signaling pathway |
| 2. P | GO:0050829 | defense response to Gram-negative bacterium |
| 2. P | GO:0070447 | positive regulation of oligodendrocyte progenitor proliferation |
| 2. P | GO:0007218 | neuropeptide signaling pathway |
| 2. P | GO:0060412 | ventricular septum morphogenesis |
| 2. P | GO:0006091 | generation of precursor metabolites and energy |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0019731 | antibacterial humoral response |
| 2. P | GO:1903489 | positive regulation of lactation |
| 2. P | GO:0001837 | epithelial to mesenchymal transition |
| 2. P | GO:0003149 | membranous septum morphogenesis |
| 2. P | GO:0005615 | extracellular space |
| 2. P | GO:0001707 | mesoderm formation |
| 2. P | GO:0061514 | interleukin-34-mediated signaling pathway |
| 2. P | GO:0035019 | somatic stem cell population maintenance |
| 2. P | GO:0005133 | interferon-gamma receptor binding |
| 2. P | GO:0001839 | neural plate morphogenesis |
| 2. P | GO:0006954 | inflammatory response |
| 2. P | GO:0042438 | melanin biosynthetic process |
| 2. P | GO:0090193 | positive regulation of glomerulus development |
| 2. P | GO:0061312 | BMP signaling pathway involved in heart development |
| 2. P | GO:0002227 | innate immune response in mucosa |
| 2. P | GO:0030336 | negative regulation of cell migration |
| 2. P | GO:0070378 | positive regulation of ERK5 cascade |
| 2. P | GO:0061626 | pharyngeal arch artery morphogenesis |
| 2. P | GO:2000313 | regulation of fibroblast growth factor receptor signaling pathway involved in neural plate anterior/posterior pattern formation |
| 2. P | GO:0048571 | long-day photoperiodism |
| 2. P | GO:0061844 | antimicrobial humoral immune response mediated by antimicrobial peptide |
| 2. P | GO:0060044 | negative regulation of cardiac muscle cell proliferation |
| 2. P | GO:2000253 | positive regulation of feeding behavior |
| 2. P | GO:0008343 | adult feeding behavior |
| 2. P | GO:0001501 | skeletal system development |
| 2. P | GO:0045651 | positive regulation of macrophage differentiation |
| 2. P | GO:0005157 | macrophage colony-stimulating factor receptor binding |
| 2. P | GO:0009755 | hormone-mediated signaling pathway |
| 2. P | GO:0061098 | positive regulation of protein tyrosine kinase activity |
| 2. P | GO:0050796 | regulation of insulin secretion |
| 2. P | GO:0003151 | outflow tract morphogenesis |
| 2. P | GO:0042755 | eating behavior |
| 2. P | GO:0001649 | osteoblast differentiation |
| 2. P | GO:0045087 | innate immune response |
| 2. P | GO:0051971 | positive regulation of transmission of nerve impulse |
| 2. P | GO:1905710 | positive regulation of membrane permeability |
| 2. P | GO:1902747 | negative regulation of lens fiber cell differentiation |
| 2. P | GO:0060676 | ureteric bud formation |
| 2. P | GO:0048318 | axial mesoderm development |
| 2. P | GO:0030298 | receptor signaling protein tyrosine kinase activator activity |
| 2. P | GO:0060173 | limb development |
| 2. P | GO:0071222 | cellular response to lipopolysaccharide |
| 2. P | GO:0045596 | negative regulation of cell differentiation |
| 2. P | GO:0031779 | melanocortin receptor binding |
| 2. P | GO:0060325 | face morphogenesis |
| 2. P | GO:0055009 | atrial cardiac muscle tissue morphogenesis |
| 2. P | GO:0007259 | receptor signaling pathway via JAK-STAT |
| 2. P | GO:1902093 | positive regulation of flagellated sperm motility |
| 2. P | GO:0061518 | microglial cell proliferation |
| 2. P | GO:0005125 | cytokine activity |
| 2. P | GO:0002385 | mucosal immune response |
| 2. P | GO:0008045 | motor neuron axon guidance |
| 2. P | GO:0009953 | dorsal/ventral pattern formation |
| 2. P | GO:0045668 | negative regulation of osteoblast differentiation |
| 2. P | GO:0070092 | regulation of glucagon secretion |
| 2. P | GO:0060272 | embryonic skeletal joint morphogenesis |
| 2. P | GO:0019871 | sodium channel inhibitor activity |
| 2. P | GO:0005102 | signaling receptor binding |
| 2. P | GO:0030510 | regulation of BMP signaling pathway |
| 2. P | GO:0048023 | positive regulation of melanin biosynthetic process |
| 2. P | GO:0032868 | response to insulin |
| 2. P | GO:0051873 | killing by host of symbiont cells |
| 2. P | GO:0005184 | neuropeptide hormone activity |
| 2. P | GO:0048570 | notochord morphogenesis |
| 2. P | GO:0019229 | regulation of vasoconstriction |
| 2. P | GO:0032812 | positive regulation of epinephrine secretion |
| 2. P | GO:0021533 | cell differentiation in hindbrain |
| 2. P | GO:1904894 | positive regulation of receptor signaling pathway via STAT |
| 2. P | GO:0046850 | regulation of bone remodeling |
| 2. P | GO:0050679 | positive regulation of epithelial cell proliferation |
| 2. P | GO:0070374 | positive regulation of ERK1 and ERK2 cascade |
| 2. P | GO:0032402 | melanosome transport |
| 2. P | GO:0090190 | positive regulation of branching involved in ureteric bud morphogenesis |
| 2. P | GO:0001843 | neural tube closure |
| 2. P | GO:0001706 | endoderm formation |
| 2. P | GO:0070996 | type 1 melanocortin receptor binding |
| 2. P | GO:0031781 | type 3 melanocortin receptor binding |
| 2. P | GO:0060302 | negative regulation of cytokine activity |
| 2. P | GO:0021983 | pituitary gland development |
| 2. P | GO:0070093 | negative regulation of glucagon secretion |
| 2. P | GO:0072574 | hepatocyte proliferation |
| 2. P | GO:0061053 | somite development |
| 2. P | GO:1905006 | negative regulation of epithelial to mesenchymal transition involved in endocardial cushion formation |
| 2. P | GO:0003203 | endocardial cushion morphogenesis |
| 2. P | GO:0031640 | killing of cells of another organism |
| 2. P | GO:0001655 | urogenital system development |
| 2. P | GO:0060825 | fibroblast growth factor receptor signaling pathway involved in neural plate anterior/posterior pattern formation |
| 2. P | GO:0003223 | ventricular compact myocardium morphogenesis |
| 2. P | GO:0051607 | defense response to virus |
| 2. P | GO:0080154 | regulation of fertilization |
| 2. P | GO:0048712 | negative regulation of astrocyte differentiation |
| 2. P | GO:0040030 | obsolete regulation of molecular function, epigenetic |
| 2. P | GO:0010759 | positive regulation of macrophage chemotaxis |
| 2. P | GO:0030971 | receptor tyrosine kinase binding |
| 2. P | GO:0090729 | toxin activity |
| 2. P | GO:0050832 | defense response to fungus |
| 2. P | GO:0071514 | genomic imprinting |
| 2. P | GO:0008083 | growth factor activity |
| 2. P | GO:0021510 | spinal cord development |
| 2. P | GO:0060135 | maternal process involved in female pregnancy |
| 2. P | GO:0048762 | mesenchymal cell differentiation |
| 2. P | GO:0032099 | negative regulation of appetite |
| 2. P | GO:0070253 | somatostatin secretion |
| 2. P | GO:0048646 | anatomical structure formation involved in morphogenesis |
| 2. P | GO:0030514 | negative regulation of BMP signaling pathway |
| 2. P | GO:0008284 | positive regulation of cell population proliferation |
| 2. P | GO:0045657 | positive regulation of monocyte differentiation |
| 2. P | GO:0010628 | positive regulation of gene expression |
| 2. P | GO:0051151 | negative regulation of smooth muscle cell differentiation |
| 2. P | GO:0031782 | type 4 melanocortin receptor binding |
| 2. P | GO:0043406 | positive regulation of MAP kinase activity |
| 2. P | GO:0051673 | membrane disruption in another organism |
| 2. P | GO:0042474 | middle ear morphogenesis |
| 2. P | GO:0042060 | wound healing |
| 2. P | GO:0032438 | melanosome organization |
| 2. P | GO:0060259 | regulation of feeding behavior |
| 2. P | GO:0072540 | T-helper 17 cell lineage commitment |
| 2. P | GO:0019955 | cytokine binding |
| 2. P | GO:0042742 | defense response to bacterium |
| 2. P | GO:0045779 | negative regulation of bone resorption |
| 2. P | GO:0042310 | vasoconstriction |
| 2. P | GO:0005138 | interleukin-6 receptor binding |
| 2. P | GO:0048714 | positive regulation of oligodendrocyte differentiation |
| 2. P | GO:0050830 | defense response to Gram-positive bacterium |
| 2. P | GO:0060394 | negative regulation of pathway-restricted SMAD protein phosphorylation |
| 2. P | GO:0060425 | lung morphogenesis |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q86UD1 | Out at first protein homolog | 0 | 3.79e-157 | 0.0 |
| 1. PB | Q8QZR4 | Out at first protein homolog | 0.00e+00 | 7.13e-43 | 5.93e-165 |
| 1. PB | O18638 | Out at first protein | 0.00e+00 | 6.17e-10 | 1.26e-63 |
| 1. PB | Q6AYE5 | Out at first protein homolog | 0.00e+00 | 3.39e-41 | 5.42e-162 |
| 1. PB | Q6GPK2 | Out at first protein homolog | 0.00e+00 | 5.36e-22 | 1.20e-120 |
| 1. PB | Q71SY6 | Out at first protein homolog | 0.00e+00 | 1.16e-44 | 1.68e-135 |
| 2. P | D2Y265 | U11-theraphotoxin-Hhn1a | 9.52e-01 | 4.05e-02 | NA |
| 2. P | D2Y284 | U11-theraphotoxin-Hhn1n | 9.25e-01 | 2.33e-03 | NA |
| 2. P | O93525 | Noggin | 8.53e-01 | 1.80e-02 | NA |
| 2. P | W4VSA5 | U16-barytoxin-Tl1f | 9.71e-01 | 1.11e-02 | NA |
| 2. P | Q1XGV1 | Agouti-signaling protein | 6.92e-01 | 2.10e-04 | NA |
| 2. P | Q9YHT8 | Noggin | 6.16e-01 | 1.48e-04 | NA |
| 2. P | A8CEM0 | Agouti-signaling protein | 7.06e-01 | 1.90e-04 | NA |
| 2. P | D2Y286 | U11-theraphotoxin-Hhn1p | 9.46e-01 | 1.56e-02 | NA |
| 2. P | A1YL74 | Agouti-signaling protein | 6.72e-01 | 3.65e-04 | NA |
| 2. P | A0A1B0GTR0 | Epididymal protein 13 | 8.09e-01 | 3.42e-08 | NA |
| 2. P | D2Y291 | U11-theraphotoxin-Hhn1u | 9.52e-01 | 4.07e-03 | NA |
| 2. P | Q4KM46 | Interleukin-34 | 8.31e-01 | 7.26e-06 | NA |
| 2. P | A1YL68 | Agouti-signaling protein | 7.74e-01 | 9.38e-06 | NA |
| 2. P | Q5GAN6 | Inactive ribonuclease-like protein 10 | 3.83e-01 | 2.37e-05 | NA |
| 2. P | W4VRY9 | U9-barytoxin-Tl1a | NA | 2.72e-07 | NA |
| 2. P | Q4VK74 | Interferon lambda-2 | 4.54e-01 | 3.41e-04 | NA |
| 2. P | A1YL82 | Agouti-signaling protein | NA | 1.26e-03 | NA |
| 2. P | A6QL48 | Interleukin-34 | 7.06e-01 | 4.88e-04 | NA |
| 2. P | Q9I9H4 | Somatolactin | 8.92e-01 | 1.28e-02 | NA |
| 2. P | A1YL67 | Agouti-signaling protein | 7.05e-01 | 1.90e-04 | NA |
| 2. P | Q8TAA1 | Probable ribonuclease 11 | 4.17e-01 | 8.16e-03 | NA |
| 2. P | Q8CGK6 | Interferon lambda-3 | 4.13e-01 | 1.66e-02 | NA |
| 2. P | Q1XGU6 | Agouti-signaling protein | 6.55e-01 | 3.65e-04 | NA |
| 2. P | Q1XGU8 | Agouti-signaling protein | 7.02e-01 | 1.35e-04 | NA |
| 2. P | W4VS08 | U17-barytoxin-Tl1d | 9.85e-01 | 1.75e-04 | NA |
| 2. P | A1YL72 | Agouti-signaling protein | 7.21e-01 | 3.65e-04 | NA |
| 2. P | O26903 | UPF0305 protein MTH_812 | 8.60e-01 | 2.13e-02 | NA |
| 2. P | Q9DA16 | Izumo sperm-egg fusion protein 2 | 9.45e-01 | 7.83e-03 | NA |
| 2. P | D2Y276 | U11-theraphotoxin-Hhn1f | 9.54e-01 | 1.80e-02 | NA |
| 2. P | Q5UK76 | Agouti-signaling protein | 7.53e-01 | 1.44e-03 | NA |
| 2. P | D2Y293 | U11-theraphotoxin-Hhn1a | 9.47e-01 | 4.20e-03 | NA |
| 2. P | A8CEN1 | Agouti-signaling protein | 7.47e-01 | 4.59e-05 | NA |
| 2. P | Q29414 | Agouti-signaling protein | 6.38e-01 | 3.99e-03 | NA |
| 2. P | A6YB85 | Alpha-defensin 1 | 5.91e-01 | 1.20e-02 | NA |
| 2. P | D2Y260 | U11-theraphotoxin-Hhn1a | 9.53e-01 | 2.11e-02 | NA |
| 2. P | A1YL66 | Agouti-signaling protein | 5.70e-01 | 2.10e-04 | NA |
| 2. P | P42127 | Agouti-signaling protein | 4.46e-01 | 1.53e-04 | NA |
| 2. P | D2Y259 | U11-theraphotoxin-Hhn1a | 9.49e-01 | 1.69e-02 | NA |
| 2. P | D2Y290 | U11-theraphotoxin-Hhn1t | 9.59e-01 | 3.20e-02 | NA |
| 2. P | Q03288 | Agouti-signaling protein | 7.97e-01 | 5.34e-03 | NA |
| 2. P | P86718 | Spiderine-2a | 9.10e-01 | 1.20e-02 | NA |
| 2. P | A0A125S9G0 | Conotoxin Im026 | 9.69e-01 | 7.44e-03 | NA |
| 2. P | Q6L6X6 | Interleukin-6 | 6.36e-01 | 1.52e-03 | NA |
| 2. P | B3IXK1 | Interferon gamma | 9.49e-01 | 8.33e-03 | NA |
| 2. P | B1P1H6 | U26-theraphotoxin-Cg1a | 9.86e-01 | 5.74e-03 | NA |
| 2. P | D2Y269 | U11-theraphotoxin-Hhn1a | 9.49e-01 | 2.45e-02 | NA |
| 2. P | D2Y272 | U11-theraphotoxin-Hhn1c | 9.57e-01 | 1.69e-03 | NA |
| 2. P | D2Y299 | U9-theraphotoxin-Hhn1a | 9.54e-01 | 2.93e-02 | NA |
| 2. P | A8CEM7 | Agouti-signaling protein | 7.58e-01 | 1.64e-03 | NA |
| 2. P | D2Y297 | U11-theraphotoxin-Hhn1a | 9.54e-01 | 5.34e-03 | NA |
| 2. P | Q6UXV1 | Izumo sperm-egg fusion protein 2 | 9.23e-01 | 2.64e-08 | NA |
| 2. P | P0DJK1 | Sarafotoxin-i2 | 8.16e-01 | 6.57e-04 | NA |
| 2. P | D2Y277 | U11-theraphotoxin-Hhn1g | 9.45e-01 | 7.14e-03 | NA |
| 2. P | Q1XGV7 | Agouti-signaling protein | 5.69e-01 | 3.53e-04 | NA |
| 2. P | W4VRU8 | U16-barytoxin-Tl1b | 9.73e-01 | 3.13e-03 | NA |
| 2. P | A8CEM4 | Agouti-signaling protein | 7.16e-01 | 6.01e-05 | NA |
| 2. P | P58457 | Kalata-B7 | 8.65e-01 | 9.53e-04 | NA |
| 2. P | W4VSI3 | U16-barytoxin-Tl1f | 9.54e-01 | 2.56e-03 | NA |
| 2. P | P56388 | Cocaine- and amphetamine-regulated transcript protein | 9.69e-01 | 2.73e-02 | NA |
| 2. P | A8CEM9 | Agouti-signaling protein | 7.42e-01 | 4.59e-05 | NA |
| 2. P | A1YL81 | Agouti-signaling protein | NA | 1.26e-03 | NA |
| 2. P | W4VRY7 | U13-barytoxin-Tl1a | NA | 3.10e-03 | NA |
| 2. P | A1YL79 | Agouti-signaling protein | 7.78e-01 | 4.87e-03 | NA |
| 2. P | D2Y275 | U11-theraphotoxin-Hhn1f | 9.51e-01 | 1.26e-02 | NA |
| 2. P | D2Y2I0 | U11-theraphotoxin-Hhn1w | 9.35e-01 | 2.97e-03 | NA |
| 2. P | Q6UX46 | ALK and LTK ligand 2 | 8.94e-01 | 3.41e-03 | NA |
| 2. P | B1NRR3 | Cyclotide vitri-A (Fragment) | 6.29e-01 | 1.80e-02 | NA |
| 2. P | D2Y295 | U11-theraphotoxin-Hhn1a | 9.60e-01 | 2.09e-02 | NA |
| 2. P | P56473 | Agouti-related protein | 7.80e-01 | 4.87e-05 | NA |
| 2. P | A1YL69 | Agouti-signaling protein | 6.38e-01 | 6.01e-05 | NA |
| 2. P | D2Y263 | U11-theraphotoxin-Hhn1a | 9.49e-01 | 2.76e-02 | NA |
| 2. P | D2Y273 | U11-theraphotoxin-Hhn1d | 9.55e-01 | 4.46e-02 | NA |
| 2. P | Q3BK14 | Disintegrin lebestatin | 9.31e-01 | 4.09e-02 | NA |
| 2. P | P56413 | Agouti-related protein | 9.01e-01 | 1.07e-08 | NA |
| 2. P | P97466 | Noggin | 7.34e-01 | 9.12e-04 | NA |
| 2. P | P49112 | Neutrophil cationic peptide 2 | 9.22e-01 | 1.52e-02 | NA |
| 2. P | D2Y294 | U11-theraphotoxin-Hhn1a | 9.47e-01 | 4.82e-02 | NA |
| 2. P | Q62716 | Neutrophil antibiotic peptide NP-1 | 8.79e-01 | 5.69e-03 | NA |
| 2. P | B1NRQ9 | Cyclotide vibi-I (Fragment) | 7.91e-01 | 3.60e-02 | NA |
| 2. P | Q6ZYM3 | Agouti-signaling protein | 5.11e-01 | 1.95e-02 | NA |
| 2. P | D2Y2H9 | U11-theraphotoxin-Hhn1v | 9.48e-01 | 6.85e-03 | NA |
| 2. P | Q62715 | Neutrophil antibiotic peptide NP-2 | 9.05e-01 | 1.37e-02 | NA |
| 2. P | Q1XGV3 | Agouti-signaling protein | 6.13e-01 | 1.90e-04 | NA |
| 2. P | A1YL70 | Agouti-signaling protein | 7.31e-01 | 2.10e-04 | NA |
| 2. P | D2Y253 | U11-theraphotoxin-Hhn1a | 9.52e-01 | 1.14e-02 | NA |
| 2. P | W4VRU6 | U16-barytoxin-Tl1c | 9.86e-01 | 2.70e-02 | NA |
| 2. P | A8CEM8 | Agouti-signaling protein | 7.45e-01 | 6.99e-05 | NA |
| 2. P | D2Y298 | U11-theraphotoxin-Hhn1a | 9.50e-01 | 1.75e-02 | NA |
| 2. P | Q1XGU9 | Agouti-signaling protein | 6.58e-01 | 2.46e-04 | NA |
| 2. P | O00253 | Agouti-related protein | 5.70e-01 | 4.93e-05 | NA |
| 2. P | W4VRW6 | U16-barytoxin-Tl1c | 9.70e-01 | 1.90e-03 | NA |
| 2. P | D2Y281 | U11-theraphotoxin-Hhn1k | 9.48e-01 | 2.07e-02 | NA |
| 2. P | A1YL77 | Agouti-signaling protein | 7.71e-01 | 3.10e-03 | NA |
| 2. P | A8CEN3 | Agouti-signaling protein | 5.14e-01 | 8.82e-05 | NA |
| 2. P | D2Y280 | U11-theraphotoxin-Hhn1j | 9.52e-01 | 7.99e-03 | NA |
| 2. P | A1YL80 | Agouti-signaling protein | 7.28e-01 | 3.10e-03 | NA |
| 2. P | W4VS15 | U16-barytoxin-Tl1c | 9.72e-01 | 1.98e-03 | NA |
| 2. P | Q1XGV5 | Agouti-signaling protein | 5.82e-01 | 3.53e-04 | NA |
| 2. P | D2Y288 | U11-theraphotoxin-Hhn1r | 9.77e-01 | 2.22e-02 | NA |
| 2. P | Q13253 | Noggin | 7.75e-01 | 8.55e-04 | NA |
| 2. P | B2RZ42 | ALK and LTK ligand 2 | 8.96e-01 | 3.51e-06 | NA |
| 2. P | D2Y274 | U11-theraphotoxin-Hhn1e | 9.53e-01 | 3.17e-03 | NA |
| 2. P | A8CEM1 | Agouti-signaling protein | 4.75e-01 | 2.13e-04 | NA |
| 2. P | Q8R1R4 | Interleukin-34 | 7.20e-01 | 1.35e-03 | NA |
| 2. P | Q5BHG4 | Lactobacillus up-regulated protein | 3.01e-01 | 2.28e-03 | NA |
| 2. P | A8CEM5 | Agouti-signaling protein | 7.36e-01 | 4.59e-05 | NA |
| 2. P | Q865F0 | Agouti-signaling protein | 7.05e-01 | 2.36e-04 | NA |
| 2. P | P11478 | Neutrophil cationic peptide 1 type A | 8.74e-01 | 1.80e-02 | NA |
| 2. P | Q9QXX2 | Interferon gamma | 9.68e-01 | 3.82e-02 | NA |
| 2. P | D2Y2P8 | U11-theraphotoxin-Hhn1b | 9.67e-01 | 1.63e-02 | NA |
| 2. P | Q64365 | Neutrophil cationic peptide 1 type B | 9.46e-01 | 3.04e-02 | NA |
| 2. P | Q1XGV4 | Agouti-signaling protein | 7.53e-01 | 7.74e-04 | NA |
| 2. P | D2Y254 | U11-theraphotoxin-Hhn1a | 9.50e-01 | 8.16e-03 | NA |
| 2. P | D2Y255 | U11-theraphotoxin-Hhn1a | 9.47e-01 | 1.95e-02 | NA |
| 2. P | Q1XGV6 | Agouti-signaling protein | 5.70e-01 | 3.53e-04 | NA |
| 2. P | D2Y279 | U11-theraphotoxin-Hhn1i | 9.68e-01 | 3.04e-02 | NA |
| 2. P | W4VRV3 | U12-barytoxin-Tl1a | 9.68e-01 | 9.74e-04 | NA |
| 2. P | D2Y2I2 | U11-theraphotoxin-Hhn1a | 9.51e-01 | 9.81e-03 | NA |
| 2. P | Q9W740 | Noggin-2 | 6.57e-01 | 3.67e-03 | NA |
| 2. P | P0DJK0 | Sarafotoxin-i1 | 9.01e-01 | 5.74e-03 | NA |
| 2. P | W4VSI4 | U16-barytoxin-Tl1d | 9.90e-01 | 2.70e-03 | NA |
| 2. P | D2Y268 | U11-theraphotoxin-Hhn1a | 9.48e-01 | 3.46e-02 | NA |
| 2. P | Q9TU18 | Agouti-related protein | 8.32e-01 | 1.05e-05 | NA |
| 2. P | K7N5K9 | U1-theraphotoxin-Sp1a | 8.75e-01 | 3.29e-02 | NA |
| 2. P | A1YL78 | Agouti-signaling protein | 7.67e-01 | 3.10e-03 | NA |
| 2. P | Q1XGU7 | Agouti-signaling protein | 7.12e-01 | 3.65e-04 | NA |
| 2. P | Q1XGU5 | Agouti-signaling protein | 7.36e-01 | 4.31e-04 | NA |
| 2. P | Q6ZMJ4 | Interleukin-34 | 5.79e-01 | 6.85e-03 | NA |
| 2. P | D2Y261 | U11-theraphotoxin-Hhn1a | 9.50e-01 | 8.24e-03 | NA |
| 2. P | Q8CJ42 | Prolactin-7B1 | 7.66e-01 | 2.13e-02 | NA |
| 2. P | P0C8A9 | Defensin-B5 | 8.56e-01 | 5.18e-03 | NA |
| 2. P | D2Y264 | U11-theraphotoxin-Hhn1a | 9.62e-01 | 8.24e-03 | NA |
| 2. P | Q80UG6 | ALK and LTK ligand 2 | 8.86e-01 | 1.32e-04 | NA |
| 2. P | D2Y285 | U11-theraphotoxin-Hhn1o | 9.31e-01 | 7.51e-03 | NA |
| 2. P | D2Y287 | U11-theraphotoxin-Hhn1q | 9.50e-01 | 1.29e-02 | NA |
| 2. P | P79407 | Agouti-signaling protein | 7.02e-01 | 3.34e-03 | NA |
| 2. P | D2Y267 | U11-theraphotoxin-Hhn1a | 9.53e-01 | 8.59e-03 | NA |
| 2. P | D2Y271 | U11-theraphotoxin-Hhn1b | 9.66e-01 | 7.99e-03 | NA |
| 2. P | D2Y270 | U11-theraphotoxin-Hhn1a | 9.47e-01 | 3.17e-02 | NA |
| 2. P | P86719 | Spiderine-2b | 8.99e-01 | 7.29e-03 | NA |
| 2. P | Q1XGV2 | Agouti-signaling protein | 6.41e-01 | 4.59e-05 | NA |
| 2. P | W4VSI1 | U17-barytoxin-Tl1d | 9.89e-01 | 2.33e-04 | NA |
| 2. P | Q1XGV0 | Agouti-signaling protein | 7.12e-01 | 2.10e-04 | NA |
| 3. B | Q9NLA6 | Out at first protein | NA | NA | 6.81e-63 |