Summary

Q86UF4

Homolog: Q3URK1.
Function: Coiled-coil domain-containing protein 190.

Statistics

Total GO Annotation: 78
Unique PROST Go: 78
Unique BLAST Go: 0

Total Homologs: 33
Unique PROST Homologs: 30
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q3URK1 (Coiled-coil domain-containing protein 190) with a FATCAT P-Value: 5.55e-07 and RMSD of 5.01 angstrom. The sequence alignment identity is 54.4%.
Structural alignment shown in left. Query protein Q86UF4 colored as red in alignment, homolog Q3URK1 colored as blue. Query protein Q86UF4 is also shown in right top, homolog Q3URK1 showed in right bottom. They are colored based on secondary structures. 

  Q86UF4 MERHMVRGQLYKHFDLERKNAKQAEARLDQRLQRLKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPEDVLVF-SPQGRQKHRAP 99
  Q3URK1 MDRSMVKGPLYKQFDLERKSARQAEARLSLRLQRLEIICLYHVKSLAREQRQLQKELQRLQQ-DIIKKRFSSYVGHEIQKRSKDVVTFLPPTG-QRHAVP 98

  Q86UF4 QAKKMRALATRMAQDTCKSKSQVP-PS-HDAGLKDPMKSKKQPLSQNNRTACFIKE-QPQAQEKDSVNPSKDVDPSKGISVPCQNQEVSTN-TIEQGPSS 195
  Q3URK1 E-PKIRTLKNSVTQEV-KTK--IPVPSLHDPVLKDTLRSQEHLLSHGERTSCF-KEGSPQGQEGEPTNPLKGVDPSKDVSVPCHDQELSTNKTEDSGVSS 193

  Q86UF4 SPASDSGMACADETRSKDVALKPDGNTGKQIPPKHMECAGSFEGEFTKPTFLELLSKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRV 295
  Q3URK1 QD-GERGSAPANETRSENASQKPRGDADVQNSPSSVDYAGSFKDERTKPSFLELFEKAKNAHYVRHRVPPESERLLSIGEIFGHKHYSLPRTGETL---- 288

  Q86UF4 PSKFLPL 302
  Q3URK1 ------- 288

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
2. P GO:0010369 chromocenter
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0005876 spindle microtubule
2. P GO:0000122 negative regulation of transcription by RNA polymerase II
2. P GO:0031110 regulation of microtubule polymerization or depolymerization
2. P GO:0005521 lamin binding
2. P GO:0031106 septin ring organization
2. P GO:0032488 Cdc42 protein signal transduction
2. P GO:0043709 cell adhesion involved in single-species biofilm formation
2. P GO:0071962 mitotic sister chromatid cohesion, centromeric
2. P GO:0010847 regulation of chromatin assembly
2. P GO:1903251 multi-ciliated epithelial cell differentiation
2. P GO:1903243 negative regulation of cardiac muscle hypertrophy in response to stress
2. P GO:0070822 Sin3-type complex
2. P GO:0030010 establishment of cell polarity
2. P GO:0043486 histone exchange
2. P GO:0060026 convergent extension
2. P GO:0007141 male meiosis I
2. P GO:0045171 intercellular bridge
2. P GO:0031274 positive regulation of pseudopodium assembly
2. P GO:0051321 meiotic cell cycle
2. P GO:0030496 midbody
2. P GO:0033698 Rpd3L complex
2. P GO:0005634 nucleus
2. P GO:2000217 regulation of invasive growth in response to glucose limitation
2. P GO:0007099 centriole replication
2. P GO:0030838 positive regulation of actin filament polymerization
2. P GO:1900114 positive regulation of histone H3-K9 trimethylation
2. P GO:0098535 de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P GO:0007266 Rho protein signal transduction
2. P GO:0061186 negative regulation of silent mating-type cassette heterochromatin assembly
2. P GO:0007096 regulation of exit from mitosis
2. P GO:0070210 Rpd3L-Expanded complex
2. P GO:0000070 mitotic sister chromatid segregation
2. P GO:0007059 chromosome segregation
2. P GO:0045132 meiotic chromosome segregation
2. P GO:0007281 germ cell development
2. P GO:0051301 cell division
2. P GO:0000775 chromosome, centromeric region
2. P GO:0007051 spindle organization
2. P GO:0098536 deuterosome
2. P GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
2. P GO:0042995 cell projection
2. P GO:1990837 sequence-specific double-stranded DNA binding
2. P GO:0019901 protein kinase binding
2. P GO:0061408 positive regulation of transcription from RNA polymerase II promoter in response to heat stress
2. P GO:0030466 silent mating-type cassette heterochromatin assembly
2. P GO:0010944 negative regulation of transcription by competitive promoter binding
2. P GO:0000278 mitotic cell cycle
2. P GO:0043332 mating projection tip
2. P GO:1900111 positive regulation of histone H3-K9 dimethylation
2. P GO:0001042 RNA polymerase I core binding
2. P GO:0051276 chromosome organization
2. P GO:0001741 XY body
2. P GO:0000940 outer kinetochore
2. P GO:0110029 negative regulation of meiosis I
2. P GO:0005813 centrosome
2. P GO:0016575 histone deacetylation
2. P GO:0030030 cell projection organization
2. P GO:0010614 negative regulation of cardiac muscle hypertrophy
2. P GO:0005694 chromosome
2. P GO:0061188 negative regulation of ribosomal DNA heterochromatin assembly
2. P GO:0070121 Kupffer's vesicle development
2. P GO:0031981 nuclear lumen
2. P GO:0031939 obsolete negative regulation of chromatin silencing at telomere
2. P GO:0000131 incipient cellular bud site
2. P GO:0005934 cellular bud tip
2. P GO:0000776 kinetochore
2. P GO:0051233 spindle midzone
2. P GO:0007548 sex differentiation
2. P GO:0007290 spermatid nucleus elongation
2. P GO:0005730 nucleolus
2. P GO:0032133 chromosome passenger complex
2. P GO:0032298 positive regulation of DNA-dependent DNA replication initiation
2. P GO:0051225 spindle assembly
2. P GO:0005684 U2-type spliceosomal complex
2. P GO:0070868 obsolete heterochromatin organization involved in chromatin silencing

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q1RMX6 Coiled-coil domain-containing protein 190 8.54e-06 3.02e-33 1.07e-126
1. PB Q3URK1 Coiled-coil domain-containing protein 190 5.55e-07 2.37e-39 2.17e-103
1. PB Q86UF4 Coiled-coil domain-containing protein 190 0 2.61e-147 0.0
2. P O74517 Protein saf1 1.24e-01 1.73e-05 NA
2. P P38785 GTPase-interacting component 1 9.98e-02 6.19e-05 NA
2. P Q8CGW9 Doublesex- and mab-3-related transcription factor C2 2.07e-02 3.27e-04 NA
2. P Q4V7H8 Borealin-2 2.80e-02 4.53e-03 NA
2. P F7DP49 Deuterosome assembly protein 1 8.43e-03 2.98e-02 NA
2. P Q4KLP8 Shugoshin 1 1.62e-02 2.14e-04 NA
2. P P46676 Suppressor of mar1-1 protein 1.08e-01 2.92e-03 NA
2. P Q6AXW0 Borealin 3.44e-03 4.21e-05 NA
2. P Q80WR5 UPF0688 protein C1orf174 homolog 5.09e-02 3.12e-02 NA
2. P Q5ZK13 Centrosomal protein kizuna 9.15e-03 8.12e-09 NA
2. P Q2M2Z5 Centrosomal protein kizuna 5.71e-02 3.50e-05 NA
2. P P40505 Transcriptional regulatory protein SDS3 3.80e-03 7.91e-04 NA
2. P Q66HF9 Leucine-rich repeat flightless-interacting protein 1 2.23e-02 2.70e-02 NA
2. P Q68D10 Protein SPT2 homolog 6.77e-01 3.89e-02 NA
2. P Q8BHX3 Borealin 6.61e-03 6.35e-06 NA
2. P Q8IXT2 Doublesex- and mab-3-related transcription factor C2 6.99e-03 2.68e-02 NA
2. P P86346 Borealin 4.05e-02 4.35e-03 NA
2. P P03333 Gag polyprotein NA 1.73e-02 NA
2. P Q10310 Meiotically up-regulated gene 68 protein 1.76e-01 8.88e-03 NA
2. P B1H1S4 Spindle and kinetochore-associated protein 3 1.55e-02 3.44e-02 NA
2. P Q9JM96 Cdc42 effector protein 4 2.17e-01 5.43e-03 NA
2. P P86347 Borealin-2 7.16e-03 1.68e-02 NA
2. P O94243 Meiotically up-regulated gene 9 protein 4.40e-01 8.52e-04 NA
2. P Q5FW52 Muscular LMNA-interacting protein 3.33e-01 8.88e-03 NA
2. P Q0V9F7 Borealin-2 1.19e-02 1.53e-04 NA
2. P A8MWA6 Putative protein FAM90A22P 1.10e-01 2.86e-02 NA
2. P Q3UXL4 Centrosomal protein kizuna 2.07e-02 6.78e-05 NA
2. P B7SXM5 Immediate early response gene 2 protein 2.75e-02 1.43e-02 NA
2. P B0BM16 Spindle and kinetochore-associated protein 3 6.62e-03 1.27e-02 NA
2. P P0CB21 Uncharacterized protein At4g26450 4.79e-01 3.13e-04 NA