Summary

Q86V59

Homolog: Q5R6R8.
Function: Paraneoplastic antigen-like protein 8A.

Statistics

Total GO Annotation: 47
Unique PROST Go: 29
Unique BLAST Go: 16

Total Homologs: 59
Unique PROST Homologs: 31
Unique BLAST Homologs: 23

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q5R6R8 (Paraneoplastic antigen-like protein 8A) with a FATCAT P-Value: 1.23e-11 and RMSD of 3.89 angstrom. The sequence alignment identity is 96.8%.
Structural alignment shown in left. Query protein Q86V59 colored as red in alignment, homolog Q5R6R8 colored as blue. Query protein Q86V59 is also shown in right top, homolog Q5R6R8 showed in right bottom. They are colored based on secondary structures. 

  Q86V59 MSKTMAMNLLEDWCRGMEVDIHRSLLVTGIPEDCGQAEIEETLNGVLSPLGPYRVLNKIFVREENVKAALIEVGEGVNLSTIPREFPGRGGVWRVVCRDP 100
  Q5R6R8 MSKTMAMNLLEDWCRGMEVDIHRSLLVTGIPEDCGQAEIEETLNGVLAPLGPYRVLNKIFVREENVKAALIEVGEGVNLSTIPREFPGRGGVWRVVCRDP 100

  Q86V59 TQDAEFLKNLNEFLDAEGRTWEDVVRLLQLNHPTLSQNQHQPPENWAEALGVLLGAVVQIIFCMDAEIRSREEARAQEAAEFEEMAAWALAAGRKVKKEP 200
  Q5R6R8 TQDAEFLKNLNEFLDAEGRTWEDVVRLLQLNHPTLSQNQHQPPENWAEALGVLLGAVVQIIFCMDAEIRSREEARAQEAAEFEEMAAWALAAGKKVKKEP 200

  Q86V59 GLAAEVGSALKAETPNNWNATEDQHEPTKPLVRRAGAKSRSRRKKQKKNSRQEAVPWKKPKGINSNSTANLEDPEVGDAESMAISEPIKGSRKPCVNKEE 300
  Q5R6R8 GLAAEVGSALKAETPNNWNATEDQHDPPKPLVRRAGAKSRSRRKKQKKNPKQEAVPWKKPKGINSSSTANLEDPEVGDAESMAISEPIKGSRKPCVKQEE 300

  Q86V59 LALKKPMAKCAWKGPREPPQDARAEAESPGGASESDQDGGHESPPKKKAVAWVSAKNPAPMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREAS 400
  Q5R6R8 LALKKPMAKCAWKGPREPPQDAQAEAESPGGASESDQDGGHESPPKKKAMAWVSAKNPAPMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREAS 400

  Q86V59 DQKAPRGQQPAEATASTSRGPKAKPEGSPRRATNESRKV 439
  Q5R6R8 VQKAPQGQQPAEATASTSRGPRAKPEGSPRRATNESRKV 439

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005730 nucleolus
1. PB GO:0005654 nucleoplasm
2. P GO:0006370 7-methylguanosine mRNA capping
2. P GO:0042273 ribosomal large subunit biogenesis
2. P GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
2. P GO:0009414 response to water deprivation
2. P GO:0000407 phagophore assembly site
2. P GO:0051028 mRNA transport
2. P GO:1990316 Atg1/ULK1 kinase complex
2. P GO:0035145 exon-exon junction complex
2. P GO:0005634 nucleus
2. P GO:0000340 RNA 7-methylguanosine cap binding
2. P GO:0048571 long-day photoperiodism
2. P GO:0042162 telomeric DNA binding
2. P GO:0016607 nuclear speck
2. P GO:0003723 RNA binding
2. P GO:0031588 nucleotide-activated protein kinase complex
2. P GO:0000339 RNA cap binding
2. P GO:0070478 nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay
2. P GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
2. P GO:0009863 salicylic acid mediated signaling pathway
2. P GO:0017056 structural constituent of nuclear pore
2. P GO:0045727 positive regulation of translation
2. P GO:0000045 autophagosome assembly
2. P GO:0003729 mRNA binding
2. P GO:0034451 centriolar satellite
2. P GO:0048026 positive regulation of mRNA splicing, via spliceosome
2. P GO:0009867 jasmonic acid mediated signaling pathway
2. P GO:0031490 chromatin DNA binding
2. P GO:0080090 regulation of primary metabolic process
3. B GO:0090200 positive regulation of release of cytochrome c from mitochondria
3. B GO:0005813 centrosome
3. B GO:0007088 regulation of mitotic nuclear division
3. B GO:0005829 cytosol
3. B GO:0097190 apoptotic signaling pathway
3. B GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand
3. B GO:0002437 inflammatory response to antigenic stimulus
3. B GO:0000226 microtubule cytoskeleton organization
3. B GO:0031625 ubiquitin protein ligase binding
3. B GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors
3. B GO:0005741 mitochondrial outer membrane
3. B GO:1990393 3M complex
3. B GO:0042981 regulation of apoptotic process
3. B GO:0001844 protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
3. B GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
3. B GO:0043065 positive regulation of apoptotic process

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q86V59 Paraneoplastic antigen-like protein 8A 0 5.66e-148 0.0
1. PB A7E321 Paraneoplastic antigen-like protein 8A 2.56e-07 3.74e-39 0.0
1. PB Q5R6R8 Paraneoplastic antigen-like protein 8A 1.23e-11 2.95e-92 0.0
1. PB Q80VM8 Paraneoplastic antigen-like protein 8A 3.22e-08 1.62e-43 8.70e-159
1. PB Q9ULN7 Paraneoplastic antigen-like protein 8B 1.67e-01 4.23e-06 2.61e-28
2. P Q8K2X2 RNA-binding protein 48 1.73e-01 7.37e-04 NA
2. P A2A3V1 A-kinase anchor protein 17B 1.08e-01 3.75e-02 NA
2. P Q9BZI7 Regulator of nonsense transcripts 3B 1.67e-02 1.11e-06 NA
2. P Q8BZR9 Nuclear cap-binding protein subunit 3 2.86e-01 3.60e-03 NA
2. P Q5RL73 RNA-binding protein 48 7.58e-02 4.33e-06 NA
2. P E7Q4T7 Cruciform DNA-recognizing protein 1 NA 4.42e-02 NA
2. P Q9VWD4 Probable RNA-binding protein CG14230 1.19e-01 1.51e-02 NA
2. P A6ZRR2 Signal transduction protein MDG1 1.64e-01 1.68e-03 NA
2. P Q8RWN5 Glycine-rich RNA-binding protein RZ1C 1.74e-01 4.80e-02 NA
2. P A2QWA6 Autophagy-related protein 13 2.84e-01 1.98e-02 NA
2. P Q9AST1 Transcription initiation factor TFIID subunit 15 4.56e-02 5.17e-03 NA
2. P Q5R4U2 RNA-binding protein 48 2.43e-01 1.53e-04 NA
2. P C8ZG55 Signal transduction protein MDG1 4.46e-02 8.51e-04 NA
2. P B0S733 Regulator of nonsense transcripts 3A 6.23e-02 1.86e-05 NA
2. P B3LP25 Signal transduction protein MDG1 2.57e-01 1.18e-03 NA
2. P Q9FVW4 Regulator of nonsense transcripts UPF3 1.59e-01 2.98e-15 NA
2. P A4FVJ7 RNA-binding protein 48 1.24e-01 4.93e-07 NA
2. P Q5VYV7 Protein SLX4IP 2.11e-02 5.93e-03 NA
2. P Q1E891 Autophagy-related protein 13 3.20e-01 3.30e-02 NA
2. P Q9H1J1 Regulator of nonsense transcripts 3A 1.42e-02 7.38e-05 NA
2. P Q5ZM19 Nuclear cap-binding protein subunit 3 5.92e-01 9.68e-03 NA
2. P E7NIP0 Cruciform DNA-recognizing protein 1 5.82e-02 4.71e-02 NA
2. P Q9HFE6 Uncharacterized RNA-binding protein P16F5.06 1.21e-02 1.28e-02 NA
2. P P53885 Signal transduction protein MDG1 2.07e-01 8.51e-04 NA
2. P Q561R3 RNA-binding protein 48 8.42e-02 3.92e-04 NA
2. P A6QPE1 RNA-binding protein 48 9.39e-02 2.00e-07 NA
2. P Q10267 Nonsense-mediated mRNA decay protein 3 8.63e-03 1.43e-06 NA
2. P Q6DFQ2 Nuclear cap-binding protein subunit 3 4.62e-01 1.19e-03 NA
2. P Q08287 60S ribosome subunit biogenesis protein NOP8 3.50e-01 3.94e-03 NA
2. P C7GTE8 Signal transduction protein MDG1 3.33e-01 1.28e-03 NA
2. P Q12044 Regulator of calcineurin 2 3.23e-01 5.30e-04 NA
3. B Q95KI4 Modulator of apoptosis 1 1.15e-04 NA 2.74e-35
3. B P62521 Coiled-coil domain-containing protein 8 2.54e-01 NA 1.10e-09
3. B Q8ND90 Paraneoplastic antigen Ma1 1.68e-04 NA 3.59e-41
3. B Q5DTT8 Paraneoplastic antigen-like protein 5 5.28e-02 NA 3.08e-23
3. B Q8VHZ4 Paraneoplastic antigen Ma1 homolog 8.32e-05 NA 2.75e-40
3. B Q9UL42 Paraneoplastic antigen Ma2 8.07e-05 NA 6.35e-35
3. B Q9GMU3 Paraneoplastic antigen Ma2 homolog 4.44e-03 NA 5.45e-35
3. B A0A0J9YX94 Paraneoplastic antigen Ma6F 3.19e-03 NA 2.51e-24
3. B Q9H0W5 Coiled-coil domain-containing protein 8 4.16e-02 NA 1.76e-10
3. B A0A1B0GUJ8 Paraneoplastic antigen-like protein 8C 2.82e-05 NA 1.13e-33
3. B Q9ERH6 Modulator of apoptosis 1 1.90e-04 NA 1.01e-31
3. B A6QLK5 Paraneoplastic antigen Ma1 homolog 1.74e-04 NA 4.15e-39
3. B Q8BHK0 Paraneoplastic antigen Ma2 homolog 1.23e-03 NA 6.72e-33
3. B Q5R486 Paraneoplastic antigen Ma2 homolog 3.97e-05 NA 4.23e-35
3. B Q96PV4 Paraneoplastic antigen-like protein 5 1.70e-03 NA 5.57e-35
3. B Q2KIT6 Paraneoplastic antigen Ma2 homolog 3.86e-05 NA 3.03e-34
3. B A0A0J9YXQ4 Paraneoplastic antigen Ma6E 8.60e-03 NA 6.75e-23
3. B Q96BY2 Modulator of apoptosis 1 1.14e-04 NA 8.24e-35
3. B Q9UL41 Paraneoplastic antigen Ma3 2.41e-03 NA 1.31e-33
3. B P0CW24 Paraneoplastic antigen-like protein 6A 3.29e-04 NA 1.92e-24
3. B Q8C1C8 Paraneoplastic antigen Ma1 homolog 8.76e-05 NA 1.45e-39
3. B D3YZV8 Coiled-coil domain-containing protein 8 homolog 1.35e-02 NA 1.19e-10
3. B Q8JZW8 Paraneoplastic antigen Ma3 homolog 2.47e-03 NA 7.54e-35