Summary

Q86V87

Homolog: Q0P4Q0.
Function: FHF complex subunit HOOK interacting protein 2B.

Statistics

Total GO Annotation: 35
Unique PROST Go: 27
Unique BLAST Go: 1

Total Homologs: 58
Unique PROST Homologs: 25
Unique BLAST Homologs: 24

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q0P4Q0 (FHF complex subunit HOOK interacting protein 2B) with a FATCAT P-Value: 0.0 and RMSD of 1.97 angstrom. The sequence alignment identity is 48.5%.
Structural alignment shown in left. Query protein Q86V87 colored as red in alignment, homolog Q0P4Q0 colored as blue. Query protein Q86V87 is also shown in right top, homolog Q0P4Q0 showed in right bottom. They are colored based on secondary structures. 

  Q86V87 MLSRLGALLQEAVGAREPSIDLLQAFVEHWKGITHYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQ---QAAAGE---------AGPCLEYLLQHKI 88
  Q0P4Q0 MWGRLGAFLQQAVETREPTQDLLQSFIQHWKGVTQYYLETSDESCPARETDIPWRLRQLIDILVFEESNNGSQLSSGDEEDSGAGSHAGPCMEYLLQHKI 100

  Q86V87 LETLCTLGKAEYPPGMRQQVFQFFSKVLAQVQHPLLHYLSVHRPVQKLLRLGGTASGSVTEKEEVQFTTVLCSKIQQDPELLAYIL-EGKKIVGRKKAC- 186
  Q0P4Q0 LETLCTLAKAEYPPGMRQQVLLFYSRLLAKVQRPLLHYLSVHRPVQKLIALAEDPVGATAQKEELQFLTAVCTKLEKDPSLLVHVLEEGS---GSRVRCS 197

  Q86V87 GEPTALPKDTTSHGDKDCSHDGAPARPQLDGESCGAQALNSHMPAETEELDGGTTESNLITSLLGLCQSKKSRVALKAQENLLLLVSMASPAAATYLVQS 286
  Q0P4Q0 G------------GEQ-------------DGET---EARN-HKP-----------RQNLFKALLRLCTCQKGRLCVRAREALLRVLHSAQQEGPVHLIVQ 257

  Q86V87 SACCPAIVRHLCQLYRSMPVFLDPADIATLEGISWRLPSAPSDEASFPGKE----ALAAFLGWFDYCDHLITEAHTVVADALAKAVAENFFVETLQPQLL 382
  Q0P4Q0 SKLSQYVTEHLCELHRCIPLSIHPCDITALQETDWRKDSG-SQESD--GMENAEAALQRFLCWVEYCDCLVRESHEVVAMEITRSIKEGYLQGILQPELL 354

  Q86V87 HVSEQSILTSTALLTAMLRQLR-SPALLREAVAFLLGTDRQPEAPGDNPHTLYAHLIGHCDHLSDEISITTLRLFEELLQKPHEGIIHSLVLRNLEGRPY 481
  Q0P4Q0 EVSELSILRSTAILTAVLHRFTATP-LLRQFLTFLFGDERGPETRGDRGSQLRSQLIQRCNHLSDEISLASLRLFEEILQMPEEIALHSLVIRNLETRSY 453

  Q86V87 VAWGSPEPESYE-DTLD----LEEDPYFTDSFLDSGFQTPAKP---RLAPATSYDGKTAVTE-IVNSFLCLVPEEAKTSAFLEETGYDTYVHDAYGLFQE 572
  Q0P4Q0 LAGGQDESRGQESETWDGAEELEEDPYFTDGFPDTGIRLPRSDNAHRTEPA----G----TEQWVKSFLSLVPEEIKSS----DTGYDGYLQDAIVQYRA 541

  Q86V87 CSSRVASWGWPLTP--TPLDPHEPERPFFEGHFLRVLFDRMSRILDQPYSLNLQVTSVLSRLALFPHPHIHEYLLDPYISLAPGCRSLFSVLVRVIGDLM 670
  Q0P4Q0 CCQQVAQWGWPVSSKGT---GH-SQQEFYEGHFMEVLLGRLGGILDQPYDVNLQVTSLLSRLALFPHPNLQEYLLNPFITLAPGARSLFSVLVRVVADLA 637

  Q86V87 QRIQRVPQFPGKLLLVRKQLTGQAPGEQLDHQTLLQGVVVLEEFCKELAAIAFVKFPPHDPRQNVSPAPEGQV 743
  Q0P4Q0 QRSLRVPDLQEMLLLVRRQLLANSANEQLNHVTLCRGAVVLEEFCKELAAAACV---THSP---V-----GF- 698

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0008333 endosome to lysosome transport
1. PB GO:0007032 endosome organization
1. PB GO:0007040 lysosome organization
1. PB GO:0005829 cytosol
1. PB GO:1905719 protein localization to perinuclear region of cytoplasm
1. PB GO:0045022 early endosome to late endosome transport
1. PB GO:0070695 FHF complex
2. P GO:0008540 proteasome regulatory particle, base subcomplex
2. P GO:0016020 membrane
2. P GO:1903358 regulation of Golgi organization
2. P GO:0070588 calcium ion transmembrane transport
2. P GO:0070209 ASTRA complex
2. P GO:0006511 ubiquitin-dependent protein catabolic process
2. P GO:0048820 hair follicle maturation
2. P GO:0005794 Golgi apparatus
2. P GO:0070682 proteasome regulatory particle assembly
2. P GO:0016197 endosomal transport
2. P GO:0044599 AP-5 adaptor complex
2. P GO:0016567 protein ubiquitination
2. P GO:0000502 proteasome complex
2. P GO:0019902 phosphatase binding
2. P GO:0060348 bone development
2. P GO:0005262 calcium channel activity
2. P GO:0007030 Golgi organization
2. P GO:0043248 proteasome assembly
2. P GO:0080008 Cul4-RING E3 ubiquitin ligase complex
2. P GO:0000139 Golgi membrane
2. P GO:0006893 Golgi to plasma membrane transport
2. P GO:0022624 proteasome accessory complex
2. P GO:0140627 ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
2. P GO:1990756 ubiquitin ligase-substrate adaptor activity
2. P GO:0031464 Cul4A-RING E3 ubiquitin ligase complex
2. P GO:0005654 nucleoplasm
2. P GO:0019899 enzyme binding
3. B GO:0015031 protein transport

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5W0V3 FHF complex subunit HOOK interacting protein 2A 3.33e-16 5.58e-32 0.0
1. PB Q66H54 FHF complex subunit HOOK interacting protein 1B 5.20e-09 1.00e-04 8.05e-10
1. PB A0JNG7 FHF complex subunit HOOK interacting protein 2A 0.00e+00 3.10e-36 0.0
1. PB Q86V87 FHF complex subunit HOOK interacting protein 2B 0 2.34e-129 0.0
1. PB Q80YR2 FHF complex subunit HOOK interacting protein 2B 0.00e+00 8.67e-80 0.0
1. PB A0JPF5 FHF complex subunit HOOK interacting protein 2B 0.00e+00 3.45e-44 0.0
1. PB Q0P4Q0 FHF complex subunit HOOK interacting protein 2B 0.00e+00 3.49e-40 0.0
1. PB A0JPG1 FHF complex subunit HOOK interacting protein 2A 2.22e-16 2.97e-36 0.0
1. PB Q8CDM8 FHF complex subunit HOOK interacting protein 2A 4.44e-16 1.34e-37 0.0
2. P Q0P5A6 26S proteasome non-ATPase regulatory subunit 5 1.26e-02 3.19e-04 NA
2. P Q9VYG1 26S proteasome non-ATPase regulatory subunit 5 1.30e-03 4.28e-02 NA
2. P B0G194 Dymeclin 1.96e-02 4.17e-03 NA
2. P Q8TEL6 Short transient receptor potential channel 4-associated protein 5.17e-03 9.58e-09 NA
2. P Q9JLV2 Short transient receptor potential channel 4-associated protein 1.07e-02 3.14e-09 NA
2. P O42972 UPF0588 membrane protein C20F10.02c 1.06e-02 3.86e-05 NA
2. P Q6PD19 Armadillo-like helical domain-containing protein 3 1.74e-02 1.59e-03 NA
2. P Q6DCP5 Protein saal1 1.46e-03 1.14e-03 NA
2. P Q5T2E6 Armadillo-like helical domain-containing protein 3 1.98e-02 1.08e-03 NA
2. P Q7KNA0 Dymeclin 2.25e-02 7.35e-05 NA
2. P Q6DCP6 Dymeclin 3.50e-02 2.94e-04 NA
2. P Q8CHY3 Dymeclin 1.78e-02 1.15e-04 NA
2. P Q6DCT2 Armadillo-like helical domain-containing protein 3 6.92e-03 5.11e-04 NA
2. P Q6NXR4 TELO2-interacting protein 2 4.99e-04 3.06e-03 NA
2. P B4F766 Dymeclin 1.63e-02 1.62e-03 NA
2. P Q16401 26S proteasome non-ATPase regulatory subunit 5 3.93e-03 2.97e-03 NA
2. P Q5ZLW3 Dymeclin 2.19e-02 7.96e-03 NA
2. P Q5IFJ8 26S proteasome non-ATPase regulatory subunit 5 5.54e-03 1.32e-03 NA
2. P Q8BJY1 26S proteasome non-ATPase regulatory subunit 5 6.13e-03 5.72e-04 NA
2. P Q6PGW3 Armadillo-like helical domain-containing protein 3 1.22e-02 3.13e-04 NA
2. P Q5RAW5 Dymeclin 2.32e-02 4.10e-02 NA
2. P Q28BM0 Dymeclin 1.78e-02 2.88e-04 NA
2. P Q293C2 Dymeclin 9.17e-03 1.05e-04 NA
2. P Q6NVK9 Protein saal1 1.07e-03 7.66e-04 NA
2. P Q3U829 AP-5 complex subunit zeta-1 2.17e-02 4.73e-02 NA
3. B Q8N612 FHF complex subunit HOOK interacting protein 1B 2.93e-08 NA 2.40e-08
3. B Q11187 FHIP family protein C05D11.8 3.24e-10 NA 1.60e-04
3. B Q5R8V2 FHF complex subunit HOOK interacting protein 1B 1.00e-03 NA 8.08e-10
3. B B0V207 FHF complex subunit HOOK interacting protein 1B 4.22e-06 NA 2.19e-07
3. B Q05DH4 FHF complex subunit HOOK interacting protein 1A 4.87e-06 NA 5.51e-11
3. B Q505K2 FHF complex subunit HOOK interacting protein 1A 1.91e-06 NA 5.02e-15
3. B A7YY62 FHF complex subunit HOOK interacting protein 1B 1.83e-07 NA 2.59e-08
3. B B4NXB9 FHIP family protein GE18198 5.52e-08 NA 2.84e-16
3. B B3NAN9 FHIP family protein GG24907 5.21e-08 NA 1.92e-16
3. B Q9VQK0 FHIP family protein CG3558 4.24e-08 NA 4.62e-18
3. B B5DI68 FHIP family protein GA25918 3.65e-08 NA 5.26e-16
3. B B3MLI0 FHIP family protein GF15501 1.67e-09 NA 4.85e-15
3. B Q3U2I3 FHF complex subunit HOOK interacting protein 1B 9.46e-07 NA 4.45e-10
3. B B4LQW4 FHIP family protein GJ17503 1.30e-07 NA 5.34e-15
3. B A7S6A1 FHIP family protein v1g243165 4.40e-09 NA 5.10e-08
3. B B4JQY3 FHIP family protein GH13096 7.48e-09 NA 2.18e-14
3. B B0X755 FHIP family protein CPIJ015043 1.60e-09 NA 1.08e-10
3. B B4KJS5 FHIP family protein GI14169 4.59e-07 NA 1.95e-14
3. B B4MTY2 FHIP family protein GK23746 8.85e-06 NA 6.21e-17
3. B A8XW52 FHIP family protein CBG19667 5.12e-07 NA 0.009
3. B B4G8N3 FHIP family protein GL19323 6.86e-08 NA 6.16e-16
3. B A8P7J8 FHIP family protein Bm1_18400 7.46e-05 NA 4.34e-04
3. B Q7PZ36 FHIP family protein AGAP011705 2.12e-09 NA 1.51e-08
3. B Q17AI4 FHIP family protein AAEL005291 9.11e-08 NA 2.87e-07