Results | PROST

Summary

Q86X40

Homolog: Q3TX51.
Function: Leucine-rich repeat-containing protein 28.

Statistics

Total GO Annotation: 647
Unique PROST Go: 100
Unique BLAST Go: 454

Total Homologs: 797
Unique PROST Homologs: 100
Unique BLAST Homologs: 605

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q3TX51 (Leucine-rich repeat-containing protein 28) with a FATCAT P-Value: 0.0 and RMSD of 0.95 angstrom. The sequence alignment identity is 89.9%.
Structural alignment shown in left. Query protein Q86X40 colored as red in alignment, homolog Q3TX51 colored as blue. Query protein Q86X40 is also shown in right top, homolog Q3TX51 showed in right bottom. They are colored based on secondary structures.

  Q86X40 MASELCKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQYLERLYMKRNSLTSLPENLAQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNAL 100
  Q3TX51 MASEICKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQHLERLYMKRNSLTTLPENLAQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNAL 100

  Q86X40 EIVCPEIGRLRALRHLRLANNQLQFLPPEVGDLKELQTLDISTNRLLTLPERLHMCLSLQYLTVDRNRLWYVPRHLCQLPSLNELSMAGNRLAFLPLDLG 200
  Q3TX51 EIVCPEIGGLRALRHLRLANNQLQFLPPEVGDLKELQTLDISSNRLLALPERLHLCLSLQYLTVDRNRLCCVPRHLCQLPSLNELSMAGNHLASLPIDLG 200

  Q86X40 RSRELQYVYVDNNIHLKGLPSYLYNKVIGCSGCGAPIQVSEVKLLSFSSGQRTVFLPAEVKAIGTEHDHVLPLQELAMRGLYHTYHSLLKDLNFLSPISL 300
  Q3TX51 RSRELQYVYVDNNIQLKGLPSYLYNKVIGCNGCGIPIQLSEVRLLTFSSGQLTVFLPAEVKTIGTEKDHVLPLQELTMRSLYRTYHGLWKDLNFLSPISL 300

  Q86X40 PRSLLELLHCPLGHCHRCSEPMFTIVYPKLFPLRETPMAGLHQWKTTVSFVAYCCSTQCLQTFDLLS 367
  Q3TX51 PRSLLELLHCPLGHCHLCSEPMFTFVYPKIFPLRETPMAGLHQRRTSIGFVAYCCSTQCLRTFNLLC 367

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0021540	corpus callosum morphogenesis
1. PB	GO:0010555	response to mannitol
1. PB	GO:0044300	cerebellar mossy fiber
1. PB	GO:0043198	dendritic shaft
1. PB	GO:0038131	neuregulin receptor activity
1. PB	GO:0032491	detection of molecule of fungal origin
1. PB	GO:0002718	regulation of cytokine production involved in immune response
1. PB	GO:0045121	membrane raft
1. PB	GO:0030424	axon
1. PB	GO:0007409	axonogenesis
1. PB	GO:0042043	neurexin family protein binding
1. PB	GO:0030517	negative regulation of axon extension
1. PB	GO:0002091	negative regulation of receptor internalization
1. PB	GO:0030426	growth cone
1. PB	GO:0099054	presynapse assembly
1. PB	GO:0003431	growth plate cartilage chondrocyte development
1. PB	GO:0035025	positive regulation of Rho protein signal transduction
1. PB	GO:0048495	Roundabout binding
1. PB	GO:0099060	integral component of postsynaptic specialization membrane
1. PB	GO:0008330	protein tyrosine/threonine phosphatase activity
1. PB	GO:0060076	excitatory synapse
1. PB	GO:0005615	extracellular space
1. PB	GO:0009986	cell surface
1. PB	GO:0007165	signal transduction
1. PB	GO:0016200	synaptic target attraction
1. PB	GO:0099061	integral component of postsynaptic density membrane
1. PB	GO:0050896	response to stimulus
1. PB	GO:0050808	synapse organization
1. PB	GO:0050919	negative chemotaxis
1. PB	GO:0098978	glutamatergic synapse
1. PB	GO:0055013	cardiac muscle cell development
1. PB	GO:0052083	suppression by symbiont of host cell-mediated immune response
1. PB	GO:0010977	negative regulation of neuron projection development
1. PB	GO:0043005	neuron projection
1. PB	GO:0070062	extracellular exosome
1. PB	GO:0097113	AMPA glutamate receptor clustering
1. PB	GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane
1. PB	GO:0010073	meristem maintenance
1. PB	GO:0042635	positive regulation of hair cycle
1. PB	GO:0038023	signaling receptor activity
1. PB	GO:0045108	regulation of intermediate filament polymerization or depolymerization
1. PB	GO:1905573	ganglioside GM1 binding
1. PB	GO:0061073	ciliary body morphogenesis
1. PB	GO:1905606	regulation of presynapse assembly
1. PB	GO:1905576	ganglioside GT1b binding
1. PB	GO:0032911	negative regulation of transforming growth factor beta1 production
1. PB	GO:0042734	presynaptic membrane
1. PB	GO:0022038	corpus callosum development
1. PB	GO:0044074	negative regulation by symbiont of host translation
1. PB	GO:0099104	potassium channel activator activity
1. PB	GO:0005614	interstitial matrix
1. PB	GO:0007411	axon guidance
1. PB	GO:0060291	long-term synaptic potentiation
1. PB	GO:0021960	anterior commissure morphogenesis
1. PB	GO:0099560	synaptic membrane adhesion
1. PB	GO:0010544	negative regulation of platelet activation
1. PB	GO:1902004	positive regulation of amyloid-beta formation
1. PB	GO:0050804	modulation of chemical synaptic transmission
1. PB	GO:0044295	axonal growth cone
1. PB	GO:1903818	positive regulation of voltage-gated potassium channel activity
1. PB	GO:1904761	negative regulation of myofibroblast differentiation
1. PB	GO:0098968	neurotransmitter receptor transport postsynaptic membrane to endosome
1. PB	GO:0031012	extracellular matrix
1. PB	GO:0008201	heparin binding
1. PB	GO:0005518	collagen binding
1. PB	GO:0007166	cell surface receptor signaling pathway
1. PB	GO:0072578	neurotransmitter-gated ion channel clustering
1. PB	GO:0099055	integral component of postsynaptic membrane
1. PB	GO:0098685	Schaffer collateral - CA1 synapse
1. PB	GO:0043395	heparan sulfate proteoglycan binding
1. PB	GO:0043204	perikaryon
1. PB	GO:0007155	cell adhesion
1. PB	GO:0023041	neuronal signal transduction
1. PB	GO:0002758	innate immune response-activating signal transduction
1. PB	GO:0031362	anchored component of external side of plasma membrane
1. PB	GO:0051963	regulation of synapse assembly
1. PB	GO:0046696	lipopolysaccharide receptor complex
1. PB	GO:0098982	GABA-ergic synapse
1. PB	GO:0048681	negative regulation of axon regeneration
1. PB	GO:0051393	alpha-actinin binding
1. PB	GO:0051965	positive regulation of synapse assembly
1. PB	GO:0098868	bone growth
1. PB	GO:1901629	regulation of presynaptic membrane organization
1. PB	GO:0031102	neuron projection regeneration
1. PB	GO:0099151	regulation of postsynaptic density assembly
1. PB	GO:0002240	response to molecule of oomycetes origin
1. PB	GO:0010811	positive regulation of cell-substrate adhesion
1. PB	GO:0048683	regulation of collateral sprouting of intact axon in response to injury
1. PB	GO:0046658	anchored component of plasma membrane
1. PB	GO:0098686	hippocampal mossy fiber to CA3 synapse
1. PB	GO:0035374	chondroitin sulfate binding
1. PB	GO:0035640	exploration behavior
1. PB	GO:0030017	sarcomere
2. P	GO:0060021	roof of mouth development
2. P	GO:0005686	U2 snRNP
2. P	GO:0048874	host-mediated regulation of intestinal microbiota composition
2. P	GO:0085032	modulation by symbiont of host I-kappaB kinase/NF-kappaB cascade
2. P	GO:0000389	mRNA 3'-splice site recognition
2. P	GO:0015459	potassium channel regulator activity
2. P	GO:0044877	protein-containing complex binding
2. P	GO:0007021	tubulin complex assembly
2. P	GO:1904861	excitatory synapse assembly
2. P	GO:0004842	ubiquitin-protein transferase activity
2. P	GO:0030620	U2 snRNA binding
2. P	GO:1990030	pericellular basket
2. P	GO:0007163	establishment or maintenance of cell polarity
2. P	GO:0009897	external side of plasma membrane
2. P	GO:0044309	neuron spine
2. P	GO:0005154	epidermal growth factor receptor binding
2. P	GO:0005815	microtubule organizing center
2. P	GO:0005524	ATP binding
2. P	GO:0030318	melanocyte differentiation
2. P	GO:0001750	photoreceptor outer segment
2. P	GO:0106030	neuron projection fasciculation
2. P	GO:0008076	voltage-gated potassium channel complex
2. P	GO:1990723	cytoplasmic periphery of the nuclear pore complex
2. P	GO:0010921	regulation of phosphatase activity
2. P	GO:0071805	potassium ion transmembrane transport
2. P	GO:0098793	presynapse
2. P	GO:0043025	neuronal cell body
2. P	GO:0034055	effector-mediated induction of programmed cell death in host
2. P	GO:0044164	host cell cytosol
2. P	GO:0070840	dynein complex binding
2. P	GO:0005783	endoplasmic reticulum
2. P	GO:0035418	protein localization to synapse
2. P	GO:0071005	U2-type precatalytic spliceosome
2. P	GO:0006913	nucleocytoplasmic transport
2. P	GO:0030029	actin filament-based process
2. P	GO:0071013	catalytic step 2 spliceosome
2. P	GO:0040022	feminization of hermaphroditic germ-line
2. P	GO:0005856	cytoskeleton
2. P	GO:1905232	cellular response to L-glutamate
2. P	GO:0045596	negative regulation of cell differentiation
2. P	GO:0051729	germline cell cycle switching, mitotic to meiotic cell cycle
2. P	GO:0097119	postsynaptic density protein 95 clustering
2. P	GO:0048839	inner ear development
2. P	GO:0043547	positive regulation of GTPase activity
2. P	GO:0007160	cell-matrix adhesion
2. P	GO:0001944	vasculature development
2. P	GO:0060760	positive regulation of response to cytokine stimulus
2. P	GO:0044314	protein K27-linked ubiquitination
2. P	GO:0007023	post-chaperonin tubulin folding pathway
2. P	GO:0043197	dendritic spine
2. P	GO:0016363	nuclear matrix
2. P	GO:0051865	protein autoubiquitination
2. P	GO:0043486	histone exchange
2. P	GO:0071014	post-mRNA release spliceosomal complex
2. P	GO:0032281	AMPA glutamate receptor complex
2. P	GO:2000155	positive regulation of cilium-dependent cell motility
2. P	GO:0044325	transmembrane transporter binding
2. P	GO:0030425	dendrite
2. P	GO:0097733	photoreceptor cell cilium
2. P	GO:0031103	axon regeneration
2. P	GO:0046827	positive regulation of protein export from nucleus
2. P	GO:0000226	microtubule cytoskeleton organization
2. P	GO:0046826	negative regulation of protein export from nucleus
2. P	GO:0019212	phosphatase inhibitor activity
2. P	GO:0003146	heart jogging
2. P	GO:0005681	spliceosomal complex
2. P	GO:0071004	U2-type prespliceosome
2. P	GO:0022414	reproductive process
2. P	GO:0038008	TRAF-mediated signal transduction
2. P	GO:0042393	histone binding
2. P	GO:0043014	alpha-tubulin binding
2. P	GO:0048471	perinuclear region of cytoplasm
2. P	GO:0090009	primitive streak formation
2. P	GO:0000398	mRNA splicing, via spliceosome
2. P	GO:0003305	cell migration involved in heart jogging
2. P	GO:0003314	heart rudiment morphogenesis
2. P	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
2. P	GO:0052170	suppression by symbiont of host innate immune response
2. P	GO:0042769	obsolete DNA damage response, detection of DNA damage
2. P	GO:0042981	regulation of apoptotic process
2. P	GO:0021591	ventricular system development
2. P	GO:0032391	photoreceptor connecting cilium
2. P	GO:0060271	cilium assembly
2. P	GO:0030532	small nuclear ribonucleoprotein complex
2. P	GO:0071007	U2-type catalytic step 2 spliceosome
2. P	GO:0000812	Swr1 complex
2. P	GO:0003356	regulation of cilium beat frequency
2. P	GO:0005813	centrosome
2. P	GO:0002177	manchette
2. P	GO:0015630	microtubule cytoskeleton
2. P	GO:0007413	axonal fasciculation
2. P	GO:0003779	actin binding
2. P	GO:0044458	motile cilium assembly
2. P	GO:0042552	myelination
2. P	GO:0007224	smoothened signaling pathway
2. P	GO:0015631	tubulin binding
2. P	GO:0007596	blood coagulation
2. P	GO:0005249	voltage-gated potassium channel activity
2. P	GO:0045211	postsynaptic membrane
2. P	GO:1904117	cellular response to vasopressin
3. B	GO:0003345	proepicardium cell migration involved in pericardium morphogenesis
3. B	GO:0030198	extracellular matrix organization
3. B	GO:0030014	CCR4-NOT complex
3. B	GO:0009729	detection of brassinosteroid stimulus
3. B	GO:0016080	synaptic vesicle targeting
3. B	GO:0090141	positive regulation of mitochondrial fission
3. B	GO:0042497	triacyl lipopeptide binding
3. B	GO:0090037	positive regulation of protein kinase C signaling
3. B	GO:2001013	epithelial cell proliferation involved in renal tubule morphogenesis
3. B	GO:0006368	transcription elongation from RNA polymerase II promoter
3. B	GO:0007089	traversing start control point of mitotic cell cycle
3. B	GO:1903217	negative regulation of protein processing involved in protein targeting to mitochondrion
3. B	GO:0002237	response to molecule of bacterial origin
3. B	GO:0010640	regulation of platelet-derived growth factor receptor signaling pathway
3. B	GO:0061161	positive regulation of establishment of bipolar cell polarity regulating cell shape
3. B	GO:0005095	GTPase inhibitor activity
3. B	GO:0030539	male genitalia development
3. B	GO:0010069	zygote asymmetric cytokinesis in embryo sac
3. B	GO:0060412	ventricular septum morphogenesis
3. B	GO:0015734	taurine transport
3. B	GO:0090406	pollen tube
3. B	GO:0030021	extracellular matrix structural constituent conferring compression resistance
3. B	GO:0045663	positive regulation of myoblast differentiation
3. B	GO:0010376	stomatal complex formation
3. B	GO:0019903	protein phosphatase binding
3. B	GO:0106310	protein serine kinase activity
3. B	GO:0009553	embryo sac development
3. B	GO:0050840	extracellular matrix binding
3. B	GO:0010150	leaf senescence
3. B	GO:0004722	protein serine/threonine phosphatase activity
3. B	GO:0060581	cell fate commitment involved in pattern specification
3. B	GO:0072282	metanephric nephron tubule morphogenesis
3. B	GO:0016239	positive regulation of macroautophagy
3. B	GO:0051301	cell division
3. B	GO:1904027	negative regulation of collagen fibril organization
3. B	GO:0002756	MyD88-independent toll-like receptor signaling pathway
3. B	GO:0106307
3. B	GO:0030054	cell junction
3. B	GO:0045930	negative regulation of mitotic cell cycle
3. B	GO:0021670	lateral ventricle development
3. B	GO:0000076	DNA replication checkpoint signaling
3. B	GO:0043231	intracellular membrane-bounded organelle
3. B	GO:0061975	articular cartilage development
3. B	GO:2001222	regulation of neuron migration
3. B	GO:0060348	bone development
3. B	GO:0001768	establishment of T cell polarity
3. B	GO:0044753	amphisome
3. B	GO:0006970	response to osmotic stress
3. B	GO:0140360	cyclic-GMP-AMP transmembrane transporter activity
3. B	GO:0032588	trans-Golgi network membrane
3. B	GO:0071485	cellular response to absence of light
3. B	GO:0070086	ubiquitin-dependent endocytosis
3. B	GO:0016336	establishment or maintenance of polarity of larval imaginal disc epithelium
3. B	GO:0050929	induction of negative chemotaxis
3. B	GO:0009934	regulation of meristem structural organization
3. B	GO:0017046	peptide hormone binding
3. B	GO:0090548	response to nitrate starvation
3. B	GO:0034142	toll-like receptor 4 signaling pathway
3. B	GO:0008045	motor neuron axon guidance
3. B	GO:0034750	Scrib-APC-beta-catenin complex
3. B	GO:0060122	inner ear receptor cell stereocilium organization
3. B	GO:0099400	caveola neck
3. B	GO:0030239	myofibril assembly
3. B	GO:0007179	transforming growth factor beta receptor signaling pathway
3. B	GO:0005887	integral component of plasma membrane
3. B	GO:0009742	brassinosteroid mediated signaling pathway
3. B	GO:0071215	cellular response to abscisic acid stimulus
3. B	GO:0030056	hemidesmosome
3. B	GO:0002224	toll-like receptor signaling pathway
3. B	GO:0033563	dorsal/ventral axon guidance
3. B	GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity
3. B	GO:0004532	exoribonuclease activity
3. B	GO:0035385	Roundabout signaling pathway
3. B	GO:0060561	apoptotic process involved in morphogenesis
3. B	GO:0003401	axis elongation
3. B	GO:0005789	endoplasmic reticulum membrane
3. B	GO:0048437	floral organ development
3. B	GO:0006952	defense response
3. B	GO:0090353	polygalacturonase inhibitor activity
3. B	GO:0010088	phloem development
3. B	GO:0004672	protein kinase activity
3. B	GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan
3. B	GO:0008528	G protein-coupled peptide receptor activity
3. B	GO:0010067	procambium histogenesis
3. B	GO:0010359	regulation of anion channel activity
3. B	GO:0048812	neuron projection morphogenesis
3. B	GO:0005104	fibroblast growth factor receptor binding
3. B	GO:1903980	positive regulation of microglial cell activation
3. B	GO:0070997	neuron death
3. B	GO:0010078	maintenance of root meristem identity
3. B	GO:0048481	plant ovule development
3. B	GO:0043928	exonucleolytic catabolism of deadenylated mRNA
3. B	GO:1903077	negative regulation of protein localization to plasma membrane
3. B	GO:0061290	canonical Wnt signaling pathway involved in metanephric kidney development
3. B	GO:0060763	mammary duct terminal end bud growth
3. B	GO:0106311
3. B	GO:0048833	specification of floral organ number
3. B	GO:0042060	wound healing
3. B	GO:0010227	floral organ abscission
3. B	GO:0005496	steroid binding
3. B	GO:0036335	intestinal stem cell homeostasis
3. B	GO:0034137	positive regulation of toll-like receptor 2 signaling pathway
3. B	GO:0071666	Slit-Robo signaling complex
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0080092	regulation of pollen tube growth
3. B	GO:0071287	cellular response to manganese ion
3. B	GO:0030374	nuclear receptor coactivator activity
3. B	GO:0090288	negative regulation of cellular response to growth factor stimulus
3. B	GO:0031290	retinal ganglion cell axon guidance
3. B	GO:1902499	positive regulation of protein autoubiquitination
3. B	GO:0031223	auditory behavior
3. B	GO:0051646	mitochondrion localization
3. B	GO:0034123	positive regulation of toll-like receptor signaling pathway
3. B	GO:0045171	intercellular bridge
3. B	GO:1900744	regulation of p38MAPK cascade
3. B	GO:0022028	tangential migration from the subventricular zone to the olfactory bulb
3. B	GO:0042567	insulin-like growth factor ternary complex
3. B	GO:1905279	regulation of retrograde transport, endosome to Golgi
3. B	GO:0031430	M band
3. B	GO:0005911	cell-cell junction
3. B	GO:1901333	positive regulation of lateral root development
3. B	GO:0008543	fibroblast growth factor receptor signaling pathway
3. B	GO:0048831	regulation of shoot system development
3. B	GO:0030859	polarized epithelial cell differentiation
3. B	GO:0005030	neurotrophin receptor activity
3. B	GO:0007097	nuclear migration
3. B	GO:0005737	cytoplasm
3. B	GO:0035583	sequestering of TGFbeta in extracellular matrix
3. B	GO:0048226	Casparian strip
3. B	GO:0097120	receptor localization to synapse
3. B	GO:0046813	receptor-mediated virion attachment to host cell
3. B	GO:1990523	bone regeneration
3. B	GO:0004535	poly(A)-specific ribonuclease activity
3. B	GO:0030308	negative regulation of cell growth
3. B	GO:0043394	proteoglycan binding
3. B	GO:0034134	toll-like receptor 2 signaling pathway
3. B	GO:2000405	negative regulation of T cell migration
3. B	GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process
3. B	GO:1902288	regulation of defense response to oomycetes
3. B	GO:0009755	hormone-mediated signaling pathway
3. B	GO:0070831	basement membrane assembly
3. B	GO:0000932	P-body
3. B	GO:0001649	osteoblast differentiation
3. B	GO:0048565	digestive tract development
3. B	GO:0045087	innate immune response
3. B	GO:0010102	lateral root morphogenesis
3. B	GO:0035335	peptidyl-tyrosine dephosphorylation
3. B	GO:0010955	negative regulation of protein processing
3. B	GO:0120163	negative regulation of cold-induced thermogenesis
3. B	GO:0031047	gene silencing by RNA
3. B	GO:0032722	positive regulation of chemokine production
3. B	GO:0034154	toll-like receptor 7 signaling pathway
3. B	GO:0030015	CCR4-NOT core complex
3. B	GO:0099072	regulation of postsynaptic membrane neurotransmitter receptor levels
3. B	GO:0004675	transmembrane receptor protein serine/threonine kinase activity
3. B	GO:0019806	bromide peroxidase activity
3. B	GO:0098633	collagen fibril binding
3. B	GO:0036364	transforming growth factor beta1 activation
3. B	GO:0034122	negative regulation of toll-like receptor signaling pathway
3. B	GO:0030500	regulation of bone mineralization
3. B	GO:0050918	positive chemotaxis
3. B	GO:0010080	regulation of floral meristem growth
3. B	GO:0051901	positive regulation of mitochondrial depolarization
3. B	GO:1900155	negative regulation of bone trabecula formation
3. B	GO:0048598	embryonic morphogenesis
3. B	GO:0035197	siRNA binding
3. B	GO:1902533	positive regulation of intracellular signal transduction
3. B	GO:0005225	volume-sensitive anion channel activity
3. B	GO:1901398	regulation of transforming growth factor beta3 activation
3. B	GO:0038187	pattern recognition receptor activity
3. B	GO:0032727	positive regulation of interferon-alpha production
3. B	GO:0036289	peptidyl-serine autophosphorylation
3. B	GO:0000175	3'-5'-exoribonuclease activity
3. B	GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity
3. B	GO:0004016	adenylate cyclase activity
3. B	GO:0071461	cellular response to redox state
3. B	GO:1903124	negative regulation of thioredoxin peroxidase activity
3. B	GO:0034178	toll-like receptor 13 signaling pathway
3. B	GO:0032185	septin cytoskeleton organization
3. B	GO:0000287	magnesium ion binding
3. B	GO:0061364	apoptotic process involved in luteolysis
3. B	GO:0034136	negative regulation of toll-like receptor 2 signaling pathway
3. B	GO:0090190	positive regulation of branching involved in ureteric bud morphogenesis
3. B	GO:2000067	regulation of root morphogenesis
3. B	GO:0050135	NAD(P)+ nucleosidase activity
3. B	GO:0007567	parturition
3. B	GO:1902692	regulation of neuroblast proliferation
3. B	GO:0005539	glycosaminoglycan binding
3. B	GO:0032584	growth cone membrane
3. B	GO:0090024	negative regulation of neutrophil chemotaxis
3. B	GO:0072224	metanephric glomerulus development
3. B	GO:0009994	oocyte differentiation
3. B	GO:0032473	cytoplasmic side of mitochondrial outer membrane
3. B	GO:0016593	Cdc73/Paf1 complex
3. B	GO:0060007	linear vestibuloocular reflex
3. B	GO:0010593	negative regulation of lamellipodium assembly
3. B	GO:0043679	axon terminus
3. B	GO:0010082	regulation of root meristem growth
3. B	GO:0002093	auditory receptor cell morphogenesis
3. B	GO:0016021	integral component of membrane
3. B	GO:0046579	positive regulation of Ras protein signal transduction
3. B	GO:1901727	positive regulation of histone deacetylase activity
3. B	GO:0001653	peptide receptor activity
3. B	GO:0030254	protein secretion by the type III secretion system
3. B	GO:0031175	neuron projection development
3. B	GO:0045499	chemorepellent activity
3. B	GO:0048754	branching morphogenesis of an epithelial tube
3. B	GO:0034260	negative regulation of GTPase activity
3. B	GO:1903224	regulation of endodermal cell differentiation
3. B	GO:0060161	positive regulation of dopamine receptor signaling pathway
3. B	GO:0004714	transmembrane receptor protein tyrosine kinase activity
3. B	GO:0062023	collagen-containing extracellular matrix
3. B	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
3. B	GO:0002238	response to molecule of fungal origin
3. B	GO:0022029	telencephalon cell migration
3. B	GO:0032474	otolith morphogenesis
3. B	GO:0034211	GTP-dependent protein kinase activity
3. B	GO:0071711	basement membrane organization
3. B	GO:0010449	root meristem growth
3. B	GO:0042277	peptide binding
3. B	GO:0009556	microsporogenesis
3. B	GO:0046007	negative regulation of activated T cell proliferation
3. B	GO:0030837	negative regulation of actin filament polymerization
3. B	GO:0005589	collagen type VI trimer
3. B	GO:0055046	microgametogenesis
3. B	GO:0004706	JUN kinase kinase kinase activity
3. B	GO:0005201	extracellular matrix structural constituent
3. B	GO:0005796	Golgi lumen
3. B	GO:0070052	collagen V binding
3. B	GO:0099147	extrinsic component of postsynaptic density membrane
3. B	GO:0006884	cell volume homeostasis
3. B	GO:0043615	astrocyte cell migration
3. B	GO:0048281	inflorescence morphogenesis
3. B	GO:0060026	convergent extension
3. B	GO:0071470	cellular response to osmotic stress
3. B	GO:0006468	protein phosphorylation
3. B	GO:1904417	positive regulation of xenophagy
3. B	GO:0071672	negative regulation of smooth muscle cell chemotaxis
3. B	GO:0010103	stomatal complex morphogenesis
3. B	GO:0099179	regulation of synaptic membrane adhesion
3. B	GO:0016500	protein-hormone receptor activity
3. B	GO:0060628	regulation of ER to Golgi vesicle-mediated transport
3. B	GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation
3. B	GO:0032228	regulation of synaptic transmission, GABAergic
3. B	GO:0043116	negative regulation of vascular permeability
3. B	GO:1900150	regulation of defense response to fungus
3. B	GO:0014005	microglia development
3. B	GO:0006954	inflammatory response
3. B	GO:0007416	synapse assembly
3. B	GO:0030336	negative regulation of cell migration
3. B	GO:1904887	Wnt signalosome assembly
3. B	GO:0048508	embryonic meristem development
3. B	GO:0034052	positive regulation of plant-type hypersensitive response
3. B	GO:0002667	regulation of T cell anergy
3. B	GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
3. B	GO:0050431	transforming growth factor beta binding
3. B	GO:0002329	pre-B cell differentiation
3. B	GO:1902803	regulation of synaptic vesicle transport
3. B	GO:0010075	regulation of meristem growth
3. B	GO:0010606	positive regulation of cytoplasmic mRNA processing body assembly
3. B	GO:0014041	regulation of neuron maturation
3. B	GO:0097060	synaptic membrane
3. B	GO:0070100	negative regulation of chemokine-mediated signaling pathway
3. B	GO:0005886	plasma membrane
3. B	GO:1905034	regulation of antifungal innate immune response
3. B	GO:1903351	cellular response to dopamine
3. B	GO:0010054	trichoblast differentiation
3. B	GO:0070966	nuclear-transcribed mRNA catabolic process, no-go decay
3. B	GO:0030714	anterior/posterior axis specification, follicular epithelium
3. B	GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling
3. B	GO:0061343	cell adhesion involved in heart morphogenesis
3. B	GO:0019199	transmembrane receptor protein kinase activity
3. B	GO:0010596	negative regulation of endothelial cell migration
3. B	GO:0030282	bone mineralization
3. B	GO:0005176	ErbB-2 class receptor binding
3. B	GO:0019843	rRNA binding
3. B	GO:2000280	regulation of root development
3. B	GO:0042659	regulation of cell fate specification
3. B	GO:1905103	integral component of lysosomal membrane
3. B	GO:0021972	corticospinal neuron axon guidance through spinal cord
3. B	GO:0003181	atrioventricular valve morphogenesis
3. B	GO:0045175	basal protein localization
3. B	GO:0090038	negative regulation of protein kinase C signaling
3. B	GO:0071676	negative regulation of mononuclear cell migration
3. B	GO:0002689	negative regulation of leukocyte chemotaxis
3. B	GO:0051014	actin filament severing
3. B	GO:0001968	fibronectin binding
3. B	GO:0072202	cell differentiation involved in metanephros development
3. B	GO:0008157	protein phosphatase 1 binding
3. B	GO:0048243	norepinephrine secretion
3. B	GO:0036020	endolysosome membrane
3. B	GO:0005199	structural constituent of cell wall
3. B	GO:0006171	cAMP biosynthetic process
3. B	GO:0001974	blood vessel remodeling
3. B	GO:0051900	regulation of mitochondrial depolarization
3. B	GO:0060322	head development
3. B	GO:0003184	pulmonary valve morphogenesis
3. B	GO:0043531	ADP binding
3. B	GO:0034138	toll-like receptor 3 signaling pathway
3. B	GO:0043030	regulation of macrophage activation
3. B	GO:0021510	spinal cord development
3. B	GO:0060427	lung connective tissue development
3. B	GO:0000188	obsolete inactivation of MAPK activity
3. B	GO:0048229	gametophyte development
3. B	GO:0009649	entrainment of circadian clock
3. B	GO:0021836	chemorepulsion involved in postnatal olfactory bulb interneuron migration
3. B	GO:0010183	pollen tube guidance
3. B	GO:0140058	neuron projection arborization
3. B	GO:0032495	response to muramyl dipeptide
3. B	GO:0032809	neuronal cell body membrane
3. B	GO:0098609	cell-cell adhesion
3. B	GO:0014069	postsynaptic density
3. B	GO:0060658	nipple morphogenesis
3. B	GO:0033612	receptor serine/threonine kinase binding
3. B	GO:0001818	negative regulation of cytokine production
3. B	GO:0050673	epithelial cell proliferation
3. B	GO:0014912	negative regulation of smooth muscle cell migration
3. B	GO:0010152	pollen maturation
3. B	GO:0016045	detection of bacterium
3. B	GO:0106306
3. B	GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway
3. B	GO:1903206	negative regulation of hydrogen peroxide-induced cell death
3. B	GO:0007639	homeostasis of number of meristem cells
3. B	GO:0035970	peptidyl-threonine dephosphorylation
3. B	GO:0051414	response to cortisol
3. B	GO:0010508	positive regulation of autophagy
3. B	GO:0021766	hippocampus development
3. B	GO:0048653	anther development
3. B	GO:0070973	protein localization to endoplasmic reticulum exit site
3. B	GO:0035089	establishment of apical/basal cell polarity
3. B	GO:0043202	lysosomal lumen
3. B	GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter
3. B	GO:0140361	cyclic-GMP-AMP transmembrane import across plasma membrane
3. B	GO:1900140	regulation of seedling development
3. B	GO:0070171	negative regulation of tooth mineralization
3. B	GO:0009506	plasmodesma
3. B	GO:1905289	regulation of CAMKK-AMPK signaling cascade
3. B	GO:0060603	mammary gland duct morphogenesis
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:0051058	negative regulation of small GTPase mediated signal transduction
3. B	GO:0140426	PAMP-triggered immunity signalling pathway
3. B	GO:0071504	cellular response to heparin
3. B	GO:0043237	laminin-1 binding
3. B	GO:0035308	negative regulation of protein dephosphorylation
3. B	GO:0032729	positive regulation of interferon-gamma production
3. B	GO:0061809	NAD+ nucleotidase, cyclic ADP-ribose generating
3. B	GO:0007190	activation of adenylate cyclase activity
3. B	GO:0090260	negative regulation of retinal ganglion cell axon guidance
3. B	GO:1900244	positive regulation of synaptic vesicle endocytosis
3. B	GO:0035751	regulation of lysosomal lumen pH
3. B	GO:0043194	axon initial segment
3. B	GO:0046849	bone remodeling
3. B	GO:0071896	protein localization to adherens junction
3. B	GO:0046777	protein autophosphorylation
3. B	GO:0001942	hair follicle development
3. B	GO:0048846	axon extension involved in axon guidance
3. B	GO:0034702	ion channel complex
3. B	GO:0034144	negative regulation of toll-like receptor 4 signaling pathway
3. B	GO:0009626	plant-type hypersensitive response
3. B	GO:0060866	leaf abscission
3. B	GO:0016020	membrane
3. B	GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
3. B	GO:0016323	basolateral plasma membrane
3. B	GO:0043031	negative regulation of macrophage activation
3. B	GO:0097487	multivesicular body, internal vesicle
3. B	GO:0070433	negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway
3. B	GO:0006801	superoxide metabolic process
3. B	GO:0010234	anther wall tapetum cell fate specification
3. B	GO:0060384	innervation
3. B	GO:0006955	immune response
3. B	GO:0035564	regulation of kidney size
3. B	GO:0004674	protein serine/threonine kinase activity
3. B	GO:0099059	integral component of presynaptic active zone membrane
3. B	GO:0048657	anther wall tapetum cell differentiation
3. B	GO:0005520	insulin-like growth factor binding
3. B	GO:0002042	cell migration involved in sprouting angiogenesis
3. B	GO:1904713	beta-catenin destruction complex binding
3. B	GO:0021772	olfactory bulb development
3. B	GO:0098742	cell-cell adhesion via plasma-membrane adhesion molecules
3. B	GO:1902025	nitrate import
3. B	GO:0021747	cochlear nucleus development
3. B	GO:0007569	cell aging
3. B	GO:0071638	negative regulation of monocyte chemotactic protein-1 production
3. B	GO:0032870	cellular response to hormone stimulus
3. B	GO:0046755	viral budding
3. B	GO:0090394	negative regulation of excitatory postsynaptic potential
3. B	GO:0034146	toll-like receptor 5 signaling pathway
3. B	GO:1990909	Wnt signalosome
3. B	GO:0031150	sorocarp stalk development
3. B	GO:0003180	aortic valve morphogenesis
3. B	GO:0021756	striatum development
3. B	GO:0015810	aspartate transmembrane transport
3. B	GO:0008154	actin polymerization or depolymerization
3. B	GO:0099175	regulation of postsynapse organization
3. B	GO:0042246	tissue regeneration
3. B	GO:0051964	negative regulation of synapse assembly
3. B	GO:2000172	regulation of branching morphogenesis of a nerve
3. B	GO:0060159	regulation of dopamine receptor signaling pathway
3. B	GO:0035748	myelin sheath abaxonal region
3. B	GO:0044754	autolysosome
3. B	GO:0036035	osteoclast development
3. B	GO:0048678	response to axon injury
3. B	GO:1990138	neuron projection extension
3. B	GO:0010087	phloem or xylem histogenesis
3. B	GO:0001678	cellular glucose homeostasis
3. B	GO:0043236	laminin binding
3. B	GO:0005102	signaling receptor binding
3. B	GO:0045806	negative regulation of endocytosis
3. B	GO:0090696	post-embryonic plant organ development
3. B	GO:0050728	negative regulation of inflammatory response
3. B	GO:0009505	plant-type cell wall
3. B	GO:0048478	replication fork protection
3. B	GO:0010051	xylem and phloem pattern formation
3. B	GO:0009945	radial axis specification
3. B	GO:0043068	positive regulation of programmed cell death
3. B	GO:0043408	regulation of MAPK cascade
3. B	GO:0032757	positive regulation of interleukin-8 production
3. B	GO:0001530	lipopolysaccharide binding
3. B	GO:0110011	regulation of basement membrane organization
3. B	GO:0051019	mitogen-activated protein kinase binding
3. B	GO:0046328	regulation of JNK cascade
3. B	GO:1905421	regulation of plant organ morphogenesis
3. B	GO:0140376	innate immune receptor activity
3. B	GO:0036479	peroxidase inhibitor activity
3. B	GO:0050832	defense response to fungus
3. B	GO:0097708	intracellular vesicle
3. B	GO:0090708	specification of plant organ axis polarity
3. B	GO:0043113	receptor clustering
3. B	GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening
3. B	GO:0034214	protein hexamerization
3. B	GO:0098656	anion transmembrane transport
3. B	GO:0005618	cell wall
3. B	GO:0090027	negative regulation of monocyte chemotaxis
3. B	GO:0021562	vestibulocochlear nerve development
3. B	GO:0001932	regulation of protein phosphorylation
3. B	GO:0032009	early phagosome
3. B	GO:1903125	negative regulation of thioredoxin peroxidase activity by peptidyl-threonine phosphorylation
3. B	GO:0005925	focal adhesion
3. B	GO:0007252	I-kappaB phosphorylation
3. B	GO:0002755	MyD88-dependent toll-like receptor signaling pathway
3. B	GO:1901528	hydrogen peroxide mediated signaling pathway involved in stomatal movement
3. B	GO:1903215	negative regulation of protein targeting to mitochondrion
3. B	GO:0006820	anion transport
3. B	GO:0030199	collagen fibril organization
3. B	GO:0016525	negative regulation of angiogenesis
3. B	GO:0051016	barbed-end actin filament capping
3. B	GO:0046872	metal ion binding
3. B	GO:0001933	negative regulation of protein phosphorylation
3. B	GO:0004888	transmembrane signaling receptor activity
3. B	GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
3. B	GO:0000164	protein phosphatase type 1 complex
3. B	GO:1902823	negative regulation of late endosome to lysosome transport
3. B	GO:0010074	maintenance of meristem identity
3. B	GO:0035239	tube morphogenesis

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	A4IHG1	Leucine-rich repeat-containing protein 58	9.34e-09	2.77e-46	1.51e-08
1. PB	O08770	Platelet glycoprotein V	6.51e-05	6.96e-05	6.99e-10
1. PB	Q7L985	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2	6.97e-05	6.13e-04	2.24e-05
1. PB	P83503	Nyctalopin	1.95e-05	5.67e-05	0.034
1. PB	Q32NT4	Leucine-rich repeat-containing protein 58	3.98e-10	5.62e-40	5.59e-09
1. PB	Q9D1G5	Leucine-rich repeat-containing protein 57	2.18e-14	2.05e-02	1.76e-12
1. PB	Q8BGA3	Leucine-rich repeat transmembrane neuronal protein 2	8.51e-06	4.99e-04	3.54e-08
1. PB	Q5RFE9	Leucine-rich repeat-containing protein 40	3.78e-08	2.88e-03	4.84e-15
1. PB	Q99PI8	Reticulon-4 receptor	4.73e-07	3.75e-03	1.35e-06
1. PB	Q8N456	Leucine-rich repeat-containing protein 18	5.35e-06	1.09e-19	3.79e-09
1. PB	Q9CQ76	Nephrocan	2.71e-06	4.33e-02	0.012
1. PB	Q99M75	Reticulon-4 receptor	1.36e-06	6.86e-03	1.55e-06
1. PB	Q9D9Q0	Leucine-rich repeat-containing protein 69	2.67e-13	2.06e-52	8.21e-15
1. PB	C0LGP4	Probable LRR receptor-like serine/threonine-protein kinase At3g47570	1.52e-03	4.25e-02	5.90e-08
1. PB	Q80VQ1	Leucine-rich repeat-containing protein 1	1.99e-08	2.87e-07	6.95e-19
1. PB	Q5G5D8	Plant intracellular Ras-group-related LRR protein 7	4.23e-11	9.67e-04	5.07e-13
1. PB	Q6K7R2	Plant intracellular Ras-group-related LRR protein 6	5.55e-07	1.40e-02	3.02e-12
1. PB	A1A4H9	Leucine-rich repeat transmembrane neuronal protein 1	5.24e-05	3.04e-05	8.86e-07
1. PB	Q9VPF0	Protein artichoke	1.09e-02	5.22e-04	3.08e-05
1. PB	Q9DBB9	Carboxypeptidase N subunit 2	4.43e-06	2.05e-03	1.40e-06
1. PB	Q5E9C0	Ras suppressor protein 1	1.85e-12	1.82e-10	3.99e-12
1. PB	Q86UN3	Reticulon-4 receptor-like 2	1.55e-05	9.30e-05	0.003
1. PB	O43300	Leucine-rich repeat transmembrane neuronal protein 2	1.35e-05	6.06e-04	4.16e-08
1. PB	Q6GPJ5	Leucine-rich repeat-containing protein 40	3.02e-08	2.94e-02	1.45e-15
1. PB	Q9CQ07	Leucine-rich repeat-containing protein 18	4.25e-08	9.47e-19	3.95e-11
1. PB	P90920	Leucine-rich repeat-containing protein egg-6	1.38e-03	2.36e-03	7.20e-05
1. PB	Q7M6Z0	Reticulon-4 receptor-like 2	3.07e-06	1.20e-05	0.001
1. PB	Q01819	Connectin	2.66e-05	7.24e-03	0.001
1. PB	Q86UE6	Leucine-rich repeat transmembrane neuronal protein 1	5.16e-05	3.06e-06	1.08e-07
1. PB	Q3KQF4	Leucine-rich repeat-containing protein 69	0.00e+00	7.41e-53	5.19e-10
1. PB	D3ZAL8	Leucine-rich repeat transmembrane neuronal protein 3	1.06e-04	1.16e-03	2.41e-06
1. PB	Q9BTT6	Leucine-rich repeat-containing protein 1	4.34e-08	5.21e-08	1.99e-20
1. PB	O61967	Protein lap1	1.13e-07	1.55e-03	9.80e-22
1. PB	Q24K06	Leucine-rich repeat-containing protein 10	9.10e-13	4.35e-08	1.81e-11
1. PB	Q5R6B1	Leucine-rich repeat transmembrane neuronal protein 1	3.60e-05	4.28e-06	1.01e-07
1. PB	Q9N0E3	Reticulon-4 receptor	9.92e-05	1.90e-04	1.10e-05
1. PB	D4A7P2	Leucine-rich repeat transmembrane neuronal protein 2	3.39e-06	6.96e-04	3.18e-08
1. PB	P40197	Platelet glycoprotein V	5.48e-05	1.47e-02	8.50e-08
1. PB	D4A6D8	Leucine-rich repeat transmembrane neuronal protein 1	1.69e-05	1.83e-04	1.63e-07
1. PB	Q86VH5	Leucine-rich repeat transmembrane neuronal protein 3	4.18e-05	8.96e-03	1.69e-06
1. PB	Q9C9H6	Receptor-like protein 11	1.72e-03	7.32e-03	6.48e-04
1. PB	Q15404	Ras suppressor protein 1	2.10e-12	2.35e-12	7.49e-12
1. PB	Q7Z2Q7	Leucine-rich repeat-containing protein 70	6.69e-05	8.84e-06	5.94e-05
1. PB	Q5M8G4	Leucine-rich repeat-containing protein 40	1.97e-06	4.70e-02	1.08e-14
1. PB	P0C192	Leucine-rich repeat-containing protein 4B	7.29e-05	2.30e-02	0.023
1. PB	Q55CS8	MAP kinase phosphatase with leucine-rich repeats protein 2	4.05e-05	1.03e-03	1.69e-04
1. PB	Q505F5	Leucine-rich repeat-containing protein 47	1.20e-04	2.21e-04	2.96e-08
1. PB	P18009	Probable E3 ubiquitin-protein ligase ipaH4.5	9.01e-05	3.19e-05	1.39e-04
1. PB	Q63912	Oligodendrocyte-myelin glycoprotein	4.38e-07	4.84e-05	1.14e-04
1. PB	Q7XNY1	Plant intracellular Ras-group-related LRR protein 1	4.02e-10	7.39e-12	1.95e-11
1. PB	Q3URE9	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2	8.37e-05	7.04e-04	5.02e-05
1. PB	B9F655	Plant intracellular Ras-group-related LRR protein 7	1.09e-14	2.28e-02	8.18e-20
1. PB	Q01730	Ras suppressor protein 1	1.80e-12	6.10e-12	6.69e-13
1. PB	Q4R3P6	Leucine-rich repeat-containing protein 40	1.21e-07	1.34e-02	1.49e-15
1. PB	Q8BZ81	Leucine-rich repeat transmembrane neuronal protein 3	2.79e-04	1.57e-03	2.52e-06
1. PB	A6NIK2	Leucine-rich repeat-containing protein 10B	4.44e-16	3.53e-11	8.38e-12
1. PB	Q8K377	Leucine-rich repeat transmembrane neuronal protein 1	5.77e-05	1.55e-04	1.43e-07
1. PB	P0CC10	Leucine-rich repeat-containing protein 4B	5.87e-05	1.34e-02	0.022
1. PB	Q8N1G4	Leucine-rich repeat-containing protein 47	3.13e-05	4.44e-05	2.26e-07
1. PB	Q8K3W2	Leucine-rich repeat-containing protein 10	1.51e-10	4.06e-06	3.50e-10
1. PB	Q9GZU5	Nyctalopin	1.82e-05	1.32e-05	0.001
1. PB	Q9BZR6	Reticulon-4 receptor	7.36e-05	2.40e-04	6.75e-08
1. PB	Q80XG9	Leucine-rich repeat transmembrane neuronal protein 4	2.33e-05	5.40e-05	0.004
1. PB	Q9H9A6	Leucine-rich repeat-containing protein 40	5.93e-06	1.71e-03	1.60e-16
1. PB	Q66HD6	Leucine-rich repeat-containing protein 18	6.19e-07	4.58e-17	1.68e-09
1. PB	Q6INV3	Leucine-rich repeat-containing protein 57	1.22e-14	1.11e-02	1.96e-14
1. PB	O08742	Platelet glycoprotein V	1.47e-05	6.48e-05	2.87e-08
1. PB	Q83RJ4	E3 ubiquitin-protein ligase ipaH3	6.54e-05	1.99e-02	3.31e-06
1. PB	Q3U3V8	X-ray radiation resistance-associated protein 1	2.13e-02	2.68e-02	0.019
1. PB	Q80WD0	Reticulon-4 receptor-like 1	1.00e-04	9.55e-03	8.69e-05
1. PB	Q9V780	Protein lap1	1.46e-05	4.97e-03	6.71e-17
1. PB	Q91W20	Leucine-rich repeat-containing protein 26	5.14e-05	1.36e-03	0.005
1. PB	Q9NT99	Leucine-rich repeat-containing protein 4B	6.94e-05	2.77e-02	0.030
1. PB	Q8RWE5	Plant intracellular Ras-group-related LRR protein 8	1.73e-11	2.49e-06	5.27e-14
1. PB	P23515	Oligodendrocyte-myelin glycoprotein	5.14e-07	1.23e-03	0.031
1. PB	Q86X40	Leucine-rich repeat-containing protein 28	0	9.94e-183	0.0
1. PB	Q5BKY1	Leucine-rich repeat-containing protein 10	2.57e-13	3.33e-07	4.06e-10
1. PB	Q3TX51	Leucine-rich repeat-containing protein 28	0.00e+00	5.68e-126	0.0
1. PB	P22792	Carboxypeptidase N subunit 2	6.59e-06	1.23e-02	1.18e-07
1. PB	Q65Z91	Tsukushi	1.91e-06	1.87e-02	3.40e-04
1. PB	Q8K0S5	Reticulon-4 receptor-like 1	2.36e-09	5.08e-03	6.16e-05
1. PB	Q3UGP9	Leucine-rich repeat-containing protein 58	1.10e-12	2.65e-33	3.77e-12
1. PB	Q6GLE8	Leucine-rich repeat-containing protein 28	0.00e+00	3.30e-117	0.0
1. PB	B4F7C5	Leucine-rich repeat transmembrane neuronal protein 4	3.86e-05	4.78e-05	0.003
1. PB	Q80WD1	Reticulon-4 receptor-like 2	3.31e-05	3.93e-05	0.001
1. PB	Q9HBL6	Leucine-rich repeat and transmembrane domain-containing protein 1	5.91e-05	4.97e-03	0.022
1. PB	Q96CX6	Leucine-rich repeat-containing protein 58	1.71e-10	2.40e-31	6.62e-13
1. PB	Q6ZNQ3	Leucine-rich repeat-containing protein 69	1.79e-14	4.82e-58	1.93e-11
1. PB	Q9MA83	Receptor-like protein 30	6.87e-04	2.76e-03	0.047
1. PB	Q9BGP6	Leucine-rich repeat transmembrane neuronal protein 3	1.40e-04	8.96e-03	1.69e-06
1. PB	Q86VH4	Leucine-rich repeat transmembrane neuronal protein 4	2.33e-05	1.27e-04	0.005
1. PB	Q32KX5	Leucine-rich repeat-containing protein 28	0.00e+00	5.11e-149	0.0
2. P	Q5RDJ4	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	5.78e-04	1.17e-03	NA
2. P	Q92688	Acidic leucine-rich nuclear phosphoprotein 32 family member B	2.08e-05	9.41e-05	NA
2. P	Q99PH1	Leucine-rich repeat-containing protein 4	1.93e-04	2.37e-02	NA
2. P	Q45R42	Leucine-rich repeat-containing protein 4	2.02e-04	1.53e-02	NA
2. P	Q9H756	Leucine-rich repeat-containing protein 19	2.66e-04	3.87e-04	NA
2. P	Q7Z4L9	Protein phosphatase 1 regulatory subunit 42	1.10e-05	1.67e-12	NA
2. P	Q6FV04	U2 small nuclear ribonucleoprotein A'	1.74e-02	7.57e-09	NA
2. P	O01615	Acidic leucine-rich nuclear phosphoprotein 32-related protein 2	3.88e-04	5.42e-10	NA
2. P	Q5F4A3	Acidic leucine-rich nuclear phosphoprotein 32 family member E	3.03e-05	4.28e-05	NA
2. P	Q8N309	Leucine-rich repeat-containing protein 43	1.59e-03	6.20e-04	NA
2. P	Q3SZC6	Acidic leucine-rich nuclear phosphoprotein 32 family member B	2.08e-05	1.18e-03	NA
2. P	O35381	Acidic leucine-rich nuclear phosphoprotein 32 family member A	2.58e-05	8.73e-06	NA
2. P	O43423	Acidic leucine-rich nuclear phosphoprotein 32 family member C	1.03e-04	7.88e-04	NA
2. P	Q6GQN5	Protein phosphatase 1 regulatory subunit 42	2.94e-06	3.24e-10	NA
2. P	Q66HV9	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B	2.39e-04	3.96e-04	NA
2. P	Q7ZUP0	Acidic leucine-rich nuclear phosphoprotein 32 family member A	1.70e-05	1.46e-05	NA
2. P	Q9HBW1	Leucine-rich repeat-containing protein 4	2.19e-04	1.81e-02	NA
2. P	Q326Z6	E3 ubiquitin-protein ligase ipaH9.8	2.55e-04	1.31e-02	NA
2. P	Q9D1T0	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	5.68e-04	6.35e-04	NA
2. P	Q4P5F9	U2 small nuclear ribonucleoprotein A'	3.61e-03	3.50e-10	NA
2. P	P49911	Acidic leucine-rich nuclear phosphoprotein 32 family member A	2.34e-05	5.18e-07	NA
2. P	O62220	Acidic leucine-rich nuclear phosphoprotein 32-related protein 1	6.31e-03	1.08e-09	NA
2. P	Q4R747	Leucine-rich repeat-containing protein 46	4.60e-03	2.65e-06	NA
2. P	Q5QJ74	Tubulin-specific chaperone cofactor E-like protein	1.42e-04	8.55e-05	NA
2. P	Q8R2R5	Leucine-rich repeat-containing protein 61	1.40e-03	2.83e-14	NA
2. P	Q8N967	Leucine-rich repeat and transmembrane domain-containing protein 2	4.09e-05	3.29e-02	NA
2. P	Q587K4	Leucine-rich repeat-containing protein 73	7.11e-05	6.65e-04	NA
2. P	Q9BV99	Leucine-rich repeat-containing protein 61	1.04e-03	2.77e-12	NA
2. P	Q8VSC3	E3 ubiquitin-protein ligase ipaH9.8	3.38e-04	8.96e-03	NA
2. P	Q9V895	Acidic leucine-rich nuclear phosphoprotein 32 family member A	1.51e-05	8.54e-04	NA
2. P	Q6P7C4	Leucine-rich repeat-containing protein 26	1.51e-05	4.12e-02	NA
2. P	Q9N008	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	6.19e-04	2.89e-04	NA
2. P	Q5ZMN0	Acidic leucine-rich nuclear phosphoprotein 32 family member B	2.59e-05	5.22e-04	NA
2. P	Q6C417	U2 small nuclear ribonucleoprotein A'	2.27e-03	6.28e-04	NA
2. P	P0C6S8	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3	4.13e-05	3.55e-03	NA
2. P	Q8C5W3	Tubulin-specific chaperone cofactor E-like protein	1.31e-04	1.94e-04	NA
2. P	Q9D9B4	Leucine-rich melanocyte differentiation-associated protein	8.47e-03	2.32e-04	NA
2. P	Q8HY67	Acidic leucine-rich nuclear phosphoprotein 32 family member A	NA	5.92e-07	NA
2. P	B2TT54	E3 ubiquitin-protein ligase ipaH9.8	1.96e-04	4.08e-02	NA
2. P	A6H759	Leucine-rich repeat-containing protein 72	2.69e-03	2.34e-08	NA
2. P	P09661	U2 small nuclear ribonucleoprotein A'	4.02e-03	5.51e-18	NA
2. P	Q08963	U2 small nuclear ribonucleoprotein A'	2.50e-02	3.33e-07	NA
2. P	Q7ZY40	Acidic leucine-rich nuclear phosphoprotein 32 family member E	2.49e-03	5.11e-07	NA
2. P	Q9USX8	U2 small nuclear ribonucleoprotein A'	3.19e-03	5.11e-07	NA
2. P	P97822	Acidic leucine-rich nuclear phosphoprotein 32 family member E	7.02e-04	5.97e-06	NA
2. P	P39687	Acidic leucine-rich nuclear phosphoprotein 32 family member A	2.06e-05	8.95e-07	NA
2. P	Q7ZV84	Dynein axonemal assembly factor 1	2.12e-03	7.79e-04	NA
2. P	Q4R803	Protein phosphatase 1 regulatory subunit 42	2.90e-05	3.43e-19	NA
2. P	Q5PPX0	Protein phosphatase 1 regulatory subunit 42	6.01e-05	1.06e-15	NA
2. P	Q80ZD8	Amphoterin-induced protein 1	4.32e-04	4.33e-02	NA
2. P	Q6NUW5	Acidic leucine-rich nuclear phosphoprotein 32 family member E	4.02e-05	4.13e-07	NA
2. P	Q5BGW9	U2 small nuclear ribonucleoprotein A'	1.91e-02	5.36e-08	NA
2. P	Q9H2I8	Leucine-rich melanocyte differentiation-associated protein	4.01e-02	1.27e-02	NA
2. P	P43333	U2 small nuclear ribonucleoprotein A'	3.00e-03	1.15e-07	NA
2. P	Q9DAP0	Leucine-rich repeat-containing protein 46	2.84e-03	1.72e-05	NA
2. P	Q6PAF6	Acidic leucine-rich nuclear phosphoprotein 32 family member A	1.78e-05	1.94e-06	NA
2. P	P18014	Probable E3 ubiquitin-protein ligase ipaH7.8	4.04e-05	1.65e-04	NA
2. P	Q7S9P4	U2 small nuclear ribonucleoprotein A'	1.01e-02	1.66e-10	NA
2. P	Q8N7C0	Leucine-rich repeat-containing protein 52	1.43e-05	1.15e-05	NA
2. P	Q9EST5	Acidic leucine-rich nuclear phosphoprotein 32 family member B	2.11e-05	1.99e-02	NA
2. P	Q9BTT0	Acidic leucine-rich nuclear phosphoprotein 32 family member E	7.64e-04	2.05e-05	NA
2. P	Q6BT60	U2 small nuclear ribonucleoprotein A'	6.02e-03	3.71e-06	NA
2. P	Q96FE5	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	6.87e-04	1.90e-04	NA
2. P	Q9BLB6	Probable U2 small nuclear ribonucleoprotein A'	3.38e-03	2.35e-13	NA
2. P	Q5M8M9	Leucine-rich repeat-containing protein 52	1.89e-05	1.92e-05	NA
2. P	Q8CBC6	Leucine-rich repeat neuronal protein 3	2.24e-04	4.08e-02	NA
2. P	Q4WV66	U2 small nuclear ribonucleoprotein A'	7.71e-03	9.12e-11	NA
2. P	P57784	U2 small nuclear ribonucleoprotein A'	4.18e-03	1.35e-17	NA
2. P	Q9V4Q8	Probable U2 small nuclear ribonucleoprotein A'	1.42e-02	1.69e-14	NA
2. P	Q6A1I3	Acidic leucine-rich nuclear phosphoprotein 32 family member B	2.58e-05	5.82e-06	NA
2. P	Q6P1U7	Acidic leucine-rich nuclear phosphoprotein 32 family member B	1.27e-05	6.57e-04	NA
2. P	Q6AXZ2	Leucine-rich repeat-containing protein 46	2.74e-03	8.83e-07	NA
2. P	P71451	Internalin C	1.01e-05	4.51e-02	NA
2. P	Q8ILI6	Acidic leucine-rich nuclear phosphoprotein 32-related protein	3.37e-04	1.19e-04	NA
2. P	Q5XIE0	Acidic leucine-rich nuclear phosphoprotein 32 family member E	7.92e-04	5.89e-06	NA
2. P	Q5JTD7	Leucine-rich repeat-containing protein 73	4.33e-05	4.71e-04	NA
2. P	P46060	Ran GTPase-activating protein 1	1.87e-03	9.06e-03	NA
2. P	Q8R1Z4	Protein phosphatase 1 regulatory subunit 42	1.09e-04	5.23e-19	NA
2. P	Q6UY18	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4	2.37e-04	1.43e-02	NA
2. P	Q09JZ4	Leucine-rich repeat-containing protein ODA7	7.40e-04	8.87e-03	NA
2. P	P51122	Acidic leucine-rich nuclear phosphoprotein 32 family member A	1.86e-05	9.19e-07	NA
2. P	O43822	Cilia- and flagella-associated protein 410	1.53e-02	6.72e-04	NA
2. P	Q2T9T5	Leucine-rich repeat-containing protein 61	2.30e-03	8.59e-16	NA
2. P	Q3V0L5	Leucine-rich repeat-containing protein 43	1.88e-02	1.21e-02	NA
2. P	Q96FV0	Leucine-rich repeat-containing protein 46	2.76e-03	1.50e-06	NA
2. P	Q95JT3	Leucine-rich repeat-containing protein 43	1.59e-03	1.53e-03	NA
2. P	Q755D2	U2 small nuclear ribonucleoprotein A'	1.05e-02	3.52e-08	NA
2. P	Q8AVC1	Acidic leucine-rich nuclear phosphoprotein 32 family member B	1.46e-05	6.37e-03	NA
2. P	Q7Y180	Acidic leucine-rich nuclear phosphoprotein 32-related protein 2	3.66e-03	2.55e-03	NA
2. P	A6NJI9	Leucine-rich repeat-containing protein 72	3.43e-03	1.49e-10	NA
2. P	Q4R8Y8	U2 small nuclear ribonucleoprotein A'	6.01e-03	5.51e-18	NA
2. P	Q5UQX3	Putative leucine-rich repeat protein R380	NA	9.23e-12	NA
2. P	Q5A449	U2 small nuclear ribonucleoprotein A'	2.54e-02	4.07e-10	NA
2. P	Q5PQJ7	Tubulin-specific chaperone cofactor E-like protein	1.17e-04	6.96e-05	NA
2. P	Q8C6G1	Cilia- and flagella-associated protein 410	1.27e-02	1.05e-04	NA
2. P	Q31SH3	E3 ubiquitin-protein ligase ipaH9.8	1.55e-04	2.66e-02	NA
2. P	P14770	Platelet glycoprotein IX	1.92e-01	2.47e-02	NA
2. P	A4IIW9	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	5.65e-04	6.94e-03	NA
2. P	Q86QS6	Acidic leucine-rich nuclear phosphoprotein 32-related protein	4.03e-03	1.89e-03	NA
2. P	Q50L44	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	4.07e-04	9.35e-04	NA
3. B	Q504C1	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2	5.29e-03	NA	0.001
3. B	O43155	Leucine-rich repeat transmembrane protein FLRT2	2.50e-04	NA	6.85e-09
3. B	Q723X5	Internalin I	1.78e-02	NA	9.65e-05
3. B	Q6QMY6	Tsukushi	2.68e-06	NA	4.81e-04
3. B	Q9HCJ2	Leucine-rich repeat-containing protein 4C	1.47e-04	NA	0.002
3. B	O75094	Slit homolog 3 protein	3.73e-02	NA	3.48e-05
3. B	Q08817	Leucine-rich repeat-containing protein SOG2	4.38e-02	NA	2.11e-06
3. B	Q9BYS8	Leucine-rich repeat-containing protein 2	2.74e-11	NA	8.35e-14
3. B	Q9DGB6	Toll-like receptor 2 type-2	2.17e-03	NA	0.020
3. B	Q8LPB4	Phytosulfokine receptor 1	3.42e-03	NA	0.050
3. B	Q8AVI4	Leucine-rich repeat protein SHOC-2	1.31e-11	NA	3.86e-19
3. B	Q8GRU6	Leucine-rich repeat receptor-like kinase protein HAR1	1.75e-03	NA	4.22e-07
3. B	B0BNK7	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	8.63e-05	NA	0.020
3. B	Q9VJ07	Protein phosphatase PHLPP-like protein	5.71e-04	NA	0.027
3. B	Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2	9.58e-02	NA	1.06e-09
3. B	Q9DE68	Decorin	1.53e-11	NA	1.09e-08
3. B	Q5NVQ6	Immunoglobulin superfamily containing leucine-rich repeat protein	5.91e-04	NA	2.11e-06
3. B	Q5VUJ6	Leucine-rich repeat and calponin homology domain-containing protein 2	4.24e-05	NA	1.05e-13
3. B	O93233	Phospholipase A2 inhibitor	8.20e-09	NA	2.52e-05
3. B	Q96RT1	Erbin	8.79e-05	NA	2.64e-19
3. B	Q2R2D5	Receptor kinase-like protein Xa21	1.68e-03	NA	4.78e-06
3. B	Q6FRT2	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.10e-02	NA	5.52e-06
3. B	Q8L899	Systemin receptor SR160	1.48e-02	NA	1.11e-05
3. B	Q3UMG5	Leucine-rich repeat and calponin homology domain-containing protein 2	1.11e-04	NA	1.81e-13
3. B	Q3V1N1	Malignant fibrous histiocytoma-amplified sequence 1 homolog	2.67e-04	NA	1.26e-12
3. B	Q80YS5	Leucine-rich repeat-containing protein 27	6.61e-03	NA	2.80e-06
3. B	Q9XSD9	Decorin	3.18e-11	NA	5.86e-08
3. B	Q9SHI2	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	3.36e-03	NA	1.57e-09
3. B	Q9WVC1	Slit homolog 2 protein (Fragment)	1.97e-03	NA	0.015
3. B	P07585	Decorin	2.68e-11	NA	2.01e-06
3. B	Q8ZQQ2	E3 ubiquitin-protein ligase SlrP	2.91e-05	NA	7.70e-05
3. B	Q9LVP0	Probable leucine-rich repeat receptor-like protein kinase At5g63930	3.57e-03	NA	1.94e-07
3. B	Q4H4B6	Protein scribble homolog	8.38e-04	NA	9.73e-22
3. B	Q8TF66	Leucine-rich repeat-containing protein 15	6.46e-06	NA	6.30e-07
3. B	P13605	Fibromodulin	1.38e-07	NA	5.71e-04
3. B	B5DX45	Leucine-rich repeat protein soc-2 homolog	4.83e-11	NA	3.72e-19
3. B	C0LGE4	Probable LRR receptor-like serine/threonine-protein kinase At1g12460	1.25e-03	NA	0.002
3. B	O55226	Chondroadherin	2.60e-06	NA	0.024
3. B	Q3UHC2	Leucine-rich repeat serine/threonine-protein kinase 1	3.35e-02	NA	2.36e-06
3. B	F4KIF3	Disease resistance-like protein CSA1	8.33e-03	NA	0.022
3. B	Q7Z5L7	Podocan	1.40e-06	NA	0.009
3. B	Q9SKG5	Somatic embryogenesis receptor kinase 4	2.18e-02	NA	3.03e-07
3. B	F4IUU1	Receptor like protein 27	1.12e-03	NA	8.45e-05
3. B	Q6R2K2	Protein STRUBBELIG-RECEPTOR FAMILY 4	6.30e-04	NA	0.028
3. B	Q9NZU0	Leucine-rich repeat transmembrane protein FLRT3	4.23e-04	NA	6.27e-07
3. B	Q8C031	Leucine-rich repeat-containing protein 4C	1.73e-04	NA	0.001
3. B	Q9NR96	Toll-like receptor 9	1.34e-02	NA	0.030
3. B	Q6JN47	Receptor-like protein EIX1	3.58e-03	NA	0.001
3. B	Q9C9H7	Receptor-like protein 12	1.30e-03	NA	4.92e-06
3. B	F1MLX5	Leucine-rich repeat-containing G-protein coupled receptor 4	6.62e-04	NA	2.58e-07
3. B	Q8RX63	Receptor-like protein 31	1.30e-03	NA	1.82e-06
3. B	P93194	Receptor-like protein kinase	1.50e-03	NA	9.29e-08
3. B	Q2WF71	Leucine-rich repeat and fibronectin type III domain-containing protein 1	2.87e-04	NA	1.96e-05
3. B	Q8BGR2	Volume-regulated anion channel subunit LRRC8D	1.97e-09	NA	5.77e-17
3. B	C0LGN2	Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840	6.21e-03	NA	0.001
3. B	A8XWW4	Leucine-rich repeat protein soc-2	2.04e-11	NA	9.25e-17
3. B	O02678	Biglycan	1.17e-10	NA	0.003
3. B	Q9BXN1	Asporin	9.05e-09	NA	0.048
3. B	Q86YC3	Transforming growth factor beta activator LRRC33	1.08e-05	NA	0.003
3. B	P47853	Biglycan	1.28e-10	NA	4.85e-05
3. B	Q8BLY3	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	7.79e-05	NA	0.019
3. B	Q6BMM5	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.60e-02	NA	3.85e-09
3. B	Q9C6A8	Receptor-like protein 15	1.58e-03	NA	2.94e-04
3. B	Q6R6I7	Relaxin receptor 1	4.07e-04	NA	0.004
3. B	O49879	Receptor-like protein Cf-9 homolog	2.92e-03	NA	0.003
3. B	Q5R1V9	Decorin	2.58e-11	NA	2.01e-06
3. B	Q5ZLN0	Leucine-rich repeat-containing protein 40	3.08e-07	NA	7.42e-15
3. B	P28654	Decorin	1.40e-11	NA	1.26e-05
3. B	Q942F3	Brassinosteroid LRR receptor kinase BRI1	8.51e-03	NA	5.27e-04
3. B	Q9UFC0	Leucine-rich repeat and WD repeat-containing protein 1	1.02e-01	NA	0.004
3. B	G5EG78	Peroxidasin homolog pxn-2	8.03e-02	NA	0.026
3. B	P51888	Prolargin	3.25e-08	NA	0.003
3. B	Q93YT3	Receptor-like protein 50	1.58e-03	NA	9.29e-05
3. B	Q9SSL9	Leucine-rich repeat receptor-like protein kinase PEPR1	1.92e-03	NA	2.19e-07
3. B	F4HTV6	Putative receptor-like protein 16	1.40e-09	NA	4.96e-05
3. B	Q9LJF3	Receptor-like protein kinase BRI1-like 3	NA	NA	3.23e-04
3. B	Q9WTR8	PH domain leucine-rich repeat protein phosphatase 1	1.32e-02	NA	5.03e-08
3. B	Q22875	Leucine-rich repeat protein soc-2	7.36e-10	NA	3.07e-16
3. B	Q6NSJ5	Volume-regulated anion channel subunit LRRC8E	1.92e-09	NA	5.31e-20
3. B	Q8N9N7	Leucine-rich repeat-containing protein 57	2.60e-14	NA	1.50e-13
3. B	Q5F334	Leucine-rich repeat-containing protein 59	2.25e-03	NA	7.73e-04
3. B	Q6RKD8	Leucine-rich repeat transmembrane protein FLRT1	1.43e-04	NA	3.44e-05
3. B	F1MT22	Leucine-rich repeat-containing G-protein coupled receptor 5	5.73e-04	NA	1.63e-09
3. B	Q9C699	Receptor-like protein 7	8.31e-07	NA	7.49e-08
3. B	Q6Z8P4	Plant intracellular Ras-group-related LRR protein 4	3.06e-12	NA	3.92e-16
3. B	Q9LJM4	Receptor-like protein kinase HAIKU2	2.47e-03	NA	8.04e-11
3. B	Q3ZBI5	Transforming growth factor beta activator LRRC33	1.77e-05	NA	0.003
3. B	Q92626	Peroxidasin homolog	1.43e-01	NA	0.010
3. B	P0C895	LRR repeats and ubiquitin-like domain-containing protein At2g30105	6.35e-13	NA	4.01e-13
3. B	Q9XIL9	Pollen-specific leucine-rich repeat extensin-like protein 3	5.27e-05	NA	2.89e-05
3. B	Q9LJS2	Receptor-like protein 41	3.96e-03	NA	2.46e-04
3. B	Q9LRR5	Putative disease resistance protein At3g14460	6.56e-02	NA	0.001
3. B	Q9FL28	LRR receptor-like serine/threonine-protein kinase FLS2	3.20e-03	NA	5.23e-11
3. B	Q9R1B9	Slit homolog 2 protein	7.65e-02	NA	0.011
3. B	Q29393	Decorin	1.84e-11	NA	1.20e-07
3. B	Q13045	Protein flightless-1 homolog	1.16e-03	NA	1.86e-06
3. B	Q5BJ41	CCR4-NOT transcription complex subunit 6	9.75e-03	NA	3.19e-07
3. B	P0CP23	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.97e-02	NA	2.11e-06
3. B	Q9DBY4	TLR4 interactor with leucine rich repeats	4.14e-04	NA	1.66e-08
3. B	P50608	Fibromodulin	1.90e-07	NA	4.95e-04
3. B	Q8TCA0	Leucine-rich repeat-containing protein 20	7.92e-12	NA	2.78e-04
3. B	Q0WR59	Probable inactive receptor kinase At5g10020	5.67e-03	NA	0.038
3. B	Q9ULM6	CCR4-NOT transcription complex subunit 6	6.42e-03	NA	5.03e-07
3. B	D4ABX8	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	1.16e-04	NA	0.001
3. B	Q80X72	Leucine-rich repeat-containing protein 15	3.09e-05	NA	2.25e-11
3. B	Q7KRY7	Protein lap4	2.87e-03	NA	6.14e-22
3. B	Q01631	Adenylate cyclase	5.79e-02	NA	4.89e-11
3. B	Q965M2	Leucine-rich repeats and immunoglobulin-like domains protein sma-10	3.67e-03	NA	0.003
3. B	Q9SSD1	Protein TOO MANY MOUTHS	5.76e-05	NA	4.61e-04
3. B	Q9LS79	Receptor-like protein 38	1.68e-03	NA	0.005
3. B	Q9C9N5	Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830	2.15e-03	NA	3.93e-05
3. B	P21809	Biglycan	1.32e-10	NA	8.13e-05
3. B	Q9GKN8	Prolargin	2.38e-08	NA	5.81e-04
3. B	O88279	Slit homolog 1 protein	4.94e-02	NA	2.97e-04
3. B	Q5RAC4	SLIT and NTRK-like protein 1	2.68e-04	NA	5.75e-04
3. B	Q9HBX8	Leucine-rich repeat-containing G-protein coupled receptor 6	5.82e-04	NA	9.65e-08
3. B	F4I9S3	Receptor-like protein 9a	2.41e-03	NA	0.008
3. B	Q8VYG9	Plant intracellular Ras-group-related LRR protein 9	2.12e-10	NA	1.37e-13
3. B	Q5RI43	Keratocan	5.22e-08	NA	8.11e-04
3. B	B4LXW1	Leucine-rich repeat protein soc-2 homolog	1.82e-11	NA	2.22e-19
3. B	Q8CHE4	PH domain leucine-rich repeat-containing protein phosphatase 1	1.23e-02	NA	4.03e-08
3. B	Q3ZC49	Leucine-rich repeat-containing protein 39	5.07e-11	NA	1.67e-12
3. B	Q7KIN0	Toll-like receptor 7	2.02e-02	NA	7.17e-08
3. B	Q9NR99	Matrix-remodeling-associated protein 5	NA	NA	3.35e-04
3. B	Q9ZUK3	Receptor-like protein 19	9.21e-05	NA	2.65e-05
3. B	Q9VEK6	Leucine-rich repeat protein soc-2 homolog	6.98e-11	NA	1.76e-19
3. B	Q6NWG1	Leucine-rich repeat-containing protein 59	5.66e-03	NA	1.93e-05
3. B	D3ZTV3	Leucine-rich repeat transmembrane protein FLRT2	2.44e-04	NA	6.21e-09
3. B	A7SFP1	Leucine-rich repeat protein soc-2 homolog	5.73e-10	NA	3.36e-18
3. B	Q8VZG8	MDIS1-interacting receptor like kinase 2	6.03e-03	NA	1.67e-09
3. B	Q0WVM4	Probable LRR receptor-like serine/threonine-protein kinase At2g23950	1.87e-02	NA	6.42e-06
3. B	O60346	PH domain leucine-rich repeat-containing protein phosphatase 1	2.57e-02	NA	8.22e-06
3. B	Q96NI6	Leucine-rich repeat and fibronectin type-III domain-containing protein 5	5.11e-04	NA	0.005
3. B	A2Q9L0	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.77e-02	NA	3.31e-07
3. B	Q9C7T7	Receptor protein-tyrosine kinase CEPR2	2.89e-03	NA	1.43e-09
3. B	C0LGJ9	Probable LRR receptor-like serine/threonine-protein kinase At2g02780	3.62e-04	NA	2.47e-04
3. B	G7JIK2	Leucine-rich repeat receptor-like kinase protein SUNN	7.74e-04	NA	9.64e-11
3. B	Q80ZI6	E3 ubiquitin-protein ligase LRSAM1	2.57e-04	NA	4.10e-10
3. B	O46378	Fibromodulin (Fragment)	1.77e-12	NA	0.043
3. B	Q9C6A6	Receptor-like protein 13	2.54e-03	NA	0.002
3. B	Q9FZ59	Leucine-rich repeat receptor-like protein kinase PEPR2	3.62e-03	NA	5.48e-09
3. B	Q80U72	Protein scribble homolog	6.25e-04	NA	3.51e-18
3. B	Q8S7M7	Plant intracellular Ras-group-related LRR protein 5	5.75e-09	NA	6.12e-17
3. B	Q6QNU9	Toll-like receptor 12	9.01e-03	NA	0.003
3. B	P28653	Biglycan	1.43e-10	NA	4.32e-05
3. B	Q96PX8	SLIT and NTRK-like protein 1	4.67e-04	NA	6.17e-04
3. B	O80809	Receptor-like protein CLAVATA2	6.08e-05	NA	2.36e-05
3. B	W8DXL4	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3	6.36e-03	NA	1.55e-04
3. B	B0M0P8	Ras guanine nucleotide exchange factor L	1.08e-02	NA	1.49e-14
3. B	Q6XHA6	Probable inactive serine/threonine-protein kinase roco10	6.71e-02	NA	1.54e-10
3. B	C0LGH8	Probable LRR receptor-like serine/threonine-protein kinase At1g63430	4.64e-03	NA	2.83e-05
3. B	Q91ZZ5	Relaxin receptor 2	1.58e-04	NA	0.002
3. B	Q9SJH6	Receptor like protein 29	2.76e-08	NA	6.70e-10
3. B	Q4WQG5	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	9.99e-03	NA	9.74e-08
3. B	O94813	Slit homolog 2 protein	4.12e-02	NA	0.004
3. B	Q9HBX9	Relaxin receptor 1	1.74e-04	NA	7.16e-05
3. B	Q7G768	Brassinosteroid LRR receptor kinase BRL2	6.57e-03	NA	8.53e-07
3. B	C0LGQ9	LRR receptor-like serine/threonine-protein kinase GHR1	2.24e-04	NA	2.68e-10
3. B	Q8IWT6	Volume-regulated anion channel subunit LRRC8A	1.27e-07	NA	1.26e-19
3. B	Q5RAV5	Leucine-rich repeat protein SHOC-2	1.49e-11	NA	1.05e-15
3. B	Q7L1W4	Volume-regulated anion channel subunit LRRC8D	2.63e-06	NA	7.52e-17
3. B	O48809	Leucine-rich repeat extensin-like protein 2	3.58e-04	NA	5.73e-09
3. B	Q8BGT1	Leucine-rich repeat transmembrane protein FLRT3	1.97e-04	NA	1.94e-07
3. B	P02750	Leucine-rich alpha-2-glycoprotein	4.34e-08	NA	8.37e-09
3. B	C0LGQ4	Protein MALE DISCOVERER 2	2.47e-01	NA	0.003
3. B	O22938	Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3	1.58e-03	NA	5.64e-06
3. B	Q9DD78	Toll-like receptor 2 type-1	3.28e-03	NA	0.021
3. B	Q5G5E0	Plant intracellular Ras-group-related LRR protein 5	1.32e-08	NA	2.82e-15
3. B	Q9UQ13	Leucine-rich repeat protein SHOC-2	1.47e-11	NA	1.05e-15
3. B	C0LGK4	Probable LRR receptor-like serine/threonine-protein kinase At2g16250	8.81e-04	NA	1.27e-04
3. B	Q9NZU1	Leucine-rich repeat transmembrane protein FLRT1	1.75e-04	NA	2.42e-05
3. B	Q9P244	Leucine-rich repeat and fibronectin type III domain-containing protein 1	3.03e-04	NA	1.77e-05
3. B	Q9SCT4	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2	1.10e-03	NA	0.007
3. B	V9M398	Disease resistance protein RUN1	4.87e-03	NA	7.86e-09
3. B	Q6AYI5	Leucine-rich repeat protein SHOC-2	1.94e-11	NA	1.20e-15
3. B	Q80ZD9	Amphoterin-induced protein 2	4.66e-04	NA	0.001
3. B	B1H234	Leucine-rich repeat transmembrane protein FLRT3	2.89e-04	NA	2.35e-07
3. B	Q9SRL7	Receptor-like protein 35	8.31e-05	NA	1.29e-04
3. B	O64789	Probable disease resistance protein At1g61310	1.39e-03	NA	0.047
3. B	Q5FW85	Extracellular matrix protein 2	1.89e-05	NA	2.32e-06
3. B	O82318	Leucine-rich repeat receptor-like serine/threonine-protein kinase SKM1	1.20e-03	NA	1.59e-05
3. B	Q8LPS5	Somatic embryogenesis receptor kinase 5	1.64e-02	NA	0.002
3. B	Q9ZUI0	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130	9.96e-04	NA	9.16e-11
3. B	Q9ZU46	Receptor protein kinase-like protein ZAR1	9.00e-04	NA	0.002
3. B	Q40235	Receptor-like protein Cf-9	1.24e-06	NA	0.008
3. B	Q8RZV7	Leucine-rich repeat receptor protein kinase MSP1	8.51e-03	NA	2.28e-06
3. B	Q1RMS4	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	7.12e-05	NA	0.015
3. B	Q9FK66	Receptor-like protein 55	9.97e-06	NA	0.008
3. B	O65375	Leucine-rich repeat extensin-like protein 1	2.01e-04	NA	4.36e-07
3. B	Q5MR23	Receptor-like protein 9DC3	6.62e-03	NA	0.015
3. B	O70210	Chondroadherin	2.59e-06	NA	0.030
3. B	Q0U7W4	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	8.44e-03	NA	2.07e-07
3. B	Q960C5	Leucine-rich repeat and calponin homology domain-containing protein	1.31e-05	NA	1.11e-11
3. B	V9M2S5	Disease resistance protein RPV1	7.76e-03	NA	8.28e-09
3. B	Q14392	Transforming growth factor beta activator LRRC32	3.45e-05	NA	0.022
3. B	Q8R5M3	Leucine-rich repeat-containing protein 15	5.72e-05	NA	1.55e-09
3. B	G9LZD7	Probable inactive leucine-rich repeat receptor kinase XIAO	1.44e-03	NA	1.72e-10
3. B	Q9Y2L9	Leucine-rich repeat and calponin homology domain-containing protein 1	1.84e-07	NA	2.75e-14
3. B	P35334	Polygalacturonase inhibitor 1	1.69e-06	NA	0.003
3. B	O46403	Biglycan	1.48e-10	NA	2.01e-04
3. B	O75473	Leucine-rich repeat-containing G-protein coupled receptor 5	1.58e-04	NA	2.14e-07
3. B	Q8IUZ0	Leucine-rich repeat-containing protein 49	1.03e-04	NA	3.02e-06
3. B	F4HWL3	Receptor-like protein 4	4.72e-02	NA	6.46e-04
3. B	D3ZXS4	Leucine-rich repeat-containing protein 39	1.13e-09	NA	1.20e-14
3. B	Q9CRC8	Leucine-rich repeat-containing protein 40	2.58e-07	NA	2.19e-14
3. B	P31384	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.80e-02	NA	4.87e-06
3. B	Q9SLI6	Putative receptor-like protein 8	1.57e-03	NA	0.005
3. B	O49545	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1	2.46e-03	NA	2.91e-04
3. B	Q9H5Y7	SLIT and NTRK-like protein 6	6.58e-03	NA	5.14e-08
3. B	Q940E8	Leucine-rich repeat receptor-like protein FASCIATED EAR2	2.89e-04	NA	2.21e-09
3. B	Q8YA32	Internalin I	1.83e-02	NA	0.001
3. B	Q54AX5	Leucine-rich repeat protein lrrA	6.11e-09	NA	1.29e-16
3. B	A1CIJ6	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.18e-02	NA	3.61e-07
3. B	C0LGR3	LRR receptor-like serine/threonine-protein kinase RGI3	4.39e-03	NA	2.65e-09
3. B	Q91YK0	Leucine-rich repeat-containing protein 49	3.24e-04	NA	1.65e-05
3. B	B3LWU3	Leucine-rich repeat protein soc-2 homolog	7.42e-11	NA	8.96e-20
3. B	Q9XIC7	Somatic embryogenesis receptor kinase 2	1.61e-02	NA	8.86e-06
3. B	Q5S006	Leucine-rich repeat serine/threonine-protein kinase 2	1.26e-01	NA	2.76e-07
3. B	Q9SZ67	Probable WRKY transcription factor 19	5.81e-02	NA	0.037
3. B	Q1L8Y7	Leucine-rich repeat protein SHOC-2	1.15e-11	NA	1.10e-15
3. B	Q5FVI3	Leucine-rich repeat-containing protein 57	1.81e-14	NA	2.75e-13
3. B	Q61809	Leucine-rich repeat neuronal protein 1	6.63e-04	NA	0.017
3. B	Q9SRL2	Receptor-like protein 34	4.50e-04	NA	8.35e-05
3. B	Q05C16	Leucine-rich repeat-containing protein 63	4.02e-04	NA	1.25e-07
3. B	Q99983	Osteomodulin	1.14e-05	NA	0.011
3. B	O75093	Slit homolog 1 protein	6.02e-02	NA	4.70e-04
3. B	Q9S9U3	Receptor-like protein 53	1.44e-03	NA	0.006
3. B	C0LGR9	Probable LRR receptor-like serine/threonine-protein kinase At4g31250	8.45e-03	NA	0.045
3. B	Q96DD0	Leucine-rich repeat-containing protein 39	4.38e-10	NA	2.70e-15
3. B	Q80TE7	Leucine-rich repeat-containing protein 7	6.10e-04	NA	1.22e-15
3. B	Q9T0K5	Leucine-rich repeat extensin-like protein 3	5.02e-05	NA	7.29e-05
3. B	Q01513	Adenylate cyclase	4.04e-02	NA	1.39e-08
3. B	Q9ZPS9	Serine/threonine-protein kinase BRI1-like 2	4.86e-03	NA	1.08e-08
3. B	Q810C0	SLIT and NTRK-like protein 2	2.77e-03	NA	0.043
3. B	P47735	Receptor-like protein kinase 5	3.48e-03	NA	1.95e-07
3. B	Q80TH2	Erbin	3.89e-04	NA	1.26e-17
3. B	P0DO06	Receptor-like protein 9DC2	5.02e-04	NA	0.013
3. B	Q54WS5	Probable serine/threonine-protein kinase roco6	5.70e-02	NA	3.04e-04
3. B	Q9FGL5	Receptor protein-tyrosine kinase CEPR1	1.48e-03	NA	2.23e-09
3. B	Q9LFS4	Protein NSP-INTERACTING KINASE 1	4.51e-03	NA	9.99e-06
3. B	Q9C637	Receptor-like protein 6	1.71e-03	NA	0.006
3. B	E9Q7T7	Chondroadherin-like protein	2.16e-04	NA	1.77e-09
3. B	Q6Z4U4	LRR receptor kinase BAK1	8.72e-03	NA	3.15e-04
3. B	Q9LYN8	Leucine-rich repeat receptor protein kinase EMS1	5.84e-03	NA	1.50e-07
3. B	Q8MVR1	Cyclic GMP-binding protein C	5.03e-01	NA	5.08e-12
3. B	Q6NQP4	Leucine-rich repeat protein 2	1.66e-04	NA	3.64e-08
3. B	Q6CJU4	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.79e-02	NA	1.33e-06
3. B	Q9C2R2	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	5.10e-02	NA	1.34e-07
3. B	Q9FIZ3	LRR receptor-like serine/threonine-protein kinase GSO2	2.94e-03	NA	7.06e-08
3. B	A6QLV3	Leucine-rich repeat protein SHOC-2	2.05e-11	NA	1.07e-15
3. B	Q6ZCZ2	Brassinosteroid LRR receptor kinase BRL3	1.34e-02	NA	0.001
3. B	C0LGS3	Probable LRR receptor-like serine/threonine-protein kinase At4g37250	3.05e-03	NA	2.02e-04
3. B	A0A1P8ATR9	Receptor-like protein 9b	2.63e-03	NA	0.003
3. B	Q6AXU9	CCR4-NOT transcription complex subunit 6	2.29e-02	NA	3.32e-07
3. B	C4V7I7	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.83e-03	NA	0.001
3. B	C0LGP9	Probable leucine-rich repeat receptor-like protein kinase IMK3	2.36e-04	NA	4.30e-06
3. B	Q9LP24	Probable leucine-rich repeat receptor-like protein kinase At1g35710	6.98e-03	NA	7.10e-10
3. B	Q9LFG1	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590	1.08e-03	NA	5.16e-08
3. B	O35103	Osteomodulin	1.28e-05	NA	5.86e-09
3. B	Q0CT27	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.23e-02	NA	3.42e-08
3. B	Q3UVD5	Leucine-rich repeat-containing G-protein coupled receptor 6	5.54e-04	NA	3.20e-07
3. B	Q6DF55	Vasorin	2.04e-04	NA	1.22e-08
3. B	Q01129	Decorin	1.01e-11	NA	5.59e-08
3. B	Q1ZXD6	Probable serine/threonine-protein kinase roco5	NA	NA	2.01e-11
3. B	Q6WRI0	Immunoglobulin superfamily member 10	3.82e-01	NA	2.70e-05
3. B	Q09564	Protein phosphatase PHLPP-like protein	7.61e-04	NA	2.27e-08
3. B	D4AC13	Leucine-rich repeat-containing G-protein coupled receptor 5	6.21e-04	NA	4.95e-09
3. B	Q00874	DNA damage-repair/toleration protein DRT100	4.88e-08	NA	6.94e-04
3. B	Q6P3Y9	Podocan-like protein 1	5.20e-09	NA	1.22e-04
3. B	O46390	Biglycan	1.10e-10	NA	7.50e-05
3. B	Q9JK53	Prolargin	2.46e-08	NA	0.029
3. B	Q6AXL3	Transforming growth factor beta activator LRRC33	1.25e-04	NA	5.34e-05
3. B	Q8R502	Volume-regulated anion channel subunit LRRC8C	5.04e-09	NA	2.25e-18
3. B	Q9DE66	Keratocan	1.26e-07	NA	0.032
3. B	Q5TJ59	Toll-like receptor 3	3.01e-03	NA	3.70e-04
3. B	Q96II8	DISP complex protein LRCH3	1.37e-05	NA	2.14e-14
3. B	Q6P2D8	X-ray radiation resistance-associated protein 1	8.42e-03	NA	0.032
3. B	Q9M0G7	MDIS1-interacting receptor like kinase 1	3.19e-03	NA	5.12e-10
3. B	O75325	Leucine-rich repeat neuronal protein 2	3.48e-04	NA	0.002
3. B	Q8N135	Leucine-rich repeat LGI family member 4	1.50e-02	NA	0.026
3. B	Q68CR7	Leucine-rich repeat-containing protein 66	2.74e-02	NA	4.33e-05
3. B	Q1MX30	Receptor kinase-like protein Xa21	1.25e-03	NA	6.20e-06
3. B	F4J339	Probable disease resistance protein RPP1	4.52e-03	NA	0.045
3. B	Q6ZH85	Plant intracellular Ras-group-related LRR protein 2	1.20e-08	NA	4.79e-14
3. B	Q8VDB8	Leucine-rich repeat-containing protein 2	4.94e-11	NA	3.44e-16
3. B	Q6UXM1	Leucine-rich repeats and immunoglobulin-like domains protein 3	8.30e-03	NA	0.004
3. B	Q6K4T4	LRR receptor kinase SERK2	1.50e-02	NA	0.003
3. B	Q54XZ5	Probable serine/threonine-protein kinase DDB_G0278509	2.65e-05	NA	1.16e-10
3. B	Q6PEZ8	Podocan-like protein 1	1.63e-06	NA	2.39e-05
3. B	F4JTU7	Receptor-like protein 48	1.05e-03	NA	9.48e-06
3. B	Q9FII5	Leucine-rich repeat receptor-like protein kinase TDR	7.64e-03	NA	7.78e-07
3. B	P0CP22	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.49e-02	NA	2.04e-06
3. B	Q52KR2	Leucine-rich repeats and immunoglobulin-like domains protein 2	4.52e-03	NA	3.57e-07
3. B	Q6EMK4	Vasorin	8.30e-06	NA	9.98e-05
3. B	Q8VEG6	CCR4-NOT transcription complex subunit 6-like	9.15e-03	NA	1.96e-07
3. B	Q9SIT1	Receptor-like kinase TMK3	1.99e-03	NA	1.39e-04
3. B	Q32Q07	Leucine-rich repeat neuronal protein 1	8.41e-04	NA	0.007
3. B	Q75BI3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	8.38e-02	NA	4.77e-06
3. B	Q6XAT2	LRR receptor-like serine/threonine-protein kinase ERL2	4.16e-04	NA	5.72e-07
3. B	Q24020	Protein flightless-1	1.20e-03	NA	2.38e-12
3. B	I1Z695	LRR receptor-like serine/threonine-protein kinase ER2	6.49e-04	NA	1.55e-08
3. B	B4IBI9	Leucine-rich repeat protein soc-2 homolog	1.22e-08	NA	3.28e-19
3. B	Q2UUI3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.25e-01	NA	7.27e-09
3. B	Q7XK44	Plant intracellular Ras-group-related LRR protein 3	1.07e-08	NA	2.08e-13
3. B	Q5E9X4	Leucine-rich repeat-containing protein 59	3.02e-03	NA	1.06e-04
3. B	Q3UQ28	Peroxidasin homolog	1.43e-01	NA	0.003
3. B	Q6P1C6	Leucine-rich repeats and immunoglobulin-like domains protein 3	7.96e-03	NA	2.56e-04
3. B	B5UBC1	Disease resistance protein Pikm1-TS	6.27e-03	NA	2.16e-06
3. B	Q9LRV8	Plant intracellular Ras-group-related LRR protein 2	1.03e-11	NA	4.77e-12
3. B	Q80XU8	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	1.37e-04	NA	0.001
3. B	O75427	Leucine-rich repeat and calponin homology domain-containing protein 4	4.12e-07	NA	2.65e-20
3. B	Q9TTB4	Fibromodulin (Fragment)	1.56e-12	NA	0.042
3. B	Q7SXW3	Leucine-rich repeat-containing protein 40	4.63e-07	NA	1.52e-15
3. B	O88520	Leucine-rich repeat protein SHOC-2	1.47e-11	NA	1.42e-15
3. B	A6NM36	Leucine-rich repeat-containing protein 30	5.99e-13	NA	3.20e-13
3. B	Q4UWF4	Uridine 5'-monophosphate transferase	7.21e-05	NA	4.77e-05
3. B	Q9FYK0	Receptor-like kinase TMK2	1.80e-03	NA	0.021
3. B	B0BLW3	Leucine-rich repeat-containing G-protein coupled receptor 4	3.40e-04	NA	3.85e-10
3. B	Q8CI70	Leucine-rich repeat-containing protein 20	1.35e-11	NA	2.81e-04
3. B	Q3V1M1	Immunoglobulin superfamily member 10	3.67e-01	NA	1.35e-05
3. B	Q96L50	Leucine-rich repeat protein 1	6.81e-08	NA	2.44e-10
3. B	O35930	Platelet glycoprotein Ib alpha chain	3.34e-07	NA	5.90e-05
3. B	Q4P9T3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.76e-02	NA	1.34e-06
3. B	P14605	Adenylate cyclase	3.37e-03	NA	1.34e-07
3. B	Q9Z1P4	Leucine-rich repeat-containing G-protein coupled receptor 5	2.72e-03	NA	1.48e-08
3. B	Q9LZV7	Leucine-rich repeat receptor-like protein kinase PXC2	6.88e-04	NA	5.49e-08
3. B	A4IGL7	Peroxidasin	1.83e-01	NA	0.028
3. B	C0LGT6	LRR receptor-like serine/threonine-protein kinase EFR	9.43e-04	NA	8.52e-08
3. B	Q6DHL5	Leucine-rich repeat-containing protein 57	8.22e-15	NA	3.77e-16
3. B	Q55CS7	MAP kinase phosphatase with leucine-rich repeats protein 1	1.68e-04	NA	2.30e-06
3. B	O15335	Chondroadherin	2.81e-07	NA	0.010
3. B	Q42371	LRR receptor-like serine/threonine-protein kinase ERECTA	9.58e-04	NA	1.59e-05
3. B	Q9RBS2	Protein PopC	7.41e-04	NA	2.36e-12
3. B	Q9HB75	p53-induced death domain-containing protein 1	1.08e-04	NA	4.97e-17
3. B	C0LGW6	LRR receptor-like serine/threonine-protein kinase ERL1	7.58e-04	NA	1.06e-06
3. B	F4JT82	Probable disease resistance protein At4g19520	2.37e-02	NA	0.007
3. B	B4N9T4	Leucine-rich repeat protein soc-2 homolog	6.14e-11	NA	2.32e-19
3. B	A1CW67	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.22e-02	NA	4.08e-07
3. B	Q5XH73	CCR4-NOT transcription complex subunit 6-like-B	1.39e-02	NA	0.010
3. B	Q3UV48	Leucine-rich repeat-containing protein 30	5.31e-13	NA	2.40e-14
3. B	B3P3E8	Leucine-rich repeat protein soc-2 homolog	6.61e-11	NA	2.64e-19
3. B	F1MCA7	Leucine-rich repeat-containing protein 7	3.35e-04	NA	1.32e-17
3. B	P0DL10	Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1	4.97e-03	NA	1.16e-09
3. B	Q9LY03	Probable LRR receptor-like serine/threonine-protein kinase IRK	1.73e-03	NA	8.27e-07
3. B	P0C7J6	Leucine-rich repeat and fibronectin type III domain-containing protein 1	2.90e-04	NA	2.00e-05
3. B	Q7TQ62	Podocan	4.72e-06	NA	1.25e-05
3. B	Q9LUI1	Leucine-rich repeat extensin-like protein 6	3.33e-06	NA	1.06e-04
3. B	Q9FHF0	Disease resistance protein RPS4B	8.62e-03	NA	0.044
3. B	P21810	Biglycan	1.27e-10	NA	4.93e-05
3. B	Q9M5J9	Polygalacturonase inhibitor 1	2.20e-06	NA	0.037
3. B	Q9SKK5	Receptor-like protein 20	7.94e-04	NA	2.95e-06
3. B	Q9LRW9	Receptor-like protein 40	3.54e-03	NA	0.004
3. B	Q80TM9	Nischarin	1.44e-02	NA	0.002
3. B	A8JAM0	Dynein regulatory complex subunit 7 (Fragment)	4.98e-04	NA	1.62e-16
3. B	Q4R6F0	Leucine-rich repeat and death domain-containing protein 1	2.31e-05	NA	1.52e-14
3. B	Q96NW7	Leucine-rich repeat-containing protein 7	2.03e-04	NA	1.06e-14
3. B	Q658G7	LRR receptor-like serine/threonine-protein kinase SIK1	1.26e-03	NA	6.25e-09
3. B	Q6UWE0	E3 ubiquitin-protein ligase LRSAM1	6.24e-04	NA	6.03e-13
3. B	B8ABC2	Leucine-rich repeat protein 1	1.77e-04	NA	8.44e-06
3. B	Q6NX28	Leucine-rich repeat-containing protein 59	2.00e-03	NA	0.004
3. B	Q5R5V8	Relaxin receptor 1	3.72e-04	NA	3.71e-05
3. B	Q9ULH4	Leucine-rich repeat and fibronectin type-III domain-containing protein 2	1.14e-03	NA	0.014
3. B	Q27972	Chondroadherin	NA	NA	0.033
3. B	F4HX15	Phospholipase A I	6.18e-02	NA	4.36e-07
3. B	Q8BVU0	DISP complex protein LRCH3	1.05e-05	NA	1.33e-13
3. B	Q8TDW0	Volume-regulated anion channel subunit LRRC8C	3.20e-10	NA	6.76e-19
3. B	Q38SD2	Leucine-rich repeat serine/threonine-protein kinase 1	2.96e-02	NA	2.85e-08
3. B	Q9SGP2	Receptor-like protein kinase HSL1	3.27e-03	NA	1.16e-09
3. B	Q55FD8	Ras guanine nucleotide exchange factor V	4.30e-02	NA	1.45e-08
3. B	Q9BXB1	Leucine-rich repeat-containing G-protein coupled receptor 4	2.22e-03	NA	2.49e-07
3. B	E5DHB5	Leucine-rich repeat-containing G-protein coupled receptor 5A	6.77e-04	NA	6.43e-08
3. B	O49328	Receptor like protein 26	3.14e-03	NA	2.14e-06
3. B	Q9LJS0	Receptor-like protein 42	1.51e-03	NA	6.66e-05
3. B	Q96AG4	Leucine-rich repeat-containing protein 59	3.50e-03	NA	1.32e-04
3. B	P58874	Opticin	1.46e-08	NA	0.015
3. B	Q8AVS8	Leucine-rich repeat-containing protein 59	3.73e-03	NA	0.002
3. B	Q9LNV9	Receptor-like protein 1	7.92e-04	NA	1.22e-05
3. B	Q55E58	Probable serine/threonine-protein kinase pats1	NA	NA	2.17e-12
3. B	Q1PEN0	Receptor-like protein 36	4.27e-05	NA	0.004
3. B	F4J7T6	Receptor-like protein 39	3.20e-03	NA	1.09e-04
3. B	Q54Y32	MAP kinase phosphatase with leucine-rich repeats protein 3	5.41e-05	NA	1.24e-08
3. B	Q460M5	Leucine-rich repeat and fibronectin type-III domain-containing protein 2	9.84e-04	NA	0.028
3. B	A2ARI4	Leucine-rich repeat-containing G-protein coupled receptor 4	1.17e-03	NA	6.27e-07
3. B	O49329	Receptor like protein 24	4.81e-03	NA	0.004
3. B	Q6NU09	Volume-regulated anion channel subunit LRRC8E	4.45e-09	NA	1.07e-14
3. B	D0ZRB2	E3 ubiquitin-protein ligase SlrP	3.81e-05	NA	8.12e-05
3. B	F4I2N7	Receptor-like protein kinase 7	1.27e-03	NA	4.55e-05
3. B	Q9C0I9	Leucine-rich repeat-containing protein 27	6.95e-03	NA	6.02e-05
3. B	O48849	Receptor like protein 23	4.01e-03	NA	9.36e-05
3. B	B7XK66	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.45e-03	NA	1.91e-08
3. B	P07359	Platelet glycoprotein Ib alpha chain	2.01e-04	NA	0.002
3. B	P70587	Leucine-rich repeat-containing protein 7	1.85e-04	NA	1.20e-15
3. B	Q94F62	BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1	2.01e-02	NA	5.23e-07
3. B	B4PU77	Leucine-rich repeat protein soc-2 homolog	6.91e-11	NA	2.22e-19
3. B	F4KHA2	Receptor-like protein 54	3.39e-03	NA	0.010
3. B	Q7XA40	Putative disease resistance protein RGA3	1.82e-02	NA	3.87e-04
3. B	Q96LI5	CCR4-NOT transcription complex subunit 6-like	7.81e-03	NA	0.012
3. B	Q4G017	Nischarin	1.10e-02	NA	0.016
3. B	Q7L0X0	TLR4 interactor with leucine rich repeats	3.55e-04	NA	4.34e-06
3. B	Q9EQP5	Prolargin	3.94e-06	NA	0.013
3. B	Q0PV50	Toll-like receptor 3	3.11e-03	NA	1.29e-05
3. B	C0LGF5	LRR receptor-like serine/threonine-protein kinase RGI5	2.39e-03	NA	1.29e-04
3. B	A6H694	Leucine-rich repeat-containing protein 63	5.86e-06	NA	2.39e-04
3. B	O64566	Plant intracellular Ras-group-related LRR protein 6	1.68e-12	NA	2.00e-14
3. B	Q9M9S4	Probable LRR receptor-like serine/threonine-protein kinase At1g14390	4.99e-04	NA	0.002
3. B	P35859	Insulin-like growth factor-binding protein complex acid labile subunit	8.80e-06	NA	9.88e-07
3. B	Q8K3P5	CCR4-NOT transcription complex subunit 6	8.47e-03	NA	3.32e-07
3. B	C0LGD7	Probable LRR receptor-like serine/threonine-protein kinase At1g06840	2.19e-03	NA	4.99e-04
3. B	Q9ERV7	p53-induced death domain-containing protein 1	1.75e-04	NA	4.55e-14
3. B	D4A1J9	Leucine-rich repeat and fibronectin type-III domain-containing protein 5	4.90e-04	NA	0.005
3. B	P50609	Fibromodulin	1.47e-07	NA	5.91e-04
3. B	O94294	Leucine-rich repeat-containing protein sog2	5.47e-03	NA	3.90e-10
3. B	Q5Z9N5	Leucine-rich repeat receptor-like kinase protein FLORAL ORGAN NUMBER1	1.90e-03	NA	2.23e-08
3. B	Q54M77	Probable serine/threonine-protein kinase roco8	6.64e-02	NA	5.80e-06
3. B	F4K6B8	Leucine-rich repeat receptor-like serine/threonine-protein kinase RGI4	6.73e-03	NA	4.15e-08
3. B	Q9Y4C4	Malignant fibrous histiocytoma-amplified sequence 1	3.08e-04	NA	8.98e-16
3. B	Q66JT1	Volume-regulated anion channel subunit LRRC8E	1.99e-09	NA	3.98e-19
3. B	Q9LHP4	LRR receptor-like serine/threonine-protein kinase RGI1	2.46e-03	NA	5.39e-07
3. B	Q14160	Protein scribble homolog	3.11e-04	NA	5.26e-18
3. B	Q2I0M4	Leucine-rich repeat-containing protein 26	8.11e-06	NA	0.001
3. B	C0STK7	Phospholipase A2 inhibitor beta	NA	NA	0.002
3. B	Q80TG9	Leucine-rich repeat and fibronectin type-III domain-containing protein 2	1.10e-03	NA	0.029
3. B	Q6XHA7	Probable serine/threonine-protein kinase roco9	NA	NA	5.63e-15
3. B	P0DO09	Disease resistance protein Piks-1	3.23e-03	NA	2.10e-06
3. B	Q9SVW8	Plant intracellular Ras-group-related LRR protein 4	2.24e-08	NA	2.07e-16
3. B	F7D3V9	Leucine-rich repeat-containing G-protein coupled receptor 5	5.12e-04	NA	8.15e-08
3. B	Q9SUQ3	Probable inactive receptor kinase At4g23740	4.25e-03	NA	0.017
3. B	A6H6A4	Leucine-rich repeat and IQ domain-containing protein 4	1.15e-06	NA	3.50e-13
3. B	Q6NUI6	Chondroadherin-like protein	1.47e-03	NA	2.31e-09
3. B	Q9SVN2	Receptor-like protein 47	9.97e-04	NA	1.08e-04
3. B	P17778	Outer membrane protein YopM	1.23e-07	NA	0.020
3. B	Q5RJR8	Leucine-rich repeat-containing protein 59	1.54e-03	NA	6.87e-05
3. B	Q1EA11	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.29e-02	NA	1.42e-07
3. B	Q9ZWC8	Serine/threonine-protein kinase BRI1-like 1	1.13e-02	NA	1.90e-04
3. B	P49606	Adenylate cyclase	6.98e-02	NA	9.08e-09
3. B	O88280	Slit homolog 3 protein	1.69e-01	NA	4.37e-05
3. B	Q9FFJ3	Plant intracellular Ras-group-related LRR protein 1	1.54e-09	NA	1.92e-11
3. B	Q9M2Z1	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2	4.04e-05	NA	5.18e-06
3. B	Q9WVB4	Slit homolog 3 protein	4.98e-02	NA	3.97e-05
3. B	Q9Z2H4	Leucine-rich repeat-containing G-protein coupled receptor 4	3.84e-03	NA	5.69e-07
3. B	Q6CEJ6	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	9.24e-03	NA	1.99e-09
3. B	P0DM44	Leucine-rich repeat-containing G-protein coupled receptor 6	9.33e-04	NA	1.02e-07
3. B	Q9VUN0	Toll-like receptor 6	2.44e-02	NA	1.06e-06
3. B	A0A0R0HPY5	Leucine-rich repeat receptor-like kinase protein CLV1a	3.00e-03	NA	6.07e-08
3. B	P35858	Insulin-like growth factor-binding protein complex acid labile subunit	1.15e-05	NA	1.27e-06
3. B	Q8BXA0	Leucine-rich repeat and fibronectin type-III domain-containing protein 5	1.59e-03	NA	0.005
3. B	Q5BK65	Transforming growth factor beta activator LRRC33	2.06e-05	NA	0.007
3. B	O65440	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3	6.65e-03	NA	2.63e-05
3. B	Q7XV05	LRR receptor kinase SERK2	2.10e-02	NA	1.88e-04
3. B	Q28888	Decorin	3.19e-11	NA	1.15e-07
3. B	Q69SP5	LRR receptor-like serine/threonine-protein kinase ER1	8.38e-04	NA	8.52e-09
3. B	Q8VYT3	Probable LRR receptor-like serine/threonine-protein kinase At4g30520	1.65e-02	NA	7.68e-07
3. B	Q54T82	Putative leucine-rich repeat-containing protein DDB_G0281931	3.06e-03	NA	1.72e-05
3. B	Q6WRH9	Immunoglobulin superfamily member 10	3.05e-01	NA	4.17e-05
3. B	O46542	Decorin	2.39e-11	NA	2.28e-08
3. B	Q9SHI3	Receptor-like protein 2	5.31e-05	NA	0.012
3. B	F2VYU4	Disease resistance protein Pik-1	8.35e-04	NA	2.03e-06
3. B	P58823	Polygalacturonase inhibitor 3	1.45e-06	NA	0.011
3. B	D0ZVG2	E3 ubiquitin-protein ligase SspH1	7.53e-05	NA	0.001
3. B	A2BHJ4	CCR4-NOT transcription complex subunit 6-like	9.31e-03	NA	1.98e-06
3. B	Q5VQP7	Leucine-rich repeat protein 1	2.03e-04	NA	8.44e-06
3. B	Q9M6A7	Leucine-rich repeat receptor-like kinase protein CLV1B	2.60e-03	NA	2.00e-05
3. B	D0ZPH9	E3 ubiquitin-protein ligase SspH2	1.46e-04	NA	0.017
3. B	Q9FL51	Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940	1.20e-03	NA	9.09e-06
3. B	Q9LK43	Receptor-like kinase TMK4	1.89e-03	NA	0.021
3. B	P82963	Chaoptin (Fragment)	7.33e-04	NA	5.54e-06
3. B	B8BB68	LRR receptor kinase BAK1	1.56e-02	NA	3.26e-04
3. B	F4J8G2	Receptor-like protein 33	9.69e-04	NA	1.51e-05
3. B	Q69JN6	Brassinosteroid LRR receptor kinase BRL1	7.57e-03	NA	5.57e-04
3. B	C0LGK9	Probable LRR receptor-like serine/threonine-protein kinase At2g24230	1.32e-03	NA	5.79e-08
3. B	O94991	SLIT and NTRK-like protein 5	1.21e-02	NA	4.61e-04
3. B	Q9SD62	Putative receptor-like protein kinase At3g47110	1.61e-03	NA	1.01e-07
3. B	Q9FRS6	Leucine-rich repeat receptor-like protein kinase PXL1	2.73e-03	NA	1.51e-06
3. B	P08678	Adenylate cyclase	3.10e-02	NA	9.35e-08
3. B	Q9ZUK7	Receptor-like protein 18	6.37e-04	NA	0.004
3. B	Q6PJG9	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	1.28e-04	NA	0.002
3. B	Q9BTN0	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	7.27e-05	NA	0.018
3. B	P34268	Protein flightless-1 homolog	2.19e-03	NA	2.42e-12
3. B	Q86WK6	Amphoterin-induced protein 1	3.53e-04	NA	0.044
3. B	Q9LHF1	Leucine-rich repeat extensin-like protein 4	1.21e-06	NA	3.73e-04
3. B	P51887	Fibromodulin	1.14e-07	NA	0.004
3. B	P0DO05	Receptor-like protein 9DC1	3.85e-03	NA	0.013
3. B	Q3E991	Pollen receptor-like kinase 6	9.22e-03	NA	1.81e-04
3. B	F1R6I3	Leucine-rich repeat-containing protein 39	1.29e-09	NA	1.04e-15
3. B	Q8W4Q3	Plant intracellular Ras-group-related LRR protein 3	1.21e-12	NA	1.80e-16
3. B	P70389	Insulin-like growth factor-binding protein complex acid labile subunit	1.63e-05	NA	3.67e-07
3. B	Q9SVM3	Receptor-like protein 49	2.63e-03	NA	9.75e-06
3. B	Q42484	Disease resistance protein RPS2	2.03e-03	NA	0.023
3. B	Q70AK3	Leucine-rich repeat transmembrane protein FLRT3	3.20e-04	NA	6.29e-08
3. B	D2HFT7	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	8.05e-05	NA	0.019
3. B	Q9SYQ8	Receptor protein kinase CLAVATA1	4.91e-03	NA	7.43e-10
3. B	Q9M9X0	Receptor-like protein 32	1.87e-03	NA	2.75e-04
3. B	P76123	Leucine-rich repeat domain-containing protein YddK	1.81e-12	NA	0.026
3. B	Q6R5N8	Toll-like receptor 13	4.69e-03	NA	0.015
3. B	C0LGG8	Probable LRR receptor-like serine/threonine-protein kinase At1g53430	3.32e-03	NA	4.04e-04
3. B	Q9SKK2	Receptor like protein 21	1.05e-03	NA	0.001
3. B	O94769	Extracellular matrix protein 2	3.24e-05	NA	4.35e-05
3. B	Q9IB75	Biglycan	1.06e-10	NA	1.48e-11
3. B	Q5XM32	Relaxin receptor 2	1.10e-04	NA	2.86e-05
3. B	Q68F79	Volume-regulated anion channel subunit LRRC8E	4.99e-09	NA	3.85e-16
3. B	B4JTV9	Leucine-rich repeat protein soc-2 homolog	3.03e-11	NA	2.39e-19
3. B	Q6IR85	CCR4-NOT transcription complex subunit 6-like-A	5.79e-03	NA	0.008
3. B	Q8BMT4	Transforming growth factor beta activator LRRC33	8.02e-06	NA	0.008
3. B	C0LGX3	LRR receptor-like serine/threonine-protein kinase HSL2	2.50e-03	NA	8.29e-12
3. B	A8WHP9	Leucine-rich repeat-containing protein 3	7.15e-03	NA	0.003
3. B	Q9JJ28	Protein flightless-1 homolog	1.61e-03	NA	3.36e-07
3. B	V5NAL9	Toll-like receptor 4	1.17e-02	NA	1.28e-05
3. B	Q9FN37	Phytosulfokine receptor 2	2.69e-03	NA	0.049
3. B	B0W6M9	Leucine-rich repeat protein soc-2 homolog	9.72e-11	NA	1.79e-18
3. B	Q2QZF2	Disease resistance protein PIK5-NP	3.73e-03	NA	1.25e-08
3. B	Q810B7	SLIT and NTRK-like protein 5	4.05e-03	NA	3.34e-04
3. B	Q9LRT1	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040	1.21e-03	NA	1.47e-05
3. B	O02833	Insulin-like growth factor-binding protein complex acid labile subunit	1.24e-05	NA	4.43e-06
3. B	O49325	Receptor like protein 28	3.03e-03	NA	7.24e-04
3. B	Q922Q8	Leucine-rich repeat-containing protein 59	1.89e-03	NA	6.99e-05
3. B	P58822	Polygalacturonase inhibitor 2	1.59e-06	NA	0.004
3. B	Q6JN46	Receptor-like protein EIX2	3.19e-03	NA	2.38e-10
3. B	O14498	Immunoglobulin superfamily containing leucine-rich repeat protein	5.22e-04	NA	6.01e-07
3. B	O22476	Protein BRASSINOSTEROID INSENSITIVE 1	7.66e-03	NA	3.40e-06
3. B	Q9Z1S7	Osteomodulin	1.89e-05	NA	1.02e-09
3. B	Q9FPJ5	Leucine-rich repeat protein 1	4.21e-04	NA	1.07e-06
3. B	Q8CBR6	Tsukushi	3.57e-06	NA	0.015
3. B	A4IIK1	Malignant fibrous histiocytoma-amplified sequence 1 homolog	2.19e-04	NA	7.67e-19
3. B	Q9TTE2	Decorin	3.12e-11	NA	5.55e-08
3. B	Q5DU41	Volume-regulated anion channel subunit LRRC8B	4.81e-10	NA	4.95e-14
3. B	Q5PP26	Piriformospora indica-insensitive protein 2	8.67e-11	NA	0.001
3. B	Q9FK63	Calmodulin-binding receptor kinase CaMRLK	8.88e-04	NA	0.016
3. B	O74874	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.68e-02	NA	1.17e-08
3. B	Q94AG2	Somatic embryogenesis receptor kinase 1	9.95e-03	NA	2.89e-06
3. B	C0LGF4	LRR receptor-like serine/threonine-protein kinase FEI 1	5.34e-03	NA	5.22e-04
3. B	Q9BE71	Leucine-rich repeat and fibronectin type-III domain-containing protein 2	1.07e-03	NA	0.014
3. B	Q8SU52	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.79e-03	NA	1.73e-08
3. B	Q9TZM3	Leucine-rich repeat serine/threonine-protein kinase 1	1.01e-01	NA	9.08e-05
3. B	P58681	Toll-like receptor 7	7.10e-03	NA	4.92e-06
3. B	P0CE12	E3 ubiquitin-protein ligase SspH2	1.44e-04	NA	0.017
3. B	Q9V477	Toll-like receptor Tollo	1.16e-02	NA	1.71e-08
3. B	Q6ZVD8	PH domain leucine-rich repeat-containing protein phosphatase 2	6.88e-03	NA	9.21e-06
3. B	Q8C110	SLIT and NTRK-like protein 6	2.22e-03	NA	1.21e-07
3. B	Q7XA39	Putative disease resistance protein RGA4	3.04e-02	NA	8.77e-04
3. B	C0LGU5	Probable LRR receptor-like serine/threonine-protein kinase At5g45780	5.48e-03	NA	0.001
3. B	B4QVR7	Leucine-rich repeat protein soc-2 homolog	9.48e-09	NA	2.74e-19
3. B	Q6P9F7	Volume-regulated anion channel subunit LRRC8B	5.04e-07	NA	4.36e-14
3. B	A8WGA3	Leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein	4.56e-04	NA	5.17e-08
3. B	Q5A761	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.72e-02	NA	1.84e-07
3. B	Q8GUQ5	Brassinosteroid LRR receptor kinase	1.24e-02	NA	1.98e-06
3. B	O94898	Leucine-rich repeats and immunoglobulin-like domains protein 2	4.34e-03	NA	1.53e-05
3. B	Q7F8Q9	Leucine-rich repeat receptor protein kinase MSL1	2.26e-03	NA	1.05e-04
3. B	P24014	Protein slit	4.51e-02	NA	0.003
3. B	Q9LJW7	Receptor-like protein 43	5.34e-04	NA	0.003
3. B	A6NIV6	Leucine-rich repeat and IQ domain-containing protein 4	1.87e-07	NA	6.20e-13
3. B	Q6XHB2	Probable serine/threonine-protein kinase roco4	5.46e-01	NA	0.004
3. B	P62046	Leucine-rich repeat and calponin homology domain-containing protein 1	2.90e-08	NA	3.49e-15
3. B	Q498T9	Volume-regulated anion channel subunit LRRC8C	2.03e-09	NA	1.71e-18
3. B	Q7FZR1	Receptor-like protein 52	1.55e-03	NA	2.06e-08
3. B	Q9LT96	Probable leucine-rich repeat receptor-like protein kinase At5g49770	1.61e-03	NA	5.52e-05
3. B	Q4V8G0	Leucine-rich repeat-containing protein 63	3.06e-07	NA	1.29e-05
3. B	Q9S7I6	LRR receptor-like serine/threonine-protein kinase RPK2	1.37e-02	NA	0.028
3. B	C0LGV1	LRR receptor-like serine/threonine-protein kinase RGI2	4.76e-03	NA	3.01e-11
3. B	Q8C0R9	Leucine-rich repeat and death domain-containing protein 1	1.17e-05	NA	8.00e-15
3. B	A4IFA6	Immunoglobulin superfamily containing leucine-rich repeat protein	5.85e-04	NA	2.38e-07
3. B	Q9CZT5	Vasorin	1.07e-05	NA	4.34e-05
3. B	O77742	Osteomodulin	2.33e-05	NA	1.79e-06
3. B	Q3KRC6	Volume-regulated anion channel subunit LRRC8E	1.52e-09	NA	1.45e-19
3. B	Q8BGI7	Leucine-rich repeat-containing protein 39	4.30e-10	NA	1.39e-15
3. B	Q7XDQ7	Plant intracellular Ras-group-related LRR protein 8	5.28e-12	NA	2.27e-12
3. B	Q06828	Fibromodulin	1.94e-07	NA	0.004
3. B	Q9VZZ4	Peroxidasin	1.99e-01	NA	0.007
3. B	Q921G6	Leucine-rich repeat and calponin homology domain-containing protein 4	3.66e-06	NA	4.60e-19
3. B	Q8WXD0	Relaxin receptor 2	1.74e-04	NA	4.95e-05
3. B	O81765	Pollen-specific leucine-rich repeat extensin-like protein 4	9.95e-05	NA	1.10e-04
3. B	Q0JA29	LRR receptor-like serine/threonine-protein kinase FLS2	6.51e-03	NA	1.84e-08
3. B	Q4V8I7	Volume-regulated anion channel subunit LRRC8A	7.80e-08	NA	4.88e-18
3. B	E7FE13	Leucine-rich repeat-containing G-protein coupled receptor 4	9.71e-04	NA	7.22e-08
3. B	C0LGJ1	Probable LRR receptor-like serine/threonine-protein kinase At1g74360	2.41e-03	NA	3.29e-05
3. B	Q9NYK1	Toll-like receptor 7	2.03e-02	NA	6.32e-05
3. B	Q9LJ64	Pollen-specific leucine-rich repeat extensin-like protein 1	7.33e-04	NA	0.001
3. B	F4J9A8	Receptor-like protein 45	1.96e-03	NA	0.002
3. B	A5PK13	Volume-regulated anion channel subunit LRRC8C	3.19e-10	NA	6.00e-19
3. B	A0N0X6	Leucine-rich repeat neuronal protein 1	8.78e-04	NA	0.021
3. B	C0LGQ5	LRR receptor-like serine/threonine-protein kinase GSO1	1.94e-03	NA	4.29e-09
3. B	F1NUK7	Leucine-rich repeat transmembrane protein FLRT3	1.96e-04	NA	3.38e-08
3. B	Q5U308	Volume-regulated anion channel subunit LRRC8D	2.17e-09	NA	2.33e-17
3. B	Q496Z2	TLR4 interactor with leucine rich repeats	3.91e-04	NA	5.17e-08
3. B	Q5R6T0	Leucine-rich repeat transmembrane protein FLRT3	1.51e-04	NA	8.70e-07
3. B	Q5B778	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	5.65e-02	NA	2.10e-08
3. B	P28675	Decorin	1.57e-11	NA	1.03e-08
3. B	Q8BXA7	PH domain leucine-rich repeat-containing protein phosphatase 2	5.04e-03	NA	9.70e-08
3. B	Q3MHH9	Extracellular matrix protein 2	5.14e-08	NA	8.07e-06
3. B	C0LGG7	Probable LRR receptor-like serine/threonine-protein kinase At1g53420	6.22e-03	NA	0.010
3. B	Q8BLU0	Leucine-rich repeat transmembrane protein FLRT2	2.24e-03	NA	6.32e-09
3. B	A4D1F6	Leucine-rich repeat and death domain-containing protein 1	1.11e-05	NA	5.01e-15
3. B	Q8RY65	Protein NSP-INTERACTING KINASE 2	1.35e-02	NA	5.45e-04
3. B	Q9FP13	LRR receptor kinase SERL2	2.36e-02	NA	0.005
3. B	Q80TR4	Slit homolog 1 protein	5.56e-02	NA	0.001
3. B	P23466	Adenylate cyclase	2.39e-02	NA	2.57e-09
3. B	Q6XHA5	Probable serine/threonine-protein kinase roco11	4.51e-01	NA	0.004
3. B	B1H134	Leucine-rich repeat transmembrane protein FLRT3	1.57e-04	NA	1.90e-08
3. B	Q5F4C4	Leucine-rich repeat protein SHOC-2	3.61e-12	NA	1.53e-18
3. B	O49318	Probable leucine-rich repeat receptor-like protein kinase At2g33170	2.33e-03	NA	4.46e-07
3. B	Q54TM7	Probable serine/threonine-protein kinase drkD	6.11e-03	NA	1.17e-10
3. B	F4JGB6	Receptor-like protein 46	7.52e-05	NA	1.06e-07
3. B	Q9JLF7	Toll-like receptor 5	3.46e-03	NA	4.82e-05
3. B	C0LGS2	Probable LRR receptor-like serine/threonine-protein kinase At4g36180	3.27e-03	NA	1.94e-06
3. B	P21793	Decorin	3.40e-11	NA	5.81e-08
3. B	Q80WG5	Volume-regulated anion channel subunit LRRC8A	2.66e-07	NA	8.01e-19