Summary

Q86XN7

Homolog: Q5PRE5.
Function: Proline and serine-rich protein 1.

Statistics

Total GO Annotation: 249
Unique PROST Go: 249
Unique BLAST Go: 0

Total Homologs: 91
Unique PROST Homologs: 89
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q5PRE5 (Proline and serine-rich protein 1) with a FATCAT P-Value: 0.00141 and RMSD of 12.48 angstrom. The sequence alignment identity is 78.9%.
Structural alignment shown in left. Query protein Q86XN7 colored as red in alignment, homolog Q5PRE5 colored as blue. Query protein Q86XN7 is also shown in right top, homolog Q5PRE5 showed in right bottom. They are colored based on secondary structures. 

  Q86XN7 MDKKSFEMVLDEIRKAVLTEYKLKAIEYVHGYFSSEQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNS 100
  Q5PRE5 MDKKSFETVLDEIRKAVLTEYKLKAIEYVHGYFSSEQVVDLLRYFSWAEPQLKAMKALQHKMVAVHPAEVVSILSCFTFSKDKLAALELLASNIVDAQNS 100

  Q86XN7 RPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAMISSCGTIPGNPYPKGRPSRINGIFPGTPLKKDGEECTNEGKGIAARILGPSKPPPSTYNPHKPVP 200
  Q5PRE5 RPIEDLFRINMSEKKRCKRVLEQASKAGCKAPHAMISSCGTFPGNPYPKGKPSRINGIFPGTPLKKDGEEITNEGKGIAARILGPSKPPPSTYNPHKPVP 200

  Q86XN7 YPIPPCRPHATIAPSAYNNAGLVPLANVIA---PPPPPYTPNPVGTENEDLSNPSKPIQNQTFSTPASQLFSPHG-SNPSTPAATPVPTASPVKAINHPS 296
  Q5PRE5 YPIPPCRPHATIAPSAYNNAGLVPLANVIAPGVPPPPPYTPNPAGTDNEDLSSQSKPTQSQTFSTPASQLFSPHGSSNPSTPAATPVPAVSPAKAVNHPS 300

  Q86XN7 ASAAATVSGMNLLNTVLPVFPGQVSSAVHTPQPSIPNPTVIRTPSLPTAPVTSIHSTTTTPVPSIFSGLVSLPGPSATPTAATPTPGPT-PRSTLGSSEA 395
  Q5PRE5 VSAAATGAGMSATNTALAVFP--------TPQPNTPNPTVIRTPSVPATPVTSTHSTTPTPVPSVFSGLVPLPGLSATPT--LPTQASSISRVTLASSET 390

  Q86XN7 FASTSAPFTSLPFSTSSSAASTSNPNSASLSSVFAGLPLPLPPTSQGLSNPTP-VIAGGSTPSVAGPLGVNSPLLSALKGFLTSNDTNLINSSALSSAVT 494
  Q5PRE5 FASTCAPFSG-HSSASSTAGSASNPITAPLSSVFAGLPLPFPPASHSIATPTPSVIA-----SAAGPHGVNSPLLSALKGFLTSNDTHLINSSALPSAVT 484

  Q86XN7 SGLASLSSLTLQNSDSSASAPNKCYAPSAIPTPQRTSTPGLALFPGLPSPVANSTS-TPLTLPVQSPLATAASASTSVPVSCGSSASLLRGPHPGTSDLH 593
  Q5PRE5 SGLASLSSLPNRNSDSPASATNKCYPPAAVPAAQRSSTPGLAMFPGLQSPVASATSVAP-TLPAQSPLAT---PSTAVPVSCGSSGSLLHGPHAGG---- 576

  Q86XN7 ISSTPAATTLPVMIKTEPTSPTPSAFKGPSHSGNPSHGTLGLSGTLGRAYTSTSVPISLSACLNPALSGLSSLSTPLNGSNPLSSISLPPHGSSTPIAPV 693
  Q5PRE5 ISSAPAAATMPVMIKSEPTSPPPSAFKGPAHPGTPVRGTLGLSGALGRGYPTTSVPISVSTCLNPALSGLSSLSTPLAG-----SMSLPPHASSTPIAPV 671

  Q86XN7 FTALPSFTSLTNNFPLTGNPSLNPSVSLPGSLIATSSTAATSTSLPHPSSTAAVLSGLSASAPVS-AAP--FPLNLSTAVPSLFSVTQGPLSSSNPSYPG 790
  Q5PRE5 FTALPPFTSLTNSFPLPGSPSLNPAVSLAG-----SSTTTTSAAV-HPSS-ATVRSVL----PTSNASPAAFPLNLSTAVPSLFAVTQGPLPTSNPSYPG 760

  Q86XN7 FSVSNTPSVTPALPSFPGLQAPSTVAAVTPLPVAATAPSPAPVLPGFASAFSSNFNSALVAQAGLSSGLQAAGSSVFPGLLSLPGIPGFPQNPSQSSLQE 890
  Q5PRE5 FPVSSAPSGAPTLPSFPGLQAPSTV-AVTPLPVAASAPSPAPVLPGFASAFSSNFNSALVAQAGLSSGLQAAGSSVFPGLLSLPGIPGFSQAPPQSSLQE 859

  Q86XN7 LQHNAAAQSALLQQVHSASALESYPAQPDGFPSYPSAPGTPFSLQPSLSQSGWQ 944
  Q5PRE5 LQHSAAAQSALLQQVHSASALESYPAQADGFPSYPSTPGTPFSLQTGLSQSGWQ 913

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:2001240 negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
2. P GO:0042116 macrophage activation
2. P GO:0050772 positive regulation of axonogenesis
2. P GO:0043970 histone H3-K9 acetylation
2. P GO:0016055 Wnt signaling pathway
2. P GO:0034063 stress granule assembly
2. P GO:0010324 membrane invagination
2. P GO:0010718 positive regulation of epithelial to mesenchymal transition
2. P GO:0050680 negative regulation of epithelial cell proliferation
2. P GO:1905938 positive regulation of germ cell proliferation
2. P GO:0030716 oocyte fate determination
2. P GO:1900063 regulation of peroxisome organization
2. P GO:0050775 positive regulation of dendrite morphogenesis
2. P GO:0000122 negative regulation of transcription by RNA polymerase II
2. P GO:0032968 positive regulation of transcription elongation from RNA polymerase II promoter
2. P GO:0001934 positive regulation of protein phosphorylation
2. P GO:0032793 positive regulation of CREB transcription factor activity
2. P GO:1905516 positive regulation of fertilization
2. P GO:0006900 vesicle budding from membrane
2. P GO:0071517 maintenance of imprinting at mating-type locus
2. P GO:0006511 ubiquitin-dependent protein catabolic process
2. P GO:1900006 positive regulation of dendrite development
2. P GO:0030100 regulation of endocytosis
2. P GO:0006325 chromatin organization
2. P GO:0090090 negative regulation of canonical Wnt signaling pathway
2. P GO:1903243 negative regulation of cardiac muscle hypertrophy in response to stress
2. P GO:1902846 positive regulation of mitotic spindle elongation
2. P GO:0050995 negative regulation of lipid catabolic process
2. P GO:2000298 regulation of Rho-dependent protein serine/threonine kinase activity
2. P GO:1905936 regulation of germ cell proliferation
2. P GO:0040038 polar body extrusion after meiotic divisions
2. P GO:0007409 axonogenesis
2. P GO:0034728 nucleosome organization
2. P GO:0016567 protein ubiquitination
2. P GO:0048268 clathrin coat assembly
2. P GO:1902631 negative regulation of membrane hyperpolarization
2. P GO:0032091 negative regulation of protein binding
2. P GO:2001237 negative regulation of extrinsic apoptotic signaling pathway
2. P GO:0019042 viral latency
2. P GO:0071651 positive regulation of chemokine (C-C motif) ligand 5 production
2. P GO:0048545 response to steroid hormone
2. P GO:0060340 positive regulation of type I interferon-mediated signaling pathway
2. P GO:0051247 positive regulation of protein metabolic process
2. P GO:0051223 regulation of protein transport
2. P GO:0031274 positive regulation of pseudopodium assembly
2. P GO:0018105 peptidyl-serine phosphorylation
2. P GO:0001752 compound eye photoreceptor fate commitment
2. P GO:1900244 positive regulation of synaptic vesicle endocytosis
2. P GO:0005700 polytene chromosome
2. P GO:0019897 extrinsic component of plasma membrane
2. P GO:0033565 ESCRT-0 complex
2. P GO:0031313 extrinsic component of endosome membrane
2. P GO:0008021 synaptic vesicle
2. P GO:0099527 postsynapse to nucleus signaling pathway
2. P GO:0005905 clathrin-coated pit
2. P GO:0051149 positive regulation of muscle cell differentiation
2. P GO:0009794 regulation of mitotic cell cycle, embryonic
2. P GO:0043405 regulation of MAP kinase activity
2. P GO:0071565 nBAF complex
2. P GO:0000149 SNARE binding
2. P GO:0050769 positive regulation of neurogenesis
2. P GO:0071660 positive regulation of IP-10 production
2. P GO:0030099 myeloid cell differentiation
2. P GO:0045785 positive regulation of cell adhesion
2. P GO:0043066 negative regulation of apoptotic process
2. P GO:0035070 salivary gland histolysis
2. P GO:0007163 establishment or maintenance of cell polarity
2. P GO:0007613 memory
2. P GO:0006283 transcription-coupled nucleotide-excision repair
2. P GO:0098978 glutamatergic synapse
2. P GO:0048787 presynaptic active zone membrane
2. P GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
2. P GO:1902176 negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
2. P GO:0007221 positive regulation of transcription of Notch receptor target
2. P GO:0071560 cellular response to transforming growth factor beta stimulus
2. P GO:0030511 positive regulation of transforming growth factor beta receptor signaling pathway
2. P GO:0005524 ATP binding
2. P GO:1904006 negative regulation of phospholipase D activity
2. P GO:0098833 presynaptic endocytic zone
2. P GO:1901409 positive regulation of phosphorylation of RNA polymerase II C-terminal domain
2. P GO:0060903 positive regulation of meiosis I
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:0009504 cell plate
2. P GO:0060761 negative regulation of response to cytokine stimulus
2. P GO:0006405 RNA export from nucleus
2. P GO:1905536 negative regulation of eukaryotic translation initiation factor 4F complex assembly
2. P GO:0000822 inositol hexakisphosphate binding
2. P GO:1902416 positive regulation of mRNA binding
2. P GO:0007588 excretion
2. P GO:0019901 protein kinase binding
2. P GO:0003162 atrioventricular node development
2. P GO:0002092 positive regulation of receptor internalization
2. P GO:0016605 PML body
2. P GO:2000369 regulation of clathrin-dependent endocytosis
2. P GO:0021670 lateral ventricle development
2. P GO:0050700 CARD domain binding
2. P GO:0035091 phosphatidylinositol binding
2. P GO:0043231 intracellular membrane-bounded organelle
2. P GO:0043951 negative regulation of cAMP-mediated signaling
2. P GO:0043025 neuronal cell body
2. P GO:0070375 ERK5 cascade
2. P GO:0045765 regulation of angiogenesis
2. P GO:0048808 male genitalia morphogenesis
2. P GO:0039645 modulation by virus of host G1/S transition checkpoint
2. P GO:1990511 piRNA biosynthetic process
2. P GO:0045296 cadherin binding
2. P GO:2000809 positive regulation of synaptic vesicle clustering
2. P GO:0021523 somatic motor neuron differentiation
2. P GO:0071425 hematopoietic stem cell proliferation
2. P GO:1905833 negative regulation of microtubule nucleation
2. P GO:0035075 response to ecdysone
2. P GO:0048619 embryonic hindgut morphogenesis
2. P GO:0005545 1-phosphatidylinositol binding
2. P GO:0030948 negative regulation of vascular endothelial growth factor receptor signaling pathway
2. P GO:0048666 neuron development
2. P GO:0099150 regulation of postsynaptic specialization assembly
2. P GO:0010470 regulation of gastrulation
2. P GO:0042734 presynaptic membrane
2. P GO:0032050 clathrin heavy chain binding
2. P GO:0004707 MAP kinase activity
2. P GO:0030132 clathrin coat of coated pit
2. P GO:0038024 cargo receptor activity
2. P GO:0035615 clathrin adaptor activity
2. P GO:2000352 negative regulation of endothelial cell apoptotic process
2. P GO:0016032 viral process
2. P GO:0000904 cell morphogenesis involved in differentiation
2. P GO:0045445 myoblast differentiation
2. P GO:1900273 positive regulation of long-term synaptic potentiation
2. P GO:0043274 phospholipase binding
2. P GO:0060766 negative regulation of androgen receptor signaling pathway
2. P GO:0045294 alpha-catenin binding
2. P GO:0042605 peptide antigen binding
2. P GO:0016358 dendrite development
2. P GO:0043153 entrainment of circadian clock by photoperiod
2. P GO:0060760 positive regulation of response to cytokine stimulus
2. P GO:0098688 parallel fiber to Purkinje cell synapse
2. P GO:0030136 clathrin-coated vesicle
2. P GO:1904864 negative regulation of beta-catenin-TCF complex assembly
2. P GO:0045977 positive regulation of mitotic cell cycle, embryonic
2. P GO:0071564 npBAF complex
2. P GO:0043130 ubiquitin binding
2. P GO:0003713 transcription coactivator activity
2. P GO:0098830 presynaptic endosome
2. P GO:0090169 regulation of spindle assembly
2. P GO:0009608 response to symbiont
2. P GO:0048641 regulation of skeletal muscle tissue development
2. P GO:0008022 protein C-terminus binding
2. P GO:0070301 cellular response to hydrogen peroxide
2. P GO:0051661 maintenance of centrosome location
2. P GO:1904780 negative regulation of protein localization to centrosome
2. P GO:0008139 nuclear localization sequence binding
2. P GO:0000280 nuclear division
2. P GO:0006898 receptor-mediated endocytosis
2. P GO:0008140 cAMP response element binding protein binding
2. P GO:0010494 cytoplasmic stress granule
2. P GO:2000196 positive regulation of female gonad development
2. P GO:0050750 low-density lipoprotein particle receptor binding
2. P GO:0060391 positive regulation of SMAD protein signal transduction
2. P GO:0060928 atrioventricular node cell development
2. P GO:0005634 nucleus
2. P GO:0072583 clathrin-dependent endocytosis
2. P GO:0031208 POZ domain binding
2. P GO:0071390 cellular response to ecdysone
2. P GO:1903436 regulation of mitotic cytokinetic process
2. P GO:0098894 extrinsic component of presynaptic endocytic zone membrane
2. P GO:2000096 positive regulation of Wnt signaling pathway, planar cell polarity pathway
2. P GO:0046329 negative regulation of JNK cascade
2. P GO:0030276 clathrin binding
2. P GO:0016604 nuclear body
2. P GO:0017148 negative regulation of translation
2. P GO:0021849 neuroblast division in subventricular zone
2. P GO:0098685 Schaffer collateral - CA1 synapse
2. P GO:0030335 positive regulation of cell migration
2. P GO:0042332 gravitaxis
2. P GO:0071364 cellular response to epidermal growth factor stimulus
2. P GO:0051344 negative regulation of cyclic-nucleotide phosphodiesterase activity
2. P GO:0000723 telomere maintenance
2. P GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
2. P GO:0071363 cellular response to growth factor stimulus
2. P GO:0051019 mitogen-activated protein kinase binding
2. P GO:0001921 positive regulation of receptor recycling
2. P GO:0035186 syncytial blastoderm mitotic cell cycle
2. P GO:0071499 cellular response to laminar fluid shear stress
2. P GO:0016185 synaptic vesicle budding from presynaptic endocytic zone membrane
2. P GO:0010824 regulation of centrosome duplication
2. P GO:0007458 progression of morphogenetic furrow involved in compound eye morphogenesis
2. P GO:0007269 neurotransmitter secretion
2. P GO:0010603 regulation of cytoplasmic mRNA processing body assembly
2. P GO:0070373 negative regulation of ERK1 and ERK2 cascade
2. P GO:1900275 negative regulation of phospholipase C activity
2. P GO:2001046 positive regulation of integrin-mediated signaling pathway
2. P GO:2000860 positive regulation of aldosterone secretion
2. P GO:0051289 protein homotetramerization
2. P GO:0043679 axon terminus
2. P GO:0099149 regulation of postsynaptic neurotransmitter receptor internalization
2. P GO:0031937 obsolete positive regulation of chromatin silencing
2. P GO:0060282 positive regulation of oocyte development
2. P GO:0030178 negative regulation of Wnt signaling pathway
2. P GO:0008190 eukaryotic initiation factor 4E binding
2. P GO:1900242 regulation of synaptic vesicle endocytosis
2. P GO:0070885 negative regulation of calcineurin-NFAT signaling cascade
2. P GO:0097009 energy homeostasis
2. P GO:0030665 clathrin-coated vesicle membrane
2. P GO:0034115 negative regulation of heterotypic cell-cell adhesion
2. P GO:1903438 positive regulation of mitotic cytokinetic process
2. P GO:2000331 regulation of terminal button organization
2. P GO:0007549 dosage compensation
2. P GO:0070097 delta-catenin binding
2. P GO:0010826 negative regulation of centrosome duplication
2. P GO:0016021 integral component of membrane
2. P GO:0046332 SMAD binding
2. P GO:1990521 m7G(5')pppN diphosphatase activator activity
2. P GO:0002193 MAML1-RBP-Jkappa- ICN1 complex
2. P GO:0000781 chromosome, telomeric region
2. P GO:2000095 regulation of Wnt signaling pathway, planar cell polarity pathway
2. P GO:0010862 positive regulation of pathway-restricted SMAD protein phosphorylation
2. P GO:0002735 positive regulation of myeloid dendritic cell cytokine production
2. P GO:0045648 positive regulation of erythrocyte differentiation
2. P GO:1903077 negative regulation of protein localization to plasma membrane
2. P GO:0035026 leading edge cell differentiation
2. P GO:0010642 negative regulation of platelet-derived growth factor receptor signaling pathway
2. P GO:0032349 positive regulation of aldosterone biosynthetic process
2. P GO:2000370 positive regulation of clathrin-dependent endocytosis
2. P GO:0014069 postsynaptic density
2. P GO:0031981 nuclear lumen
2. P GO:2000643 positive regulation of early endosome to late endosome transport
2. P GO:0007257 obsolete activation of JUN kinase activity
2. P GO:0005546 phosphatidylinositol-4,5-bisphosphate binding
2. P GO:0034332 adherens junction organization
2. P GO:0035556 intracellular signal transduction
2. P GO:0010831 positive regulation of myotube differentiation
2. P GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
2. P GO:0048488 synaptic vesicle endocytosis
2. P GO:1905445 positive regulation of clathrin coat assembly
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:0035612 AP-2 adaptor complex binding
2. P GO:0045807 positive regulation of endocytosis
2. P GO:0042169 SH2 domain binding
2. P GO:0016048 detection of temperature stimulus
2. P GO:0007562 eclosion
2. P GO:0000776 kinetochore
2. P GO:0017056 structural constituent of nuclear pore
2. P GO:2000653 regulation of genetic imprinting
2. P GO:0036003 positive regulation of transcription from RNA polymerase II promoter in response to stress
2. P GO:0044204 host cell nuclear matrix
2. P GO:0008013 beta-catenin binding
2. P GO:1904779 regulation of protein localization to centrosome
2. P GO:0005654 nucleoplasm
2. P GO:0098745 Dcp1-Dcp2 complex

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q86XN7 Proline and serine-rich protein 1 0 2.44e-152 0.0
1. PB Q5PRE5 Proline and serine-rich protein 1 1.41e-03 8.17e-83 0.0
2. P P03203 Epstein-Barr nuclear antigen 4 NA 3.72e-03 NA
2. P Q13164 Mitogen-activated protein kinase 7 6.83e-01 1.42e-02 NA
2. P O88797 Disabled homolog 2 2.31e-01 8.39e-03 NA
2. P Q5SW25 POM121-like protein 2 4.95e-02 5.60e-03 NA
2. P A5E406 RNA polymerase II degradation factor 1 1.10e-01 5.64e-04 NA
2. P Q0V8S0 Hepatocyte growth factor-regulated tyrosine kinase substrate 7.73e-01 3.88e-02 NA
2. P Q8JJ48 Dapper 1-A 2.78e-01 1.22e-03 NA
2. P Q157S1 CREB-regulated transcription coactivator 1 4.95e-01 1.97e-02 NA
2. P Q8N9H9 Uncharacterized protein C1orf127 2.16e-01 1.28e-02 NA
2. P O60641 Clathrin coat assembly protein AP180 8.90e-02 4.77e-03 NA
2. P Q6P1W5 Uncharacterized protein C1orf94 4.23e-01 2.27e-02 NA
2. P Q8JIS6 T-box transcription factor TBX6 9.30e-02 1.49e-04 NA
2. P Q3KST0 Epstein-Barr nuclear antigen 6 NA 6.82e-04 NA
2. P Q8IH18 Eukaryotic translation initiation factor 4E transporter 5.42e-01 6.43e-03 NA
2. P Q9WVS8 Mitogen-activated protein kinase 7 7.03e-01 6.37e-03 NA
2. P Q91X84 CREB-regulated transcription coactivator 3 4.11e-01 7.03e-03 NA
2. P Q91VX2 Ubiquitin-associated protein 2 1.90e-01 1.10e-02 NA
2. P Q9QZS3 Protein numb homolog 4.09e-01 1.77e-02 NA
2. P G5ED29 Ataxin-2 homolog 1.50e-01 6.27e-04 NA
2. P Q8BW22 Calcium-responsive transactivator 2.52e-01 4.19e-03 NA
2. P A6ZZR2 RNA polymerase II degradation factor 1 4.07e-01 9.62e-03 NA
2. P Q6GLQ4 Serine/threonine-protein phosphatase 1 regulatory subunit 10 4.48e-01 2.23e-02 NA
2. P Q5AMM4 RNA polymerase II degradation factor 1 7.28e-02 1.39e-02 NA
2. P A4FVR1 GBF-interacting protein 1-like 1.09e-01 2.11e-04 NA
2. P C5M2B8 RNA polymerase II degradation factor 1 7.96e-02 7.10e-03 NA
2. P Q03825 Transcription activator MSS11 1.46e-01 3.31e-02 NA
2. P P36041 Protein EAP1 7.71e-01 6.18e-03 NA
2. P O75177 Calcium-responsive transactivator 3.39e-01 1.45e-02 NA
2. P O74417 Uncharacterized protein C14G10.04 6.19e-01 2.15e-03 NA
2. P Q6FXZ4 Mediator of RNA polymerase II transcription subunit 3 4.75e-01 2.82e-02 NA
2. P P03204 Epstein-Barr nuclear antigen 6 NA 3.01e-02 NA
2. P Q68ED7 CREB-regulated transcription coactivator 1 7.11e-01 2.59e-02 NA
2. P O94358 Uncharacterized protein C428.10 9.56e-02 7.31e-03 NA
2. P Q53ET0 CREB-regulated transcription coactivator 2 3.59e-01 4.28e-03 NA
2. P Q13495 Mastermind-like domain-containing protein 1 2.32e-01 8.55e-03 NA
2. P Q6R7D0 Putative apoptosis inhibitor ORF99 NA 2.08e-02 NA
2. P Q1HVG4 Epstein-Barr nuclear antigen 4 NA 1.28e-02 NA
2. P Q6BRB3 RNA polymerase II degradation factor 1 3.40e-01 4.86e-02 NA
2. P C7GP20 RNA polymerase II degradation factor 1 8.18e-01 1.38e-03 NA
2. P C5DGU9 RNA polymerase II degradation factor 1 6.91e-02 1.98e-08 NA
2. P Q92585 Mastermind-like protein 1 4.50e-01 2.96e-05 NA
2. P Q24206 Broad-complex core protein isoform 6 8.24e-02 2.13e-03 NA
2. P Q05140 Clathrin coat assembly protein AP180 4.84e-02 1.60e-03 NA
2. P Q9W345 Palmitoyltransferase ZDHHC8 NA 7.83e-03 NA
2. P Q75DE9 RNA polymerase II degradation factor 1 3.72e-01 2.07e-03 NA
2. P Q20898 Translational repressor ifet-1 8.38e-01 8.04e-05 NA
2. P A0A096MK47 Muscular LMNA-interacting protein 2.55e-01 4.11e-03 NA
2. P Q96KW2 POM121-like protein 2 1.45e-01 7.10e-03 NA
2. P O43024 CUE domain-containing protein C354.10 3.77e-02 1.83e-04 NA
2. P Q9NYF0 Dapper homolog 1 1.61e-01 2.00e-02 NA
2. P Q66KC9 Dapper 1 6.16e-02 2.92e-03 NA
2. P Q6QZN6 Dapper homolog 1 2.32e-01 2.36e-02 NA
2. P Q6FTZ3 Transcription activator MSS11 1.04e-01 2.67e-05 NA
2. P P35732 RNA polymerase II degradation factor 1 8.53e-01 1.96e-03 NA
2. P P49757 Protein numb homolog 3.81e-01 2.69e-02 NA
2. P Q8IYB5 Stromal membrane-associated protein 1 5.29e-01 8.39e-03 NA
2. P Q08605 Transcription factor GAGA 7.26e-01 1.11e-02 NA
2. P C5E4K0 RNA polymerase II degradation factor 1 3.09e-01 1.21e-05 NA
2. P P0C865 Mitogen-activated protein kinase 7 4.94e-01 1.02e-02 NA
2. P Q7Z434 Mitochondrial antiviral-signaling protein 7.81e-02 3.57e-02 NA
2. P P98078 Disabled homolog 2 1.65e-01 8.72e-03 NA
2. P Q08E31 Calcium-responsive transactivator 3.18e-01 3.91e-03 NA
2. P Q5UQU8 Uncharacterized protein L357 NA 4.37e-08 NA
2. P Q61548 Clathrin coat assembly protein AP180 3.75e-02 3.95e-03 NA
2. P Q91VZ6 Stromal membrane-associated protein 1 2.25e-01 2.15e-04 NA
2. P A6ZMM3 Transcription activator MSS11 4.12e-01 5.07e-03 NA
2. P A5PKJ4 Mitogen-activated protein kinase 7 6.25e-01 2.06e-02 NA
2. P Q8WYQ9 Zinc finger CCHC domain-containing protein 14 2.02e-01 1.20e-03 NA
2. P G5EGU9 Suppressor of zyg-1 protein 20 3.35e-01 1.92e-05 NA
2. P Q10108 Uncharacterized protein C18G6.09c 8.83e-01 7.11e-04 NA
2. P Q91W92 Cdc42 effector protein 1 6.56e-01 1.07e-02 NA
2. P Q8QG92 Dapper 1-B 1.66e-01 1.14e-03 NA
2. P Q6CTH5 RNA polymerase II degradation factor 1 2.76e-01 2.93e-05 NA
2. P Q5T6F2 Ubiquitin-associated protein 2 1.73e-01 2.77e-02 NA
2. P Q6DDK1 Calcium-responsive transactivator 1.77e-01 2.07e-03 NA
2. P Q8R2V3 Zinc finger protein 445 6.58e-01 2.14e-02 NA
2. P Q6FIN4 RNA polymerase II degradation factor 1 4.35e-01 2.31e-03 NA
2. P P98082 Disabled homolog 2 1.50e-01 4.82e-03 NA
2. P P34758 Protein SCD5 1.08e-01 1.40e-03 NA
2. P Q6T264 Mastermind-like protein 1 3.82e-01 8.46e-06 NA
2. P Q5HYC2 Uncharacterized protein KIAA2026 5.88e-01 2.99e-02 NA
2. P Q14157 Ubiquitin-associated protein 2-like 1.87e-01 1.49e-02 NA
2. P Q54B97 Putative mediator of RNA polymerase II transcription subunit 8 3.44e-01 1.52e-07 NA
2. P Q6UUV7 CREB-regulated transcription coactivator 3 5.97e-01 3.61e-03 NA
2. P A2AFE9 Proline-rich protein 32 5.25e-01 1.88e-03 NA
2. P Q62280 Protein SSXT 3.34e-01 2.31e-02 NA
2. P B2RXH4 BTB/POZ domain-containing protein 18 1.12e-01 4.68e-02 NA
2. P A5D8V6 Vacuolar protein sorting-associated protein 37C 5.97e-01 2.77e-02 NA
2. P Q67YI9 Clathrin interactor EPSIN 2 6.83e-02 8.40e-05 NA