Results | PROST

Summary

Q8IV35

Homolog: A8XZJ9.
Function: Lissencephaly-1 homolog.

Statistics

Total GO Annotation: 655
Unique PROST Go: 194
Unique BLAST Go: 375

Total Homologs: 732
Unique PROST Homologs: 204
Unique BLAST Homologs: 470

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was A8XZJ9 (Lissencephaly-1 homolog) with a FATCAT P-Value: 3.47e-13 and RMSD of 2.24 angstrom. The sequence alignment identity is 16.1%.
Structural alignment shown in left. Query protein Q8IV35 colored as red in alignment, homolog A8XZJ9 colored as blue. Query protein Q8IV35 is also shown in right top, homolog A8XZJ9 showed in right bottom. They are colored based on secondary structures.

  Q8IV35 MAWREKSKKRLNMTSFNIAQGIHAFDYHSRLN-LIATAGIN-NKVCLWNPYVVSKPV-GVL---WGHSASVIAVQFFVERKQLFSFSKD---KVL-RLWD 90
  A8XZJ9 MSLSERQREEINRA---VAEYLQNNGYSEAFNMLLKEASLSENDI---------KPLGGILEKKW---TTVLRLQ----RK-V----NDLEAKLLESQQE 76

  Q8IV35 IQHQLSIQRIACSFPKSQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLYNSILKQVISS---DTGSTVSFWMIDTGQKIKQFT 187
  A8XZJ9 INH---------GAP-TRDKRQ--AAD------WIP----------RPPETQKLIGHRLPVTRVIFHP-LWTIMASCSED--ATIKVWDYETGQLEKTLK 145

  Q8IV35 GCHGNAEISTMALDANETRLLTGSTDGTVKIWDFNG--Y-C------H-HT------LNVGQDGAVDISQILILKKKILVTGWERAITVFRPQNFNQFFI 271
  A8XZJ9 G-HTDA-VNDIAIDAAGKQLVSCSTDLTIKLWDF-GQSYDCLKSLKGHEHTVSSVTFLPTG-DFVLSASRDHTIKQWDISTGY--CVFTFRGHN------ 233

  Q8IV35 QPEEWKGGIQ-HHDDILCAAFLPPQTL-VTGSYDGEIVLWNNSTENAHHVLHPDYQR-----LLKSKLD-TKPQKLLSAGRSQPSHPMA----DHSTTGV 359
  A8XZJ9 ---DWVRMIRISHDG----------TLFASGSLDQTVSVWS---------L-PRKQRNWYFEIMSMRWSVSKPE-----GNS--THILFSGSRDRS---I 300

  Q8IV35 RNFEIDTEGKNAVMRLCF-LKARKNTAVTG------GANLVSCGGSGYVRFWDIYKKQLLAEFLAHSG-VGSIIMSTDKMNRYLTTGDLDGWLKIWNIEE 451
  A8XZJ9 KAWNIST-G-----EVIFTLSAHENW-VRGLAFHPKGKYLVSVADDKMMRIWELSAQRCMKAIEAHEHFVSTVAF--HQTNPYVITGSVDMSCKVW--E- 388

  Q8IV35 YCLNSSKNKITKAPTLIRSFQPHEDRISSLEMCEPGGQLLIISSSADCSICVTGVCNAPVWIFGQAKHWHIENCLFLPKRDTNLVESEIQKEISLFSKEE 551
  A8XZJ9 -CR------------------------------------------------------------------------------------------------- 390

  Q8IV35 SCLDPTEHSLLNKKNKDDSTYNVRPSEDINLDIKYKERSTCMKETQKPYYGEVIKKSFSTFRSLNIGALEELPEVNKPAFLLDPEKYFRKEPEEERPQIL 651
  A8XZJ9 ---------------------------------------------------------------------------------------------------- 390

  Q8IV35 EAPSLFKTLKAVFDEKNLFPKEILHHERKAKQLCQEKSCEVKKNKK 697
  A8XZJ9 ---------------------------------------------- 390

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0005770	late endosome
1. PB	GO:0043614	multi-eIF complex
1. PB	GO:0005080	protein kinase C binding
1. PB	GO:0048705	skeletal system morphogenesis
1. PB	GO:1905861	intranuclear rod assembly
1. PB	GO:0048568	embryonic organ development
1. PB	GO:0048872	homeostasis of number of cells
1. PB	GO:0016567	protein ubiquitination
1. PB	GO:0044666	MLL3/4 complex
1. PB	GO:0030687	preribosome, large subunit precursor
1. PB	GO:0009991	response to extracellular stimulus
1. PB	GO:0006974	cellular response to DNA damage stimulus
1. PB	GO:0007338	single fertilization
1. PB	GO:2000234	positive regulation of rRNA processing
1. PB	GO:0032781	positive regulation of ATP-dependent activity
1. PB	GO:0009553	embryo sac development
1. PB	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
1. PB	GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
1. PB	GO:0006891	intra-Golgi vesicle-mediated transport
1. PB	GO:1902525	regulation of protein monoubiquitination
1. PB	GO:0005737	cytoplasm
1. PB	GO:0001895	retina homeostasis
1. PB	GO:0007281	germ cell development
1. PB	GO:0071540	eukaryotic translation initiation factor 3 complex, eIF3e
1. PB	GO:0032040	small-subunit processome
1. PB	GO:0016579	protein deubiquitination
1. PB	GO:0031023	microtubule organizing center organization
1. PB	GO:0034511	U3 snoRNA binding
1. PB	GO:0030036	actin cytoskeleton organization
1. PB	GO:0007283	spermatogenesis
1. PB	GO:0000922	spindle pole
1. PB	GO:0001650	fibrillar center
1. PB	GO:2000114	regulation of establishment of cell polarity
1. PB	GO:0031252	cell leading edge
1. PB	GO:1905168	positive regulation of double-strand break repair via homologous recombination
1. PB	GO:0005886	plasma membrane
1. PB	GO:0072520	seminiferous tubule development
1. PB	GO:0030030	cell projection organization
1. PB	GO:1901998	toxin transport
1. PB	GO:0045159	myosin II binding
1. PB	GO:0030864	cortical actin cytoskeleton
1. PB	GO:0002183	cytoplasmic translational initiation
1. PB	GO:0048188	Set1C/COMPASS complex
1. PB	GO:0005730	nucleolus
1. PB	GO:0035097	histone methyltransferase complex
1. PB	GO:0044665	MLL1/2 complex
1. PB	GO:0030126	COPI vesicle coat
1. PB	GO:0006886	intracellular protein transport
1. PB	GO:0071541	eukaryotic translation initiation factor 3 complex, eIF3m
1. PB	GO:0043130	ubiquitin binding
1. PB	GO:0030331	estrogen receptor binding
1. PB	GO:0048511	rhythmic process
1. PB	GO:0051568	histone H3-K4 methylation
1. PB	GO:1903003	positive regulation of protein deubiquitination
1. PB	GO:0000209	protein polyubiquitination
1. PB	GO:0050679	positive regulation of epithelial cell proliferation
1. PB	GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
1. PB	GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
1. PB	GO:0005634	nucleus
1. PB	GO:0007099	centriole replication
1. PB	GO:0036064	ciliary basal body
1. PB	GO:0030686	90S preribosome
1. PB	GO:0080008	Cul4-RING E3 ubiquitin ligase complex
1. PB	GO:0005930	axoneme
1. PB	GO:0030515	snoRNA binding
1. PB	GO:0001891	phagocytic cup
1. PB	GO:0080135	regulation of cellular response to stress
1. PB	GO:0051015	actin filament binding
1. PB	GO:0034388	Pwp2p-containing subcomplex of 90S preribosome
1. PB	GO:0030042	actin filament depolymerization
1. PB	GO:0071339	MLL1 complex
1. PB	GO:0005814	centriole
1. PB	GO:0045943	positive regulation of transcription by RNA polymerase I
1. PB	GO:0016021	integral component of membrane
1. PB	GO:0060271	cilium assembly
1. PB	GO:0031514	motile cilium
1. PB	GO:0030663	COPI-coated vesicle membrane
1. PB	GO:0005813	centrosome
1. PB	GO:0005829	cytosol
1. PB	GO:0051726	regulation of cell cycle
1. PB	GO:0030117	membrane coat
1. PB	GO:0000776	kinetochore
1. PB	GO:0005938	cell cortex
1. PB	GO:0043588	skin development
1. PB	GO:0002188	translation reinitiation
1. PB	GO:0005654	nucleoplasm
2. P	GO:0036120	cellular response to platelet-derived growth factor stimulus
2. P	GO:0010449	root meristem growth
2. P	GO:0043029	T cell homeostasis
2. P	GO:1990147	talin binding
2. P	GO:0035266	meristem growth
2. P	GO:0048873	homeostasis of number of cells within a tissue
2. P	GO:0051028	mRNA transport
2. P	GO:0051260	protein homooligomerization
2. P	GO:0007080	mitotic metaphase plate congression
2. P	GO:0030174	regulation of DNA-dependent DNA replication initiation
2. P	GO:0031465	Cul4B-RING E3 ubiquitin ligase complex
2. P	GO:0045111	intermediate filament cytoskeleton
2. P	GO:0005643	nuclear pore
2. P	GO:0006267	pre-replicative complex assembly involved in nuclear cell cycle DNA replication
2. P	GO:0008283	cell population proliferation
2. P	GO:0035327
2. P	GO:0006511	ubiquitin-dependent protein catabolic process
2. P	GO:1902463	protein localization to cell leading edge
2. P	GO:0000056	ribosomal small subunit export from nucleus
2. P	GO:0035148	tube formation
2. P	GO:0071353	cellular response to interleukin-4
2. P	GO:0140285	endosome fission
2. P	GO:0006406	mRNA export from nucleus
2. P	GO:0003093	regulation of glomerular filtration
2. P	GO:0005732	sno(s)RNA-containing ribonucleoprotein complex
2. P	GO:0033186	CAF-1 complex
2. P	GO:0010698	acetyltransferase activator activity
2. P	GO:0030010	establishment of cell polarity
2. P	GO:0003690	double-stranded DNA binding
2. P	GO:0001825	blastocyst formation
2. P	GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P	GO:0005656	nuclear pre-replicative complex
2. P	GO:0032796	uropod organization
2. P	GO:0032587	ruffle membrane
2. P	GO:0061502	early endosome to recycling endosome transport
2. P	GO:1903775	regulation of DNA double-strand break processing
2. P	GO:0010812	negative regulation of cell-substrate adhesion
2. P	GO:0005911	cell-cell junction
2. P	GO:1903673	mitotic cleavage furrow formation
2. P	GO:0071672	negative regulation of smooth muscle cell chemotaxis
2. P	GO:0010969	regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion
2. P	GO:1900027	regulation of ruffle assembly
2. P	GO:0016070	RNA metabolic process
2. P	GO:0009855	determination of bilateral symmetry
2. P	GO:0003431	growth plate cartilage chondrocyte development
2. P	GO:0120293	dynein axonemal particle
2. P	GO:0001673	male germ cell nucleus
2. P	GO:0048487	beta-tubulin binding
2. P	GO:0032956	regulation of actin cytoskeleton organization
2. P	GO:0000176	nuclear exosome (RNase complex)
2. P	GO:0051893	regulation of focal adhesion assembly
2. P	GO:0001674	female germ cell nucleus
2. P	GO:0035264	multicellular organism growth
2. P	GO:0099504	synaptic vesicle cycle
2. P	GO:0006513	protein monoubiquitination
2. P	GO:0090630	activation of GTPase activity
2. P	GO:0030490	maturation of SSU-rRNA
2. P	GO:0045184	establishment of protein localization
2. P	GO:0034455	t-UTP complex
2. P	GO:0005884	actin filament
2. P	GO:0003697	single-stranded DNA binding
2. P	GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation
2. P	GO:0042594	response to starvation
2. P	GO:0051315	attachment of mitotic spindle microtubules to kinetochore
2. P	GO:0035859	Seh1-associated complex
2. P	GO:0050708	regulation of protein secretion
2. P	GO:0098888	extrinsic component of presynaptic membrane
2. P	GO:0030595	leukocyte chemotaxis
2. P	GO:0003341	cilium movement
2. P	GO:0043320	natural killer cell degranulation
2. P	GO:0006335	DNA replication-dependent chromatin assembly
2. P	GO:0034464	BBSome
2. P	GO:0035035	histone acetyltransferase binding
2. P	GO:0090148	membrane fission
2. P	GO:0043527	tRNA methyltransferase complex
2. P	GO:0071944	cell periphery
2. P	GO:0017053	transcription repressor complex
2. P	GO:0061700	GATOR2 complex
2. P	GO:0005198	structural molecule activity
2. P	GO:0019985	translesion synthesis
2. P	GO:2000251	positive regulation of actin cytoskeleton reorganization
2. P	GO:0000407	phagophore assembly site
2. P	GO:0015031	protein transport
2. P	GO:1904263	positive regulation of TORC1 signaling
2. P	GO:0061802	anterior cell cortex
2. P	GO:0005694	chromosome
2. P	GO:0030488	tRNA methylation
2. P	GO:0005856	cytoskeleton
2. P	GO:0043524	negative regulation of neuron apoptotic process
2. P	GO:0031339	negative regulation of vesicle fusion
2. P	GO:0007095	mitotic G2 DNA damage checkpoint signaling
2. P	GO:0006999	nuclear pore organization
2. P	GO:0034315	regulation of Arp2/3 complex-mediated actin nucleation
2. P	GO:0051895	negative regulation of focal adhesion assembly
2. P	GO:0048477	oogenesis
2. P	GO:2000393	negative regulation of lamellipodium morphogenesis
2. P	GO:0051497	negative regulation of stress fiber assembly
2. P	GO:0031080	nuclear pore outer ring
2. P	GO:0071391	cellular response to estrogen stimulus
2. P	GO:0048041	focal adhesion assembly
2. P	GO:0007015	actin filament organization
2. P	GO:0005096	GTPase activator activity
2. P	GO:0032426	stereocilium tip
2. P	GO:0050918	positive chemotaxis
2. P	GO:0061803	posterior cell cortex
2. P	GO:0050870	positive regulation of T cell activation
2. P	GO:0016477	cell migration
2. P	GO:0015629	actin cytoskeleton
2. P	GO:0031201	SNARE complex
2. P	GO:0010632	regulation of epithelial cell migration
2. P	GO:0030670	phagocytic vesicle membrane
2. P	GO:0043521	regulation of myosin II filament disassembly
2. P	GO:0031529	ruffle organization
2. P	GO:0090696	post-embryonic plant organ development
2. P	GO:0005764	lysosome
2. P	GO:0090316	positive regulation of intracellular protein transport
2. P	GO:0008022	protein C-terminus binding
2. P	GO:0032036	myosin heavy chain binding
2. P	GO:0031589	cell-substrate adhesion
2. P	GO:0010762	regulation of fibroblast migration
2. P	GO:0090326	positive regulation of locomotion involved in locomotory behavior
2. P	GO:0030027	lamellipodium
2. P	GO:0016197	endosomal transport
2. P	GO:0042273	ribosomal large subunit biogenesis
2. P	GO:1900024	regulation of substrate adhesion-dependent cell spreading
2. P	GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P	GO:0009968	negative regulation of signal transduction
2. P	GO:0051126	negative regulation of actin nucleation
2. P	GO:0001755	neural crest cell migration
2. P	GO:0006887	exocytosis
2. P	GO:1902184	negative regulation of shoot apical meristem development
2. P	GO:0000055	ribosomal large subunit export from nucleus
2. P	GO:2001173	regulation of histone H2B conserved C-terminal lysine ubiquitination
2. P	GO:0008092	cytoskeletal protein binding
2. P	GO:1900025	negative regulation of substrate adhesion-dependent cell spreading
2. P	GO:0006895	Golgi to endosome transport
2. P	GO:0016600	flotillin complex
2. P	GO:1904643	response to curcumin
2. P	GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway
2. P	GO:0016922	nuclear receptor binding
2. P	GO:0006893	Golgi to plasma membrane transport
2. P	GO:0070528	protein kinase C signaling
2. P	GO:0001772	immunological synapse
2. P	GO:0035767	endothelial cell chemotaxis
2. P	GO:0010971	positive regulation of G2/M transition of mitotic cell cycle
2. P	GO:0031464	Cul4A-RING E3 ubiquitin ligase complex
2. P	GO:0043548	phosphatidylinositol 3-kinase binding
2. P	GO:0005765	lysosomal membrane
2. P	GO:0000920	septum digestion after cytokinesis
2. P	GO:0006909	phagocytosis
2. P	GO:0048203	vesicle targeting, trans-Golgi to endosome
2. P	GO:0051491	positive regulation of filopodium assembly
2. P	GO:2000394	positive regulation of lamellipodium morphogenesis
2. P	GO:1903929	primary palate development
2. P	GO:0017157	regulation of exocytosis
2. P	GO:0106143	tRNA (m7G46) methyltransferase complex
2. P	GO:0097750	endosome membrane tubulation
2. P	GO:0042102	positive regulation of T cell proliferation
2. P	GO:0000724	double-strand break repair via homologous recombination
2. P	GO:0030833	regulation of actin filament polymerization
2. P	GO:0036265	RNA (guanine-N7)-methylation
2. P	GO:0009411	response to UV
2. P	GO:0038180	nerve growth factor signaling pathway
2. P	GO:0106004	tRNA (guanine-N7)-methylation
2. P	GO:0006816	calcium ion transport
2. P	GO:0080186	developmental vegetative growth
2. P	GO:0001725	stress fiber
2. P	GO:0010825	positive regulation of centrosome duplication
2. P	GO:0034629
2. P	GO:0051017	actin filament bundle assembly
2. P	GO:1904951	positive regulation of establishment of protein localization
2. P	GO:0000028	ribosomal small subunit assembly
2. P	GO:0010633	negative regulation of epithelial cell migration
2. P	GO:0034260	negative regulation of GTPase activity
2. P	GO:0006364	rRNA processing
2. P	GO:0003779	actin binding
2. P	GO:0044387	negative regulation of protein kinase activity by regulation of protein phosphorylation
2. P	GO:0097344	Rix1 complex
2. P	GO:0001845	phagolysosome assembly
2. P	GO:0071933	Arp2/3 complex binding
2. P	GO:0034198	cellular response to amino acid starvation
2. P	GO:0000139	Golgi membrane
2. P	GO:0042060	wound healing
2. P	GO:0017166	vinculin binding
2. P	GO:0019905	syntaxin binding
2. P	GO:0017056	structural constituent of nuclear pore
2. P	GO:0090135	actin filament branching
2. P	GO:1904950	negative regulation of establishment of protein localization
2. P	GO:0008064	regulation of actin polymerization or depolymerization
2. P	GO:0007506	gonadal mesoderm development
2. P	GO:1901796	regulation of signal transduction by p53 class mediator
2. P	GO:0051279	regulation of release of sequestered calcium ion into cytosol
2. P	GO:0098674	extrinsic component of neuronal dense core vesicle membrane
2. P	GO:0003785	actin monomer binding
3. B	GO:0021540	corpus callosum morphogenesis
3. B	GO:0031932	TORC2 complex
3. B	GO:1902510	regulation of apoptotic DNA fragmentation
3. B	GO:0048364	root development
3. B	GO:0090141	positive regulation of mitochondrial fission
3. B	GO:0019226	transmission of nerve impulse
3. B	GO:0005874	microtubule
3. B	GO:0045862	positive regulation of proteolysis
3. B	GO:1902610	response to N-phenylthiourea
3. B	GO:0047496	vesicle transport along microtubule
3. B	GO:1901800	positive regulation of proteasomal protein catabolic process
3. B	GO:2000543	positive regulation of gastrulation
3. B	GO:0003743	translation initiation factor activity
3. B	GO:0051013	microtubule severing
3. B	GO:0031965	nuclear membrane
3. B	GO:0046843	dorsal appendage formation
3. B	GO:0046469	platelet activating factor metabolic process
3. B	GO:0060307	regulation of ventricular cardiac muscle cell membrane repolarization
3. B	GO:0030426	growth cone
3. B	GO:0044877	protein-containing complex binding
3. B	GO:0005576	extracellular region
3. B	GO:0019903	protein phosphatase binding
3. B	GO:0051343	positive regulation of cyclic-nucleotide phosphodiesterase activity
3. B	GO:0008017	microtubule binding
3. B	GO:0008344	adult locomotory behavior
3. B	GO:0016319	mushroom body development
3. B	GO:1903467	negative regulation of mitotic DNA replication initiation
3. B	GO:0007405	neuroblast proliferation
3. B	GO:1990757	ubiquitin ligase activator activity
3. B	GO:0032420	stereocilium
3. B	GO:0043022	ribosome binding
3. B	GO:0070016	armadillo repeat domain binding
3. B	GO:0045773	positive regulation of axon extension
3. B	GO:0050885	neuromuscular process controlling balance
3. B	GO:0045722	positive regulation of gluconeogenesis
3. B	GO:1904668	positive regulation of ubiquitin protein ligase activity
3. B	GO:0005869	dynactin complex
3. B	GO:0043224	nuclear SCF ubiquitin ligase complex
3. B	GO:0051301	cell division
3. B	GO:0008247	1-alkyl-2-acetylglycerophosphocholine esterase complex
3. B	GO:0005524	ATP binding
3. B	GO:0007303	cytoplasmic transport, nurse cell to oocyte
3. B	GO:0060256	regulation of flocculation
3. B	GO:0030587	sorocarp development
3. B	GO:0007634	optokinetic behavior
3. B	GO:0016282	eukaryotic 43S preinitiation complex
3. B	GO:0003735	structural constituent of ribosome
3. B	GO:0019005	SCF ubiquitin ligase complex
3. B	GO:0043025	neuronal cell body
3. B	GO:1990889	H4K20me3 modified histone binding
3. B	GO:0061883	clathrin-dependent endocytosis involved in vitellogenesis
3. B	GO:0070840	dynein complex binding
3. B	GO:0071005	U2-type precatalytic spliceosome
3. B	GO:0045879	negative regulation of smoothened signaling pathway
3. B	GO:0005826	actomyosin contractile ring
3. B	GO:0031931	TORC1 complex
3. B	GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
3. B	GO:0051649	establishment of localization in cell
3. B	GO:0040011	locomotion
3. B	GO:0090594	inflammatory response to wounding
3. B	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
3. B	GO:0090181	regulation of cholesterol metabolic process
3. B	GO:0051571	positive regulation of histone H3-K4 methylation
3. B	GO:0005671	obsolete Ada2/Gcn5/Ada3 transcription activator complex
3. B	GO:0033598	mammary gland epithelial cell proliferation
3. B	GO:0030836	positive regulation of actin filament depolymerization
3. B	GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process
3. B	GO:0006412	translation
3. B	GO:0050765	negative regulation of phagocytosis
3. B	GO:0043547	positive regulation of GTPase activity
3. B	GO:0042753	positive regulation of circadian rhythm
3. B	GO:2000280	regulation of root development
3. B	GO:0001198	negative regulation of mating-type specific transcription from RNA polymerase II promoter
3. B	GO:0006367	transcription initiation from RNA polymerase II promoter
3. B	GO:0008298	intracellular mRNA localization
3. B	GO:0061003	positive regulation of dendritic spine morphogenesis
3. B	GO:0016358	dendrite development
3. B	GO:0017145	stem cell division
3. B	GO:0051130	positive regulation of cellular component organization
3. B	GO:0005819	spindle
3. B	GO:0036158	outer dynein arm assembly
3. B	GO:0001667	ameboidal-type cell migration
3. B	GO:0010154	fruit development
3. B	GO:0048814	regulation of dendrite morphogenesis
3. B	GO:0051383	kinetochore organization
3. B	GO:0043291	RAVE complex
3. B	GO:0048142	germarium-derived cystoblast division
3. B	GO:0005078	MAP-kinase scaffold activity
3. B	GO:0071215	cellular response to abscisic acid stimulus
3. B	GO:0019827	stem cell population maintenance
3. B	GO:0051661	maintenance of centrosome location
3. B	GO:0031037	myosin II filament disassembly
3. B	GO:0005834	heterotrimeric G-protein complex
3. B	GO:0072432	response to G1 DNA damage checkpoint signaling
3. B	GO:0030425	dendrite
3. B	GO:0030496	midbody
3. B	GO:0036170	filamentous growth of a population of unicellular organisms in response to starvation
3. B	GO:0000375	RNA splicing, via transesterification reactions
3. B	GO:0003720	telomerase activity
3. B	GO:0000123	histone acetyltransferase complex
3. B	GO:2000217	regulation of invasive growth in response to glucose limitation
3. B	GO:0030473	nuclear migration along microtubule
3. B	GO:0048527	lateral root development
3. B	GO:0031682	G-protein gamma-subunit binding
3. B	GO:0010629	negative regulation of gene expression
3. B	GO:0010119	regulation of stomatal movement
3. B	GO:0048383	mesectoderm development
3. B	GO:0010868	negative regulation of triglyceride biosynthetic process
3. B	GO:0042052	rhabdomere development
3. B	GO:0071011	precatalytic spliceosome
3. B	GO:0043143	regulation of translation by machinery localization
3. B	GO:0007010	cytoskeleton organization
3. B	GO:0051660	establishment of centrosome localization
3. B	GO:1903026	negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding
3. B	GO:0031592	centrosomal corona
3. B	GO:0035064	methylated histone binding
3. B	GO:0045014	carbon catabolite repression of transcription by glucose
3. B	GO:0030335	positive regulation of cell migration
3. B	GO:0005681	spliceosomal complex
3. B	GO:0034504	protein localization to nucleus
3. B	GO:0044114	development of symbiont in host
3. B	GO:1905301	regulation of macropinocytosis
3. B	GO:0000381	regulation of alternative mRNA splicing, via spliceosome
3. B	GO:0043297	apical junction assembly
3. B	GO:0003677	DNA binding
3. B	GO:0048471	perinuclear region of cytoplasm
3. B	GO:0051012	microtubule sliding
3. B	GO:0030971	receptor tyrosine kinase binding
3. B	GO:1903013	response to differentiation-inducing factor 1
3. B	GO:0001764	neuron migration
3. B	GO:0045746	negative regulation of Notch signaling pathway
3. B	GO:0030157	pancreatic juice secretion
3. B	GO:0043473	pigmentation
3. B	GO:0090724	central region of growth cone
3. B	GO:0120197	mucociliary clearance
3. B	GO:0097027	ubiquitin-protein transferase activator activity
3. B	GO:0016905	myosin heavy chain kinase activity
3. B	GO:0000722	telomere maintenance via recombination
3. B	GO:0030507	spectrin binding
3. B	GO:0000398	mRNA splicing, via spliceosome
3. B	GO:1900091	regulation of raffinose biosynthetic process
3. B	GO:0006907	pinocytosis
3. B	GO:0030178	negative regulation of Wnt signaling pathway
3. B	GO:0010883	regulation of lipid storage
3. B	GO:0007312	oocyte nucleus migration involved in oocyte dorsal/ventral axis specification
3. B	GO:0000235	astral microtubule
3. B	GO:0007079	mitotic chromosome movement towards spindle pole
3. B	GO:0032350	regulation of hormone metabolic process
3. B	GO:2000574	obsolete regulation of microtubule motor activity
3. B	GO:0034452	dynactin binding
3. B	GO:0030706	germarium-derived oocyte differentiation
3. B	GO:0010235	guard mother cell cytokinesis
3. B	GO:0090049	regulation of cell migration involved in sprouting angiogenesis
3. B	GO:0005840	ribosome
3. B	GO:0010826	negative regulation of centrosome duplication
3. B	GO:0005525	GTP binding
3. B	GO:0046716	muscle cell cellular homeostasis
3. B	GO:0038026	reelin-mediated signaling pathway
3. B	GO:1903378	positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
3. B	GO:1904115	axon cytoplasm
3. B	GO:0045931	positive regulation of mitotic cell cycle
3. B	GO:0010992	ubiquitin recycling
3. B	GO:1990266	neutrophil migration
3. B	GO:0021987	cerebral cortex development
3. B	GO:0007294	germarium-derived oocyte fate determination
3. B	GO:0030043	actin filament fragmentation
3. B	GO:0071007	U2-type catalytic step 2 spliceosome
3. B	GO:1903146	regulation of autophagy of mitochondrion
3. B	GO:1903955	positive regulation of protein targeting to mitochondrion
3. B	GO:0030834	regulation of actin filament depolymerization
3. B	GO:1900087	positive regulation of G1/S transition of mitotic cell cycle
3. B	GO:0015630	microtubule cytoskeleton
3. B	GO:0010118	stomatal movement
3. B	GO:0030865	cortical cytoskeleton organization
3. B	GO:0008352	katanin complex
3. B	GO:0040019	positive regulation of embryonic development
3. B	GO:0045827	negative regulation of isoprenoid metabolic process
3. B	GO:0051299	centrosome separation
3. B	GO:0016607	nuclear speck
3. B	GO:0036180	filamentous growth of a population of unicellular organisms in response to biotic stimulus
3. B	GO:0000974	Prp19 complex
3. B	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0010476	gibberellin mediated signaling pathway
3. B	GO:0010906	regulation of glucose metabolic process
3. B	GO:0043327	chemotaxis to cAMP
3. B	GO:0051443	positive regulation of ubiquitin-protein transferase activity
3. B	GO:0005662	DNA replication factor A complex
3. B	GO:1903666	positive regulation of asexual reproduction
3. B	GO:0005635	nuclear envelope
3. B	GO:0042752	regulation of circadian rhythm
3. B	GO:0071333	cellular response to glucose stimulus
3. B	GO:0043982	histone H4-K8 acetylation
3. B	GO:0040013	negative regulation of locomotion
3. B	GO:0021819	layer formation in cerebral cortex
3. B	GO:0035591	signaling adaptor activity
3. B	GO:0021766	hippocampus development
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0008090	retrograde axonal transport
3. B	GO:0016055	Wnt signaling pathway
3. B	GO:0007369	gastrulation
3. B	GO:0051434	BH3 domain binding
3. B	GO:0005881	cytoplasmic microtubule
3. B	GO:0051081	nuclear membrane disassembly
3. B	GO:0003380	establishment or maintenance of cytoskeleton polarity involved in gastrulation
3. B	GO:0031398	positive regulation of protein ubiquitination
3. B	GO:0001934	positive regulation of protein phosphorylation
3. B	GO:0030220	platelet formation
3. B	GO:0051898	negative regulation of protein kinase B signaling
3. B	GO:0000132	establishment of mitotic spindle orientation
3. B	GO:0051510	regulation of unidimensional cell growth
3. B	GO:0033290	eukaryotic 48S preinitiation complex
3. B	GO:0043966	histone H3 acetylation
3. B	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
3. B	GO:1990716	axonemal central apparatus
3. B	GO:0001675	acrosome assembly
3. B	GO:0032091	negative regulation of protein binding
3. B	GO:1901386	negative regulation of voltage-gated calcium channel activity
3. B	GO:0016251	RNA polymerase II general transcription initiation factor activity
3. B	GO:0042998	positive regulation of Golgi to plasma membrane protein transport
3. B	GO:0030723	ovarian fusome organization
3. B	GO:0007298	border follicle cell migration
3. B	GO:0045741	positive regulation of epidermal growth factor-activated receptor activity
3. B	GO:0007062	sister chromatid cohesion
3. B	GO:0042247	establishment of planar polarity of follicular epithelium
3. B	GO:0031117	positive regulation of microtubule depolymerization
3. B	GO:0016559	peroxisome fission
3. B	GO:0005929	cilium
3. B	GO:0048713	regulation of oligodendrocyte differentiation
3. B	GO:0045214	sarcomere organization
3. B	GO:0072593	reactive oxygen species metabolic process
3. B	GO:0001826	inner cell mass cell differentiation
3. B	GO:0034399	nuclear periphery
3. B	GO:0034396	negative regulation of transcription from RNA polymerase II promoter in response to iron
3. B	GO:0005246	calcium channel regulator activity
3. B	GO:0007165	signal transduction
3. B	GO:0009867	jasmonic acid mediated signaling pathway
3. B	GO:0005669	transcription factor TFIID complex
3. B	GO:0007097	nuclear migration
3. B	GO:0033276	transcription factor TFTC complex
3. B	GO:0007019	microtubule depolymerization
3. B	GO:0005815	microtubule organizing center
3. B	GO:0043622	cortical microtubule organization
3. B	GO:2001244	positive regulation of intrinsic apoptotic signaling pathway
3. B	GO:0051642	centrosome localization
3. B	GO:0005847	mRNA cleavage and polyadenylation specificity factor complex
3. B	GO:0009585	red, far-red light phototransduction
3. B	GO:0043005	neuron projection
3. B	GO:0043981	histone H4-K5 acetylation
3. B	GO:0031616	spindle pole centrosome
3. B	GO:0043568	positive regulation of insulin-like growth factor receptor signaling pathway
3. B	GO:0045505	dynein intermediate chain binding
3. B	GO:0000417	HIR complex
3. B	GO:0030308	negative regulation of cell growth
3. B	GO:0006333	chromatin assembly or disassembly
3. B	GO:0048854	brain morphogenesis
3. B	GO:0072499	photoreceptor cell axon guidance
3. B	GO:0032880	regulation of protein localization
3. B	GO:0007219	Notch signaling pathway
3. B	GO:0048700	acquisition of desiccation tolerance in seed
3. B	GO:0005848	mRNA cleavage stimulating factor complex
3. B	GO:0001732	formation of cytoplasmic translation initiation complex
3. B	GO:0009663	plasmodesma organization
3. B	GO:1905392	plant organ morphogenesis
3. B	GO:0007212	dopamine receptor signaling pathway
3. B	GO:2001205	negative regulation of osteoclast development
3. B	GO:0048813	dendrite morphogenesis
3. B	GO:1900088	regulation of inositol biosynthetic process
3. B	GO:0071013	catalytic step 2 spliceosome
3. B	GO:0060590	ATPase regulator activity
3. B	GO:0048794	swim bladder development
3. B	GO:0009845	seed germination
3. B	GO:0098992	neuronal dense core vesicle
3. B	GO:0098930	axonal transport
3. B	GO:0044297	cell body
3. B	GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
3. B	GO:0005741	mitochondrial outer membrane
3. B	GO:0051219	phosphoprotein binding
3. B	GO:0097729	9+2 motile cilium
3. B	GO:0045199	maintenance of epithelial cell apical/basal polarity
3. B	GO:0051225	spindle assembly
3. B	GO:1902773	GTPase activator complex
3. B	GO:0043984	histone H4-K16 acetylation
3. B	GO:0140582	adenylate cyclase-activating G protein-coupled cAMP receptor signaling pathway
3. B	GO:0051010	microtubule plus-end binding
3. B	GO:0021895	cerebral cortex neuron differentiation
3. B	GO:0051020	GTPase binding
3. B	GO:0051901	positive regulation of mitochondrial depolarization
3. B	GO:1903341	regulation of meiotic DNA double-strand break formation
3. B	GO:0002446	neutrophil mediated immunity
3. B	GO:0034501	protein localization to kinetochore
3. B	GO:0036035	osteoclast development
3. B	GO:0009967	positive regulation of signal transduction
3. B	GO:0046662	regulation of oviposition
3. B	GO:0006378	mRNA polyadenylation
3. B	GO:0000437	carbon catabolite repression of transcription from RNA polymerase II promoter
3. B	GO:0060117	auditory receptor cell development
3. B	GO:1905803	negative regulation of cellular response to manganese ion
3. B	GO:0090660	cerebrospinal fluid circulation
3. B	GO:0051721	protein phosphatase 2A binding
3. B	GO:0007026	negative regulation of microtubule depolymerization
3. B	GO:0033137	negative regulation of peptidyl-serine phosphorylation
3. B	GO:0005092	GDP-dissociation inhibitor activity
3. B	GO:0043065	positive regulation of apoptotic process
3. B	GO:1990630	IRE1-RACK1-PP2A complex
3. B	GO:0007611	learning or memory
3. B	GO:0045309	protein phosphorylated amino acid binding
3. B	GO:0000266	mitochondrial fission
3. B	GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0048575	short-day photoperiodism, flowering
3. B	GO:0048135	female germ-line cyst formation
3. B	GO:0046329	negative regulation of JNK cascade
3. B	GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling
3. B	GO:0061966	establishment of left/right asymmetry
3. B	GO:0043204	perikaryon
3. B	GO:1990756	ubiquitin ligase-substrate adaptor activity
3. B	GO:0071363	cellular response to growth factor stimulus
3. B	GO:1903138	negative regulation of cell wall integrity MAPK cascade
3. B	GO:0045478	fusome organization
3. B	GO:0042393	histone binding
3. B	GO:0030332	cyclin binding
3. B	GO:0060444	branching involved in mammary gland duct morphogenesis
3. B	GO:0030286	dynein complex
3. B	GO:0090176	microtubule cytoskeleton organization involved in establishment of planar polarity
3. B	GO:0005852	eukaryotic translation initiation factor 3 complex
3. B	GO:1903725	regulation of phospholipid metabolic process
3. B	GO:0045598	regulation of fat cell differentiation
3. B	GO:0061836	intranuclear rod
3. B	GO:0005828	kinetochore microtubule
3. B	GO:0016230	sphingomyelin phosphodiesterase activator activity
3. B	GO:0060027	convergent extension involved in gastrulation
3. B	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0043087	regulation of GTPase activity
3. B	GO:0001961	positive regulation of cytokine-mediated signaling pathway
3. B	GO:0009723	response to ethylene
3. B	GO:0031334	positive regulation of protein-containing complex assembly
3. B	GO:0060290	transdifferentiation
3. B	GO:0008380	RNA splicing
3. B	GO:0000393	spliceosomal conformational changes to generate catalytic conformation
3. B	GO:0010659	cardiac muscle cell apoptotic process
3. B	GO:0051302	regulation of cell division
3. B	GO:0005875	microtubule associated complex
3. B	GO:0030513	positive regulation of BMP signaling pathway
3. B	GO:0031929	TOR signaling
3. B	GO:1990452	Parkin-FBXW7-Cul1 ubiquitin ligase complex
3. B	GO:0032991	protein-containing complex
3. B	GO:0043293	apoptosome
3. B	GO:0030381	chorion-containing eggshell pattern formation
3. B	GO:0007186	G protein-coupled receptor signaling pathway
3. B	GO:0070034	telomerase RNA binding
3. B	GO:0046872	metal ion binding
3. B	GO:0005697	telomerase holoenzyme complex
3. B	GO:0070507	regulation of microtubule cytoskeleton organization
3. B	GO:0090207	regulation of triglyceride metabolic process
3. B	GO:0030621	U4 snRNA binding
3. B	GO:0031124	mRNA 3'-end processing
3. B	GO:0050816	phosphothreonine residue binding
3. B	GO:0045842	positive regulation of mitotic metaphase/anaphase transition
3. B	GO:0090102	cochlea development
3. B	GO:0016243	regulation of autophagosome size
3. B	GO:0009640	photomorphogenesis
3. B	GO:0031570	DNA integrity checkpoint signaling
3. B	GO:0002102	podosome
3. B	GO:0042249	establishment of planar polarity of embryonic epithelium
3. B	GO:0098654	CENP-A recruiting complex
3. B	GO:0031648	protein destabilization
3. B	GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process
3. B	GO:0042169	SH2 domain binding
3. B	GO:1903208	negative regulation of hydrogen peroxide-induced neuron death
3. B	GO:0030292	protein tyrosine kinase inhibitor activity
3. B	GO:0090443	FAR/SIN/STRIPAK complex
3. B	GO:0051572	negative regulation of histone H3-K4 methylation
3. B	GO:0072344	rescue of stalled ribosome
3. B	GO:0000433	carbon catabolite repression of transcription from RNA polymerase II promoter by glucose
3. B	GO:0046982	protein heterodimerization activity
3. B	GO:0030674	protein-macromolecule adaptor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q8IV35	WD repeat-containing protein 49	0	6.59e-164	0.0
1. PB	Q8JZX3	POC1 centriolar protein homolog A	6.72e-08	7.17e-05	2.91e-05
1. PB	Q28I85	POC1 centriolar protein homolog A	8.03e-08	9.13e-06	1.48e-04
1. PB	A2RRU3	U3 small nucleolar RNA-associated protein 15 homolog	4.33e-05	4.13e-02	0.001
1. PB	Q5R664	Coatomer subunit beta'	3.16e-06	1.24e-02	0.011
1. PB	Q5RAW8	WD repeat-containing protein 48	1.46e-04	1.27e-04	5.74e-05
1. PB	Q8NBT0	POC1 centriolar protein homolog A	5.73e-06	2.83e-05	4.47e-04
1. PB	Q6PFM9	WD repeat-containing protein 48	2.33e-04	2.03e-02	5.50e-05
1. PB	Q5RD06	POC1 centriolar protein homolog B	8.67e-07	1.46e-05	0.002
1. PB	P87177	Uncharacterized WD repeat-containing protein C3D6.12	8.74e-06	2.83e-06	0.004
1. PB	B4HND9	WD repeat-containing protein 48 homolog	7.18e-05	2.59e-06	0.001
1. PB	B4MFM2	WD repeat-containing protein 48 homolog	1.14e-03	3.63e-06	0.010
1. PB	B4P7H8	WD repeat-containing protein 48 homolog	1.96e-05	4.33e-06	0.006
1. PB	Q05B17	WD repeat-containing protein 48	7.37e-04	9.24e-04	2.61e-06
1. PB	Q8BH57	WD repeat-containing protein 48	2.11e-03	3.08e-04	8.51e-05
1. PB	B4KRQ4	WD repeat-containing protein 48 homolog	8.52e-05	6.38e-06	0.025
1. PB	Q9USN3	Probable U3 small nucleolar RNA-associated protein 13	7.64e-06	6.46e-06	3.12e-06
1. PB	D3ZW91	POC1 centriolar protein homolog B	3.11e-07	6.30e-06	0.001
1. PB	O62621	Coatomer subunit beta'	2.20e-06	1.11e-03	0.020
1. PB	Q2KJJ5	Transducin beta-like protein 3	4.61e-04	3.31e-05	0.006
1. PB	B3MET8	WD repeat-containing protein 48 homolog	3.08e-04	3.09e-06	0.006
1. PB	O35142	Coatomer subunit beta'	1.81e-06	9.23e-03	0.023
1. PB	Q9C827	Coatomer subunit beta'-2	9.19e-06	4.47e-02	0.027
1. PB	Q4R4I8	Coatomer subunit beta'	1.96e-06	1.66e-02	0.010
1. PB	B7FF09	WD repeat-containing protein on Y chromosome	6.79e-08	4.98e-03	3.95e-35
1. PB	Q8TAF3	WD repeat-containing protein 48	9.74e-04	2.60e-04	5.22e-05
1. PB	B0X2V9	WD repeat-containing protein 48 homolog	3.83e-04	8.50e-07	0.038
1. PB	F6ZT52	POC1 centriolar protein homolog B	2.43e-05	2.60e-05	4.05e-06
1. PB	Q17I16	WD repeat-containing protein on Y chromosome	8.75e-06	1.03e-02	1.95e-32
1. PB	Q8TC44	POC1 centriolar protein homolog B	1.95e-06	1.39e-05	0.002
1. PB	Q7ZXZ2	U3 small nucleolar RNA-associated protein 15 homolog	5.53e-07	3.97e-02	0.014
1. PB	Q5F3K4	WD repeat-containing protein 48	8.41e-04	1.97e-04	5.32e-05
1. PB	Q4V7Z1	POC1 centriolar protein homolog B	8.42e-06	6.68e-05	7.04e-06
1. PB	Q5U2W5	Transducin beta-like protein 3	1.99e-07	8.16e-05	0.006
1. PB	Q32PG3	WD repeat-containing protein 48	2.82e-04	4.09e-04	5.27e-05
1. PB	P35606	Coatomer subunit beta'	2.66e-06	7.81e-03	0.010
1. PB	Q8BHB4	WD repeat-containing protein 3	4.37e-05	9.54e-07	7.56e-04
1. PB	Q8C4J7	Transducin beta-like protein 3	8.38e-05	9.95e-05	1.30e-04
1. PB	Q8L828	Coatomer subunit beta'-3	8.46e-06	1.73e-02	0.016
1. PB	P35605	Coatomer subunit beta'	2.51e-06	9.72e-03	0.010
1. PB	O55029	Coatomer subunit beta'	2.20e-06	1.01e-02	0.010
1. PB	Q8BHD1	POC1 centriolar protein homolog B	4.34e-06	7.97e-06	7.92e-05
1. PB	Q7ZVF0	POC1 centriolar protein homolog A	2.39e-06	2.86e-03	2.22e-05
1. PB	Q28YY2	WD repeat-containing protein 48 homolog	4.40e-04	1.21e-05	0.039
1. PB	Q1LZ08	WD repeat-containing protein 48 homolog	1.40e-04	1.27e-06	0.007
1. PB	Q16MY0	WD repeat-containing protein 48 homolog	6.08e-04	1.03e-06	0.015
1. PB	A8XSW2	WD repeat-containing protein 48 homolog	4.66e-04	3.97e-06	0.004
1. PB	B1ANS9	WD repeat-containing protein 64	3.57e-04	8.58e-03	4.10e-24
1. PB	Q12788	Transducin beta-like protein 3	1.38e-04	3.82e-04	2.38e-05
1. PB	Q9UNX4	WD repeat-containing protein 3	2.86e-05	1.93e-07	1.29e-04
1. PB	Q54UI3	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4	2.59e-04	1.41e-04	2.61e-04
1. PB	B4GIJ0	WD repeat-containing protein 48 homolog	4.82e-04	1.21e-05	0.039
1. PB	B4J8H6	WD repeat-containing protein 48 homolog	1.82e-04	2.46e-06	0.031
1. PB	Q7T0P4	POC1 centriolar protein homolog A	1.69e-05	8.25e-05	1.56e-04
1. PB	Q2TBP4	POC1 centriolar protein homolog A	4.28e-07	5.61e-07	1.36e-04
1. PB	B4QB64	WD repeat-containing protein 48 homolog	1.95e-05	1.66e-06	8.73e-04
1. PB	B3NSK1	WD repeat-containing protein 48 homolog	6.81e-05	3.50e-06	0.007
1. PB	Q4R2Z6	WD repeat-containing protein 48	1.56e-04	7.88e-05	5.49e-05
2. P	Q9WUM3	Coronin-1B	2.57e-04	1.60e-03	NA
2. P	Q6P7W2	SH3KBP1-binding protein 1	4.46e-02	1.84e-03	NA
2. P	Q5R4T8	DDB1- and CUL4-associated factor 13	2.47e-07	2.74e-03	NA
2. P	Q8RXU6	WD repeat-containing protein PCN	2.56e-05	9.24e-04	NA
2. P	P27133	Coronin-A	2.36e-04	5.15e-05	NA
2. P	O89053	Coronin-1A	8.15e-05	3.44e-03	NA
2. P	A1CRF7	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit trm82	6.26e-04	2.83e-02	NA
2. P	Q5RHI5	Denticleless protein homolog	1.82e-04	3.92e-06	NA
2. P	Q6PAC3	DDB1- and CUL4-associated factor 13	2.51e-07	4.82e-03	NA
2. P	Q3SYG4	Protein PTHB1	9.13e-04	1.97e-02	NA
2. P	O14053	U3 small nucleolar RNA-associated protein 21 homolog	9.12e-06	7.97e-12	NA
2. P	Q0CRF8	WD repeat-containing protein jip5	4.27e-08	1.08e-02	NA
2. P	Q5DQR4	Syntaxin-binding protein 5-like	8.33e-02	5.12e-04	NA
2. P	Q920M5	Coronin-6	3.46e-04	4.38e-02	NA
2. P	Q6BMP5	Pre-rRNA-processing protein IPI3	4.67e-04	1.75e-05	NA
2. P	Q6FN70	Protein DSE1	1.37e-04	1.29e-03	NA
2. P	P91341	Periodic tryptophan protein 2 homolog	6.02e-06	8.00e-04	NA
2. P	G0S2X1	Nucleoporin NUP37	4.75e-03	4.67e-03	NA
2. P	Q05946	U3 small nucleolar RNA-associated protein 13	9.89e-04	4.01e-02	NA
2. P	Q9FH32	Autophagy-related protein 18f	7.74e-03	1.71e-07	NA
2. P	Q96EE3	Nucleoporin SEH1	2.52e-04	1.37e-03	NA
2. P	P38163	Lethal(2) giant larvae protein homolog SRO77	2.92e-05	3.45e-07	NA
2. P	A4IGH4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4	3.83e-06	4.23e-04	NA
2. P	Q9C1X1	Periodic tryptophan protein 2 homolog	9.27e-07	4.32e-04	NA
2. P	B0R0D7	Coronin-1C-A	1.99e-04	2.26e-03	NA
2. P	Q9BV38	WD repeat-containing protein 18	7.75e-05	4.97e-05	NA
2. P	Q8TBY9	Cilia- and flagella-associated protein 251	8.48e-05	1.99e-02	NA
2. P	Q9NWT1	p21-activated protein kinase-interacting protein 1	5.59e-05	1.91e-06	NA
2. P	Q4VBE8	WD repeat-containing protein 18	5.14e-05	2.54e-05	NA
2. P	Q9WUM4	Coronin-1C	7.35e-05	4.41e-05	NA
2. P	P0C5J9	SH3KBP1-binding protein 1	2.96e-03	6.89e-03	NA
2. P	Q9XS70	Coronin-1B	1.53e-04	2.61e-02	NA
2. P	Q9WU70	Syntaxin-binding protein 5	7.57e-04	1.59e-02	NA
2. P	Q499N3	WD repeat-containing protein 18	2.89e-05	2.23e-05	NA
2. P	Q24DE2	Cilia- and flagella-associated protein 251	3.26e-05	6.59e-08	NA
2. P	Q99567	Nuclear pore complex protein Nup88	6.18e-03	3.29e-03	NA
2. P	P40055	U3 small nucleolar RNA-associated protein 7	1.45e-03	2.32e-04	NA
2. P	P25635	Periodic tryptophan protein 2	1.20e-05	3.86e-04	NA
2. P	Q9D2V7	Coronin-7	1.58e-06	7.11e-03	NA
2. P	Q5U4Y8	Nucleoporin SEH1	1.69e-04	4.23e-04	NA
2. P	Q3UDP0	WD repeat-containing protein 41	1.62e-06	1.16e-02	NA
2. P	A6RDW5	WD repeat-containing protein JIP5	2.26e-06	1.14e-04	NA
2. P	A8WGE3	Coronin-2B	1.03e-03	6.00e-09	NA
2. P	Q4WJR4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit trm82	1.15e-03	1.46e-06	NA
2. P	Q6CEC9	Ribosome biogenesis protein NSA1	5.05e-06	4.04e-04	NA
2. P	P20484	Protein MAK11	2.33e-06	1.35e-06	NA
2. P	Q5RBW3	Coronin-7	1.93e-06	1.05e-03	NA
2. P	Q9VNX8	Eukaryotic translation initiation factor 2A	3.31e-02	3.66e-02	NA
2. P	Q9C270	Periodic tryptophan protein 2 homolog	2.83e-05	3.33e-08	NA
2. P	P53877	Pre-rRNA-processing protein IPI3	3.20e-03	1.58e-05	NA
2. P	A7YY75	Nucleoporin SEH1	3.50e-04	6.08e-05	NA
2. P	Q9H6U6	BCAS3 microtubule associated cell migration factor	3.27e-02	2.16e-04	NA
2. P	Q5E915	Protein RBL	1.97e-04	8.15e-03	NA
2. P	Q1DNW5	WD repeat-containing protein JIP5	2.85e-07	1.62e-03	NA
2. P	Q6P1W0	Denticleless protein homolog	1.99e-04	3.43e-05	NA
2. P	Q9CAA0	Coatomer subunit beta'-1	7.73e-06	4.64e-02	NA
2. P	Q4WNA1	WD repeat-containing protein jip5	7.43e-08	2.24e-03	NA
2. P	Q6CVN2	WD repeat-containing protein JIP5	5.07e-05	5.95e-03	NA
2. P	Q6GNF1	Nucleoporin SEH1-B	2.82e-04	1.02e-02	NA
2. P	Q8IWA0	WD repeat-containing protein 75	1.56e-03	6.74e-11	NA
2. P	Q8R2U0	Nucleoporin SEH1	2.27e-04	1.12e-04	NA
2. P	Q4R4J2	Coronin-1A	8.13e-05	7.04e-03	NA
2. P	Q5AB15	Pre-rRNA-processing protein IPI3	6.16e-05	2.62e-06	NA
2. P	D3YYM4	WD repeat-containing protein 72	1.40e-02	1.08e-02	NA
2. P	Q9M3B4	Protein ROOT INITIATION DEFECTIVE 3	5.76e-05	7.31e-09	NA
2. P	A3KMV1	SH3KBP1-binding protein 1	2.51e-03	3.56e-02	NA
2. P	A5DNK9	Pre-rRNA-processing protein IPI3	2.40e-05	5.66e-12	NA
2. P	Q3U821	WD repeat-containing protein 75	1.46e-03	3.65e-09	NA
2. P	Q75AI1	Protein DSE1	7.31e-04	1.05e-03	NA
2. P	O13985	Uncharacterized WD repeat-containing protein C26H5.03	1.04e-04	2.51e-02	NA
2. P	P31146	Coronin-1A	1.51e-04	4.58e-03	NA
2. P	A0A1L8HX76	WD repeat-containing protein 18	6.53e-05	1.71e-03	NA
2. P	Q5ZKU8	p21-activated protein kinase-interacting protein 1-like	6.09e-06	1.88e-03	NA
2. P	Q9BR76	Coronin-1B	2.78e-03	1.38e-02	NA
2. P	Q8TBC3	SH3KBP1-binding protein 1	2.22e-02	2.66e-02	NA
2. P	Q3TLR7	Denticleless protein homolog	2.52e-04	1.08e-02	NA
2. P	Q22006	Pre-rRNA-processing protein pro-1	3.93e-04	1.67e-02	NA
2. P	Q6QEF8	Coronin-6	9.77e-05	3.97e-02	NA
2. P	Q8CCN5	BCAS3 microtubule associated cell migration factor	3.19e-02	7.69e-05	NA
2. P	Q6H8D5	Coatomer subunit beta'-2	7.45e-06	5.25e-03	NA
2. P	Q9NV06	DDB1- and CUL4-associated factor 13	1.38e-07	1.44e-02	NA
2. P	Q9Y597	BTB/POZ domain-containing protein KCTD3	3.75e-02	6.46e-06	NA
2. P	Q6H8D6	Putative coatomer subunit beta'-3	6.61e-06	7.42e-03	NA
2. P	C1BK83	Nucleoporin SEH1	2.20e-04	6.75e-03	NA
2. P	Q04199	Chromatin assembly factor 1 subunit p60	1.76e-03	7.42e-03	NA
2. P	Q7ZYQ6	DDB1- and CUL4-associated factor 13	2.92e-07	4.36e-05	NA
2. P	Q68FJ6	p21-activated protein kinase-interacting protein 1-like	4.24e-06	2.18e-02	NA
2. P	Q10408	Uncharacterized protein C1F3.03	1.06e-04	4.98e-07	NA
2. P	Q8CEC0	Nuclear pore complex protein Nup88	4.97e-03	1.93e-02	NA
2. P	Q6DJD8	Coronin-2B	1.88e-04	1.71e-07	NA
2. P	Q8C0P5	Coronin-2A	7.85e-04	5.80e-05	NA
2. P	A8IRK7	Cilia- and flagella-associated protein 251	1.28e-05	1.68e-10	NA
2. P	Q12220	U3 small nucleolar RNA-associated protein 12	3.51e-04	4.20e-12	NA
2. P	A3LPR4	WD repeat-containing protein JIP5	8.43e-04	1.82e-03	NA
2. P	O08658	Nuclear pore complex protein Nup88	2.97e-03	1.56e-02	NA
2. P	B0XNT4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit trm82	1.17e-03	1.46e-06	NA
2. P	Q91ZN1	Coronin-1A	9.12e-05	4.62e-03	NA
2. P	Q9Y2K9	Syntaxin-binding protein 5-like	1.15e-02	2.48e-04	NA
2. P	A7EGU0	WD repeat-containing protein jip5	5.84e-07	3.15e-03	NA
2. P	Q5ZJW8	Denticleless protein homolog	5.79e-03	6.21e-03	NA
2. P	O80775	WD repeat-containing protein 55	1.15e-06	3.19e-03	NA
2. P	Q969X6	U3 small nucleolar RNA-associated protein 4 homolog	6.98e-07	4.74e-05	NA
2. P	Q8NI36	WD repeat-containing protein 36	7.09e-03	6.19e-04	NA
2. P	Q9P4X3	Probable U3 small nucleolar RNA-associated protein 7	1.26e-04	4.13e-02	NA
2. P	Q92828	Coronin-2A	7.24e-04	1.20e-05	NA
2. P	Q6CRK4	Pre-rRNA-processing protein IPI3	4.18e-03	1.53e-05	NA
2. P	A2QPG3	WD repeat-containing protein jip5	8.21e-06	1.47e-02	NA
2. P	A1CE98	WD repeat-containing protein jip5	7.77e-08	1.85e-02	NA
2. P	Q5FVB6	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4	9.20e-05	6.15e-05	NA
2. P	Q3SZD4	WD repeat-containing protein 18	2.49e-03	1.44e-04	NA
2. P	Q4PHV3	Pre-rRNA-processing protein IPI3	1.34e-03	2.60e-04	NA
2. P	O16519	Gastrulation defective protein 1	8.97e-03	3.89e-02	NA
2. P	Q9P7W4	F-box/WD repeat-containing protein pof10	1.32e-04	3.70e-02	NA
2. P	Q10272	Pre-rRNA-processing protein crb3/ipi3	1.73e-04	2.39e-08	NA
2. P	O74863	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit trm82	5.84e-07	1.01e-07	NA
2. P	Q6TNS2	p21-activated protein kinase-interacting protein 1-like	3.35e-06	5.24e-04	NA
2. P	Q9UT73	Uncharacterized WD repeat-containing protein C343.17c	1.68e-04	1.27e-05	NA
2. P	O74340	Protein sof1	1.15e-07	2.07e-05	NA
2. P	Q8BU03	Periodic tryptophan protein 2 homolog	3.98e-07	3.27e-05	NA
2. P	P0CS53	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	7.77e-04	1.66e-04	NA
2. P	Q02931	NET1-associated nuclear protein 1	1.72e-06	1.64e-02	NA
2. P	Q7KWL3	DDB1- and CUL4-associated factor 13	2.49e-07	5.41e-04	NA
2. P	Q9DCE5	p21-activated protein kinase-interacting protein 1	5.01e-07	7.78e-05	NA
2. P	Q5ZLK1	DDB1- and CUL4-associated factor 13	3.02e-07	2.45e-04	NA
2. P	Q9ULV4	Coronin-1C	5.61e-05	1.77e-05	NA
2. P	Q5B2Q3	WD repeat-containing protein jip5	9.33e-08	2.07e-03	NA
2. P	Q32LP9	Coronin-2A	1.03e-03	3.11e-04	NA
2. P	Q7ZVR1	WD repeat-containing protein 75	5.92e-06	2.99e-07	NA
2. P	Q5RFQ3	Periodic tryptophan protein 2 homolog	3.78e-07	4.03e-03	NA
2. P	Q9W415	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	1.09e-04	1.91e-02	NA
2. P	Q7ZY78	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4	5.24e-04	5.85e-06	NA
2. P	A8Q2R5	WD repeat-containing protein 48 homolog	6.24e-05	5.75e-07	NA
2. P	Q20059	WD repeat-containing protein 48 homolog	1.12e-04	3.69e-05	NA
2. P	A8WSU9	Pre-rRNA-processing protein pro-1	1.09e-03	4.20e-03	NA
2. P	Q9VU65	POC1 centriolar protein homolog	4.09e-06	2.43e-02	NA
2. P	Q68EI0	WD repeat-containing protein 18	1.47e-05	2.31e-03	NA
2. P	O82266	Protein SLOW WALKER 1	1.57e-05	1.74e-02	NA
2. P	O74965	Eukaryotic translation initiation factor 2A	5.54e-04	2.63e-03	NA
2. P	O89046	Coronin-1B	3.57e-03	6.26e-04	NA
2. P	P57081	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	4.43e-04	2.45e-05	NA
2. P	B5DMC9	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	1.54e-04	2.07e-02	NA
2. P	A6RWR8	WD repeat-containing protein jip5	3.42e-07	3.22e-03	NA
2. P	Q4V837	Denticleless protein homolog A	1.19e-02	3.59e-07	NA
2. P	Q06679	U3 small nucleolar RNA-associated protein 4	4.95e-04	6.38e-06	NA
2. P	Q15269	Periodic tryptophan protein 2 homolog	4.33e-07	1.29e-03	NA
2. P	Q54S79	WD repeat-containing protein 3 homolog	3.16e-04	9.53e-11	NA
2. P	Q54PE0	Periodic tryptophan protein 2 homolog	2.74e-05	3.37e-04	NA
2. P	Q4FZW5	Nucleoporin SEH1-A	2.95e-04	2.37e-04	NA
2. P	Q803X4	DDB1- and CUL4-associated factor 13	3.39e-07	1.18e-03	NA
2. P	A7E3S5	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	1.44e-04	2.41e-03	NA
2. P	Q759L2	Eukaryotic translation initiation factor 3 subunit I	1.01e-09	3.70e-03	NA
2. P	A5DTA8	Pre-rRNA-processing protein IPI3	1.15e-04	3.79e-07	NA
2. P	Q9VPH8	Retinoblastoma-binding protein 5 homolog	6.01e-04	2.23e-08	NA
2. P	Q6GPU3	Denticleless protein homolog B	2.24e-04	2.38e-02	NA
2. P	P0CS52	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	4.38e-03	2.11e-04	NA
2. P	Q6C8F7	Protein EFR3	9.73e-01	2.97e-02	NA
2. P	Q5MNZ9	WD repeat domain phosphoinositide-interacting protein 1	1.17e-03	4.34e-03	NA
2. P	Q6TGU2	Nucleoporin SEH1	1.80e-04	1.53e-02	NA
2. P	Q5EA99	p21-activated protein kinase-interacting protein 1	9.89e-06	7.13e-06	NA
2. P	Q8VCG3	WD repeat-containing protein 74	2.07e-06	4.73e-04	NA
2. P	Q75E14	Pre-rRNA-processing protein IPI3	3.56e-03	3.19e-08	NA
2. P	Q8BX09	Retinoblastoma-binding protein 5	2.93e-05	8.17e-06	NA
2. P	P39706	COMPASS component SWD1	1.04e-05	3.82e-05	NA
2. P	A8PZI1	WD repeat-containing protein JIP5	2.73e-05	4.12e-03	NA
2. P	O60161	U3 small nucleolar RNA-associated protein 4	2.63e-05	7.82e-04	NA
2. P	Q8BH44	Coronin-2B	3.53e-04	1.00e-06	NA
2. P	O42858	Set1 complex component swd1	5.04e-06	8.55e-05	NA
2. P	B0D442	WD repeat-containing protein JIP5	3.04e-05	8.32e-03	NA
2. P	Q58D06	WD repeat-containing protein 74	6.58e-05	2.45e-05	NA
2. P	Q8K2G4	Bardet-Biedl syndrome 7 protein homolog	1.32e-03	1.32e-02	NA
2. P	Q0TZA1	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	6.19e-04	2.64e-05	NA
2. P	Q54FW9	WD repeat-containing protein DDB_G0290555	5.65e-04	3.99e-03	NA
2. P	Q6NLL1	WD repeat-containing protein CG11141	2.50e-02	1.35e-04	NA
2. P	Q6RFH5	WD repeat-containing protein 74	1.42e-05	6.54e-06	NA
2. P	O13878	U3 small nucleolar RNA-associated protein 17	3.40e-06	5.59e-05	NA
2. P	Q2UKH7	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit trm82	1.89e-03	6.02e-03	NA
2. P	B4JWS7	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	1.06e-05	3.66e-02	NA
2. P	Q15291	Retinoblastoma-binding protein 5	8.97e-04	5.85e-06	NA
2. P	Q6FNJ1	Pre-rRNA-processing protein IPI3	2.12e-03	3.08e-09	NA
2. P	Q6P2C0	WD repeat-containing protein 93	4.97e-04	1.61e-02	NA
2. P	Q5RAN6	Nucleoporin SEH1	2.65e-04	3.19e-04	NA
2. P	A6ZRQ4	Pre-rRNA-processing protein IPI3	2.23e-03	1.62e-05	NA
2. P	P33750	Protein SOF1	3.17e-07	1.77e-05	NA
2. P	Q19052	Eukaryotic translation initiation factor 2A	7.94e-05	8.85e-03	NA
2. P	A7UVN1	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	1.55e-05	1.70e-05	NA
2. P	Q0V786	WD repeat-containing protein JIP5	1.38e-07	2.94e-04	NA
2. P	Q6DFC6	WD repeat-containing protein 75	2.14e-05	1.59e-13	NA
2. P	Q09309	Retinoblastoma-binding protein homolog 5	1.40e-05	7.52e-09	NA
2. P	A7ESR0	ASTRA-associated protein 1	4.15e-03	1.79e-05	NA
2. P	A1DMA6	WD repeat-containing protein jip5	1.54e-07	2.49e-03	NA
2. P	Q06078	U3 small nucleolar RNA-associated protein 21	8.39e-05	1.79e-08	NA
2. P	Q8R2N2	U3 small nucleolar RNA-associated protein 4 homolog	9.44e-07	9.39e-05	NA
2. P	Q5NVK4	Coronin-1B	1.04e-04	2.29e-02	NA
2. P	Q8BFX3	BTB/POZ domain-containing protein KCTD3	1.93e-02	7.60e-05	NA
2. P	Q8H1Q5	Autophagy-related protein 18h	1.06e-01	3.64e-05	NA
2. P	Q92176	Coronin-1A	3.55e-04	1.73e-03	NA
2. P	Q9UQ03	Coronin-2B	1.22e-04	8.83e-07	NA
2. P	Q5RE88	Cilia- and flagella-associated protein 251	7.27e-05	2.94e-02	NA
2. P	A3LNM0	Pre-rRNA-processing protein IPI3	1.04e-03	6.48e-04	NA
2. P	Q920J3	Coronin-6	7.50e-05	1.97e-02	NA
2. P	Q6NVS5	DDB1- and CUL4-associated factor 13	4.44e-07	8.65e-05	NA
2. P	Q6FL15	Eukaryotic translation initiation factor 3 subunit I	1.82e-09	2.64e-02	NA
2. P	Q6C953	Pre-rRNA-processing protein IPI3	1.36e-05	2.80e-07	NA
2. P	Q9EP82	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	7.50e-06	1.06e-02	NA
3. B	Q9D994	WD repeat-containing protein 38	3.53e-07	NA	4.28e-06
3. B	Q5BE22	Pre-mRNA-splicing factor prp46	1.02e-06	NA	7.53e-07
3. B	B4KGX9	Eukaryotic translation initiation factor 3 subunit I	1.46e-09	NA	3.72e-07
3. B	G8SD34	NAD(+) hydrolase ApTIR	6.19e-06	NA	6.08e-05
3. B	Q7ZW33	U3 small nucleolar RNA-associated protein 15 homolog	1.65e-05	NA	0.002
3. B	Q8YRI1	Uncharacterized WD repeat-containing protein alr3466	5.84e-06	NA	2.19e-10
3. B	Q9W7F2	WD repeat-containing protein 1-A	4.30e-07	NA	2.59e-05
3. B	G4MQX3	MST50-interacting protein 11	2.99e-06	NA	2.04e-04
3. B	B4JWA1	Lissencephaly-1 homolog	5.80e-09	NA	1.28e-04
3. B	A4RDD7	Eukaryotic translation initiation factor 3 subunit I	1.60e-09	NA	0.003
3. B	Q05048	Cleavage stimulation factor subunit 1	2.37e-08	NA	0.039
3. B	A1L271	Guanine nucleotide-binding protein subunit beta-5a	1.16e-07	NA	0.001
3. B	Q8SRK1	Histone acetyltransferase type B subunit 2	5.02e-08	NA	0.036
3. B	Q13033	Striatin-3	1.10e-05	NA	2.71e-07
3. B	Q6DRF9	WD repeat-containing protein 55	2.37e-06	NA	7.00e-04
3. B	O74855	Ribosome assembly protein 4	2.66e-06	NA	0.033
3. B	O43815	Striatin	4.25e-04	NA	6.85e-04
3. B	P74442	Uncharacterized WD repeat-containing protein slr0143	1.22e-05	NA	6.94e-09
3. B	Q2GTM8	Eukaryotic translation initiation factor 3 subunit I	3.37e-09	NA	0.003
3. B	O94244	Histone acetyltransferase type B subunit 2	1.07e-07	NA	0.009
3. B	B3NPW0	Lissencephaly-1 homolog	5.30e-09	NA	2.00e-04
3. B	Q7RXH4	Eukaryotic translation initiation factor 3 subunit I	2.67e-09	NA	0.033
3. B	P0CS32	Eukaryotic translation initiation factor 3 subunit I	1.46e-08	NA	6.68e-05
3. B	Q75BY3	Pre-mRNA-splicing factor PRP46	2.46e-07	NA	1.03e-04
3. B	P62881	Guanine nucleotide-binding protein subunit beta-5	5.27e-08	NA	5.77e-04
3. B	Q92636	Protein FAN	7.78e-06	NA	0.010
3. B	D1FP53	Putative E3 ubiquitin-protein ligase LIN	1.17e-03	NA	0.038
3. B	Q6P2Y2	Dynein assembly factor with WDR repeat domains 1	1.73e-08	NA	5.68e-06
3. B	C5FP68	Probable E3 ubiquitin ligase complex SCF subunit sconB	9.10e-04	NA	1.73e-04
3. B	B7FF07	WD repeat-containing protein on Y chromosome	4.76e-07	NA	1.46e-38
3. B	C0NRC6	Nuclear distribution protein PAC1	6.80e-07	NA	1.03e-06
3. B	Q5XGE2	U3 small nucleolar RNA-associated protein 15 homolog	4.18e-07	NA	0.013
3. B	A0CH87	Lissencephaly-1 homolog 2	1.35e-08	NA	2.27e-04
3. B	Q6ZMY6	WD repeat-containing protein 88	7.46e-07	NA	0.002
3. B	B0WYR6	WD repeat-containing protein on Y chromosome	1.10e-08	NA	3.68e-34
3. B	Q149M9	NACHT domain- and WD repeat-containing protein 1	3.90e-04	NA	0.009
3. B	P47025	Mitochondrial division protein 1	3.72e-06	NA	0.013
3. B	Q9UTC7	Uncharacterized WD repeat-containing protein C227.12	5.74e-08	NA	1.78e-04
3. B	A8X8C6	WD repeat-containing protein tag-125	1.13e-08	NA	4.77e-09
3. B	Q6NZH4	Lissencephaly-1 homolog	4.90e-09	NA	3.47e-06
3. B	A8WVX8	Eukaryotic translation initiation factor 3 subunit I	2.57e-09	NA	0.033
3. B	C7Z6H2	Nuclear distribution protein PAC1	4.01e-08	NA	7.67e-05
3. B	Q61FW2	F-box/WD repeat-containing protein sel-10	2.34e-04	NA	1.52e-08
3. B	B0LSW3	Platelet-activating factor acetylhydrolase IB subunit beta	6.55e-09	NA	2.67e-07
3. B	P49846	Transcription initiation factor TFIID subunit 5	4.07e-06	NA	6.02e-07
3. B	P39014	F-box protein MET30	2.37e-04	NA	2.90e-06
3. B	A2QP30	Nuclear distribution protein nudF	8.62e-06	NA	0.018
3. B	Q8YV57	Uncharacterized WD repeat-containing protein all2124	1.44e-04	NA	9.65e-07
3. B	Q6CB13	Mitochondrial division protein 1	6.21e-06	NA	0.001
3. B	Q8HXX0	Platelet-activating factor acetylhydrolase IB subunit alpha	5.55e-09	NA	6.20e-07
3. B	Q6CI08	Eukaryotic translation initiation factor 3 subunit I	2.53e-09	NA	0.024
3. B	Q498M4	WD repeat-containing protein 5	5.90e-09	NA	5.00e-05
3. B	Q4P6E2	Eukaryotic translation initiation factor 3 subunit I	7.16e-09	NA	3.06e-05
3. B	Q86TI4	WD repeat-containing protein 86	7.85e-07	NA	1.22e-04
3. B	P63244	Receptor of activated protein C kinase 1	1.18e-08	NA	0.018
3. B	B4QHG6	Lissencephaly-1 homolog	5.05e-09	NA	1.71e-04
3. B	Q4WVS4	Mitochondrial division protein 1	1.80e-03	NA	0.025
3. B	Q9DC48	Pre-mRNA-processing factor 17	2.39e-05	NA	0.013
3. B	Q17963	WD repeat-containing protein wdr-5.1	1.15e-08	NA	8.43e-12
3. B	B4GSH1	Eukaryotic translation initiation factor 3 subunit I	1.22e-09	NA	7.46e-06
3. B	Q23256	WD repeat-containing protein wdr-5.3	4.41e-08	NA	1.14e-05
3. B	Q90ZL4	Lissencephaly-1 homolog	6.03e-09	NA	2.84e-06
3. B	P63245	Receptor of activated protein C kinase 1	2.24e-09	NA	0.018
3. B	C4YFX2	Transcriptional repressor TUP1	1.00e-07	NA	4.05e-04
3. B	P79959	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.89e-07	NA	0.017
3. B	Q8YTC2	Uncharacterized WD repeat-containing protein alr2800	1.04e-05	NA	3.01e-13
3. B	Q965S8	Eukaryotic translation initiation factor 3 subunit I	2.54e-09	NA	0.013
3. B	P62882	Guanine nucleotide-binding protein subunit beta-5	1.55e-07	NA	0.001
3. B	A5DGL8	Eukaryotic translation initiation factor 3 subunit I	4.80e-09	NA	0.004
3. B	P07834	Cell division control protein 4	1.87e-04	NA	0.046
3. B	Q8TED0	U3 small nucleolar RNA-associated protein 15 homolog	5.74e-05	NA	5.14e-04
3. B	P43254	E3 ubiquitin-protein ligase COP1	5.17e-05	NA	0.016
3. B	Q99973	Telomerase protein component 1	8.95e-02	NA	1.96e-06
3. B	P78706	Transcriptional repressor rco-1	3.75e-07	NA	2.21e-06
3. B	Q6RI45	Bromodomain and WD repeat-containing protein 3	4.64e-02	NA	0.001
3. B	Q9HAV0	Guanine nucleotide-binding protein subunit beta-4	1.78e-07	NA	5.97e-06
3. B	Q6DH44	WD repeat domain-containing protein 83	6.84e-09	NA	0.002
3. B	B4KT48	Lissencephaly-1 homolog	6.42e-09	NA	3.85e-04
3. B	Q21215	Guanine nucleotide-binding protein subunit beta-2-like 1	1.34e-08	NA	0.005
3. B	O93277	WD repeat-containing protein 1	1.50e-06	NA	4.66e-05
3. B	Q9D565	WD repeat-containing protein 64	6.29e-04	NA	2.55e-23
3. B	P54313	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	1.84e-07	NA	4.36e-07
3. B	Q9EPV5	Apoptotic protease-activating factor 1	5.18e-06	NA	0.003
3. B	O35242	Protein FAN	1.03e-05	NA	0.041
3. B	B0FXQ5	WD repeat-containing protein on Y chromosome	1.60e-05	NA	3.20e-40
3. B	Q6FJZ9	Pre-mRNA-splicing factor PRP46	2.75e-07	NA	8.22e-08
3. B	Q9PTR5	Lissencephaly-1 homolog	9.85e-09	NA	2.94e-07
3. B	Q2TBS9	WD40 repeat-containing protein SMU1	1.34e-07	NA	1.76e-04
3. B	O24456	Receptor for activated C kinase 1A	3.54e-06	NA	8.66e-04
3. B	A0A2R8RWN9	F-box and WD repeat domain-containing 11-B	5.01e-06	NA	0.001
3. B	P62883	Guanine nucleotide-binding protein subunit beta-like protein	1.54e-08	NA	0.011
3. B	Q01277	Probable E3 ubiquitin ligase complex SCF subunit scon-2	8.71e-04	NA	2.96e-04
3. B	Q6CKE8	Pre-mRNA-splicing factor PRP46	7.00e-07	NA	2.41e-07
3. B	Q9VU68	Actin-interacting protein 1	1.81e-06	NA	7.80e-04
3. B	O88879	Apoptotic protease-activating factor 1	1.34e-05	NA	0.006
3. B	Q12417	Pre-mRNA-splicing factor PRP46	9.26e-07	NA	2.23e-05
3. B	Q8CBE3	WD repeat-containing protein 37	2.34e-05	NA	0.014
3. B	Q921C3	Bromodomain and WD repeat-containing protein 1	2.52e-02	NA	0.001
3. B	Q8BG40	Katanin p80 WD40 repeat-containing subunit B1	4.44e-03	NA	7.06e-09
3. B	Q42384	Protein pleiotropic regulatory locus 1	1.21e-06	NA	0.006
3. B	F1MNN4	F-box/WD repeat-containing protein 7	7.12e-07	NA	3.36e-08
3. B	A0DB19	Lissencephaly-1 homolog 1	1.26e-08	NA	3.16e-04
3. B	Q54Y96	WD40 repeat-containing protein smu1	4.49e-08	NA	0.003
3. B	Q9SY00	COMPASS-like H3K4 histone methylase component WDR5B	3.71e-09	NA	2.31e-09
3. B	P16649	General transcriptional corepressor TUP1	6.34e-04	NA	8.60e-05
3. B	Q55AR8	U5 small nuclear ribonucleoprotein 40 kDa protein	1.31e-08	NA	1.15e-08
3. B	Q8RXA7	DENN domain and WD repeat-containing protein SCD1	8.24e-04	NA	2.51e-04
3. B	Q0CJD8	Mitochondrial division protein 1	1.67e-04	NA	2.06e-05
3. B	Q6PE01	U5 small nuclear ribonucleoprotein 40 kDa protein	1.92e-08	NA	4.99e-10
3. B	Q5SUS0	F-box/WD repeat-containing protein 10	1.44e-02	NA	0.001
3. B	Q8W1K8	Protein Mut11	1.04e-04	NA	1.60e-05
3. B	P56094	General transcriptional corepressor TUP1	3.47e-04	NA	0.014
3. B	A2CEH0	POC1 centriolar protein homolog B	4.48e-04	NA	9.59e-07
3. B	P38011	Guanine nucleotide-binding protein subunit beta-like protein	2.04e-06	NA	2.18e-08
3. B	Q58D00	F-box/WD repeat-containing protein 2	8.65e-06	NA	0.007
3. B	Q75C99	Histone acetyltransferase type B subunit 2	1.08e-06	NA	0.007
3. B	Q55BR7	Protein raptor homolog	1.00e-03	NA	0.011
3. B	Q8VBV4	F-box/WD repeat-containing protein 7	1.08e-06	NA	4.04e-08
3. B	Q9NSI6	Bromodomain and WD repeat-containing protein 1	5.01e-02	NA	4.43e-04
3. B	P63247	Receptor of activated protein C kinase 1	1.19e-08	NA	0.018
3. B	P0CS45	Mitochondrial division protein 1	3.51e-03	NA	0.024
3. B	Q54YD8	Coatomer subunit beta'	1.37e-05	NA	3.65e-04
3. B	Q9D7H2	WD repeat-containing protein 5B	5.27e-09	NA	1.08e-08
3. B	O60508	Pre-mRNA-processing factor 17	5.47e-10	NA	0.009
3. B	B4N0L0	Eukaryotic translation initiation factor 3 subunit I	1.23e-09	NA	1.49e-06
3. B	Q8VEJ4	Notchless protein homolog 1	5.91e-05	NA	0.002
3. B	Q4X0A9	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.13e-04	NA	0.009
3. B	O75529	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	1.36e-06	NA	3.23e-04
3. B	Q27954	Coatomer subunit alpha	4.16e-05	NA	0.001
3. B	Q8WWQ0	PH-interacting protein	6.43e-03	NA	0.001
3. B	Q5IS43	Platelet-activating factor acetylhydrolase IB subunit alpha	7.66e-09	NA	7.07e-07
3. B	Q16K15	Eukaryotic translation initiation factor 3 subunit I	1.82e-09	NA	6.10e-05
3. B	Q7KNS3	Lissencephaly-1 homolog	4.39e-09	NA	1.71e-04
3. B	C3XVT5	Lissencephaly-1 homolog	4.81e-09	NA	2.47e-05
3. B	Q9NVX2	Notchless protein homolog 1	3.43e-05	NA	5.25e-05
3. B	Q9V3J8	Protein will die slowly	1.04e-08	NA	1.53e-06
3. B	Q96DI7	U5 small nuclear ribonucleoprotein 40 kDa protein	2.18e-08	NA	6.37e-10
3. B	F4KB17	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3	7.78e-05	NA	2.23e-07
3. B	B8M7Q5	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.72e-03	NA	0.004
3. B	A7MB12	U3 small nucleolar RNA-associated protein 15 homolog	8.64e-07	NA	8.56e-04
3. B	Q6FLI3	CCR4-associated factor 4 homolog	2.39e-07	NA	1.05e-05
3. B	C5GVJ9	Nuclear distribution protein PAC1	4.10e-06	NA	0.015
3. B	A1CBP8	Mitochondrial division protein 1	1.70e-04	NA	0.020
3. B	F4IIK6	Non-functional target of rapamycin complex subunit LST8-2	2.48e-09	NA	4.14e-04
3. B	O18640	Guanine nucleotide-binding protein subunit beta-like protein	1.77e-09	NA	1.04e-04
3. B	Q6CG48	Nuclear distribution protein PAC1	1.21e-11	NA	0.005
3. B	A4RJV3	Mitochondrial division protein 1	2.55e-04	NA	1.23e-04
3. B	Q29L19	Eukaryotic translation initiation factor 3 subunit I	1.10e-09	NA	7.46e-06
3. B	Q5R8K2	Cleavage stimulation factor subunit 1	2.87e-08	NA	0.035
3. B	C4JPW9	Nuclear distribution protein PAC1-2	1.04e-07	NA	0.003
3. B	Q0P593	Dynein assembly factor with WDR repeat domains 1	1.54e-08	NA	9.15e-08
3. B	Q8VYZ5	Periodic tryptophan protein 2	6.57e-07	NA	6.97e-05
3. B	P62884	Guanine nucleotide-binding protein subunit beta-like protein	1.44e-08	NA	0.011
3. B	P54686	Actin-interacting protein 1	2.31e-07	NA	0.044
3. B	A8NEG8	Nuclear distribution protein PAC1	1.26e-12	NA	3.58e-05
3. B	Q6S7B0	Transcription initiation factor TFIID subunit 5	2.34e-06	NA	0.003
3. B	C4Q0P6	Lissencephaly-1 homolog	1.23e-09	NA	5.00e-06
3. B	P58405	Striatin-3	1.62e-06	NA	1.48e-05
3. B	A1CF18	Nuclear distribution protein nudF 2	5.22e-08	NA	2.32e-04
3. B	Q08706	Guanine nucleotide-binding protein subunit beta	1.74e-07	NA	5.59e-08
3. B	U4PCM1	pre-mRNA 3' end processing protein pfs-2	1.49e-02	NA	0.003
3. B	Q6BU94	Pre-mRNA-splicing factor PRP46	5.01e-09	NA	4.83e-06
3. B	Q5M786	WD repeat-containing protein 5	5.94e-09	NA	4.96e-05
3. B	Q5TTP0	WD repeat-containing protein on Y chromosome	8.33e-05	NA	2.91e-33
3. B	B6QC06	Nuclear distribution protein nudF 2	4.75e-06	NA	0.001
3. B	Q54KL5	WD repeat-containing protein 5 homolog	1.81e-09	NA	9.90e-07
3. B	B4NW98	Eukaryotic translation initiation factor 3 subunit I	1.25e-09	NA	4.30e-07
3. B	Q2UFN8	Probable E3 ubiquitin ligase complex SCF subunit sconB	5.58e-03	NA	3.36e-07
3. B	Q58D20	Notchless protein homolog 1	2.86e-05	NA	1.14e-04
3. B	O24467	LEC14B homolog	2.78e-04	NA	0.014
3. B	Q9ERG2	Striatin-3	2.21e-05	NA	1.10e-05
3. B	O88342	WD repeat-containing protein 1	4.71e-07	NA	2.90e-05
3. B	Q0CY32	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.54e-04	NA	8.52e-08
3. B	Q8C092	Transcription initiation factor TFIID subunit 5	1.13e-05	NA	3.46e-09
3. B	Q922V4	Pleiotropic regulator 1	1.99e-06	NA	1.31e-06
3. B	Q10282	Guanine nucleotide-binding protein subunit beta	4.15e-09	NA	0.002
3. B	Q10281	Guanine nucleotide-binding protein subunit beta-like protein	1.70e-08	NA	1.92e-04
3. B	P49177	Guanine nucleotide-binding protein subunit beta	1.58e-08	NA	3.86e-05
3. B	Q9FLX9	Notchless protein homolog	1.83e-06	NA	0.032
3. B	P53699	Cell division control protein 4	9.02e-07	NA	0.001
3. B	Q19124	Autophagic-related protein 16.1	1.34e-05	NA	5.06e-04
3. B	Q5ZIU8	Katanin p80 WD40 repeat-containing subunit B1	2.61e-04	NA	2.64e-09
3. B	Q75LV5	U3 snoRNP-associated protein-like YAOH	9.04e-06	NA	4.93e-05
3. B	F4HTH8	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2	1.72e-03	NA	2.07e-05
3. B	P93339	Guanine nucleotide-binding protein subunit beta	NA	NA	0.039
3. B	O76734	General transcriptional corepressor tupA	2.24e-07	NA	0.031
3. B	Q93847	WD repeat-containing protein wdr-5.2	1.25e-08	NA	1.94e-04
3. B	Q7T394	Lissencephaly-1 homolog A	6.44e-09	NA	2.11e-06
3. B	Q7ZXK9	Notchless protein homolog 1	4.59e-05	NA	0.003
3. B	Q2TAY7	WD40 repeat-containing protein SMU1	8.91e-08	NA	1.76e-04
3. B	P0CS44	Mitochondrial division protein 1	9.18e-04	NA	0.024
3. B	P83774	Guanine nucleotide-binding protein subunit beta-like protein	2.32e-06	NA	1.47e-04
3. B	P26308	Guanine nucleotide-binding protein subunit beta-1	1.73e-07	NA	9.90e-05
3. B	D3Z902	F-box/WD repeat-containing protein 7	7.87e-07	NA	4.05e-08
3. B	O94620	Pre-mRNA-splicing factor cwf17	8.52e-09	NA	0.001
3. B	Q9NDC9	Lissencephaly-1 homolog	4.01e-09	NA	0.009
3. B	O08653	Telomerase protein component 1	2.40e-03	NA	0.029
3. B	Q1LV15	Dynein assembly factor with WDR repeat domains 1	1.88e-08	NA	3.59e-04
3. B	Q9T014	Protein SPA1-RELATED 2	2.10e-04	NA	0.008
3. B	Q6FXI8	Histone acetyltransferase type B subunit 2	2.18e-07	NA	0.042
3. B	A7TNS8	CCR4-associated factor 4 homolog	2.70e-05	NA	4.75e-04
3. B	Q61011	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	1.91e-07	NA	5.00e-06
3. B	Q5RDY7	Guanine nucleotide-binding protein subunit beta-5	2.63e-08	NA	7.00e-04
3. B	B5X3Z6	Lissencephaly-1 homolog A	6.18e-09	NA	2.94e-06
3. B	Q39836	Guanine nucleotide-binding protein subunit beta-like protein	3.63e-06	NA	0.002
3. B	Q9LV27	Target of rapamycin complex subunit LST8-1	5.66e-10	NA	3.87e-04
3. B	Q7RY30	Nuclear distribution protein nudF-2	1.32e-05	NA	0.002
3. B	Q9FND4	WD repeat-containing protein WDS homolog	2.80e-05	NA	0.015
3. B	Q86VZ2	WD repeat-containing protein 5B	4.81e-09	NA	3.04e-08
3. B	B4MY65	Lissencephaly-1 homolog	5.84e-09	NA	3.31e-04
3. B	D4AM37	Probable E3 ubiquitin ligase complex SCF subunit sconB	4.06e-04	NA	8.34e-04
3. B	Q5REG7	Platelet-activating factor acetylhydrolase IB subunit alpha	4.22e-09	NA	3.30e-07
3. B	P90794	DDB1- and CUL4-associated factor 11 homolog	3.25e-04	NA	0.014
3. B	Q6PBY0	Guanine nucleotide-binding protein subunit beta-5b	2.06e-07	NA	0.001
3. B	A9V790	Lissencephaly-1 homolog	5.55e-09	NA	5.23e-05
3. B	Q5FWQ6	Dynein assembly factor with WDR repeat domains 1	1.69e-08	NA	1.96e-05
3. B	O55106	Striatin	1.86e-09	NA	0.001
3. B	C5JD40	Nuclear distribution protein PAC1	1.24e-05	NA	0.015
3. B	Q91WM3	U3 small nucleolar RNA-interacting protein 2	4.20e-08	NA	4.16e-04
3. B	P49027	Guanine nucleotide-binding protein subunit beta-like protein A	2.43e-07	NA	0.009
3. B	B4Q354	Eukaryotic translation initiation factor 3 subunit I	9.18e-10	NA	3.02e-07
3. B	P52287	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	1.87e-07	NA	2.10e-06
3. B	Q8VDD9	PH-interacting protein	3.36e-02	NA	0.001
3. B	C4JZS6	Nuclear distribution protein PAC1-1	1.66e-04	NA	0.001
3. B	P46680	Actin-interacting protein 1	1.12e-05	NA	0.005
3. B	B4GAJ1	Lissencephaly-1 homolog	4.42e-09	NA	4.91e-04
3. B	Q5REE0	U3 small nucleolar RNA-associated protein 15 homolog	1.19e-05	NA	0.013
3. B	P87053	F-box/WD repeat-containing protein pof1	1.77e-04	NA	7.39e-10
3. B	Q54JS5	GATOR complex protein WDR24	1.53e-03	NA	3.37e-04
3. B	Q4WT34	Pre-mRNA-splicing factor prp46	1.05e-06	NA	0.002
3. B	Q39336	Guanine nucleotide-binding protein subunit beta-like protein	3.34e-06	NA	0.006
3. B	Q9SYX2	Protein SUPPRESSOR OF PHYA-105 1	8.87e-05	NA	0.009
3. B	Q969H0	F-box/WD repeat-containing protein 7	1.04e-06	NA	4.79e-08
3. B	A7S338	Lissencephaly-1 homolog	4.43e-09	NA	2.56e-05
3. B	Q20636	Guanine nucleotide-binding protein subunit beta-2	3.38e-07	NA	9.90e-05
3. B	Q2HJH6	U5 small nuclear ribonucleoprotein 40 kDa protein	1.97e-08	NA	5.40e-10
3. B	A0A2R8QFQ6	F-box and WD repeat domain-containing 11-A	6.76e-06	NA	0.005
3. B	Q9GL51	Platelet-activating factor acetylhydrolase IB subunit alpha	4.56e-06	NA	2.26e-07
3. B	B8NGT5	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.39e-03	NA	3.73e-07
3. B	Q40687	Guanine nucleotide-binding protein subunit beta	1.42e-07	NA	0.009
3. B	Q9UTN4	Polyadenylation factor subunit 2	1.32e-07	NA	0.009
3. B	Q5BK30	Dynein assembly factor with WDR repeat domains 1	1.70e-08	NA	1.24e-04
3. B	Q9I9H8	Apoptotic protease-activating factor 1	7.60e-06	NA	0.014
3. B	P38129	Transcription initiation factor TFIID subunit 5	3.31e-04	NA	3.39e-04
3. B	Q6GPP0	WD repeat-containing protein 70	5.16e-04	NA	0.005
3. B	P23232	Guanine nucleotide-binding protein subunit beta	1.76e-07	NA	3.47e-07
3. B	C6HTE8	Nuclear distribution protein PAC1	6.64e-06	NA	1.03e-06
3. B	Q8W117	Suppressor of mec-8 and unc-52 protein homolog 1	7.41e-08	NA	0.017
3. B	Q8N1V2	Cilia- and flagella-associated protein 52	4.00e-12	NA	0.006
3. B	P0CY34	Transcriptional repressor TUP1	1.01e-07	NA	4.05e-04
3. B	B0XTS1	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.07e-04	NA	0.009
3. B	P61964	WD repeat-containing protein 5	5.94e-09	NA	5.00e-05
3. B	Q54R82	Mitogen-activated protein kinase kinase kinase A	2.69e-05	NA	2.07e-04
3. B	O14170	WD repeat-containing protein pop2	1.07e-05	NA	0.029
3. B	P36408	Guanine nucleotide-binding protein subunit beta	5.95e-09	NA	8.35e-05
3. B	Q5A7Q3	Pre-mRNA-splicing factor PRP46	3.41e-08	NA	0.015
3. B	P0CS42	Nuclear distribution protein PAC1	1.35e-05	NA	1.54e-07
3. B	B3MVL6	Eukaryotic translation initiation factor 3 subunit I	1.62e-09	NA	1.53e-06
3. B	Q95JL5	Cilia- and flagella-associated protein 52	4.12e-08	NA	0.005
3. B	A6RUL1	Eukaryotic translation initiation factor 3 subunit I	2.70e-09	NA	0.015
3. B	Q8TDJ6	DmX-like protein 2	NA	NA	0.022
3. B	P90648	Myosin heavy chain kinase B	1.56e-06	NA	0.026
3. B	Q5F201	Cilia- and flagella-associated protein 52	4.60e-12	NA	0.011
3. B	Q54ZP5	WD repeat-containing protein 48 homolog	1.13e-01	NA	0.001
3. B	Q9DAJ4	WD repeat domain-containing protein 83	5.80e-09	NA	0.002
3. B	A0A1P8AW69	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1	2.28e-03	NA	3.77e-07
3. B	Q4R7Y4	Guanine nucleotide-binding protein subunit beta-2-like 1	3.03e-09	NA	0.018
3. B	P93471	E3 ubiquitin-protein ligase COP1	5.17e-05	NA	0.003
3. B	B4F7L9	WD repeat-containing protein on Y chromosome	1.87e-07	NA	5.96e-38
3. B	Q803D2	Lissencephaly-1 homolog B	6.30e-09	NA	1.40e-06
3. B	A5D7H2	Striatin-3	2.10e-05	NA	6.45e-06
3. B	A7THX0	Mitochondrial division protein 1	3.50e-06	NA	6.31e-04
3. B	B7FF06	WD repeat-containing protein on Y chromosome	3.08e-08	NA	1.20e-41
3. B	A6H603	NACHT domain- and WD repeat-containing protein 1	3.31e-04	NA	1.75e-06
3. B	A6ZQL5	Mitochondrial division protein 1	8.49e-06	NA	0.009
3. B	O24076	Guanine nucleotide-binding protein subunit beta-like protein	3.58e-06	NA	0.006
3. B	P49695	Probable serine/threonine-protein kinase PkwA	1.44e-07	NA	2.09e-05
3. B	O74319	Transcription initiation factor TFIID subunit taf73	2.06e-06	NA	1.02e-04
3. B	B4LUA5	Eukaryotic translation initiation factor 3 subunit I	1.40e-09	NA	5.52e-07
3. B	Q3ULA2	F-box/WD repeat-containing protein 1A	1.09e-05	NA	8.92e-06
3. B	P17343	Guanine nucleotide-binding protein subunit beta-1	1.83e-07	NA	2.36e-07
3. B	Q4R8E7	Dynein assembly factor with WDR repeat domains 1	1.64e-08	NA	3.61e-06
3. B	Q39190	Protein pleiotropic regulator PRL2	1.25e-06	NA	5.93e-05
3. B	P61965	WD repeat-containing protein 5	5.96e-09	NA	5.00e-05
3. B	Q93134	Guanine nucleotide-binding protein subunit beta-2-like 1	1.14e-08	NA	1.35e-04
3. B	Q8I0F4	Lissencephaly-1 homolog	1.65e-07	NA	3.23e-04
3. B	A7RM20	Eukaryotic translation initiation factor 3 subunit I	1.63e-09	NA	0.002
3. B	P73594	WD repeat-containing protein slr1409	3.90e-09	NA	0.013
3. B	P49178	Guanine nucleotide-binding protein subunit beta	1.15e-07	NA	2.69e-04
3. B	Q76B40	WD40 repeat-containing protein SMU1	9.53e-08	NA	1.76e-04
3. B	P43033	Platelet-activating factor acetylhydrolase IB subunit beta	5.51e-09	NA	2.89e-07
3. B	Q6FJS0	Polyadenylation factor subunit 2	1.07e-05	NA	0.035
3. B	Q00808	Vegetative incompatibility protein HET-E-1	3.04e-06	NA	4.63e-10
3. B	Q9VZF4	F-box/WD repeat-containing protein 7	1.05e-04	NA	4.81e-08
3. B	P63246	Receptor of activated protein C kinase 1	1.23e-08	NA	0.018
3. B	A0AUS0	WD repeat, SAM and U-box domain-containing protein 1	1.03e-04	NA	0.003
3. B	A2AHJ4	Bromodomain and WD repeat-containing protein 3	2.23e-02	NA	0.001
3. B	B7FNU7	Lissencephaly-1 homolog	1.75e-08	NA	2.50e-04
3. B	C0S902	Nuclear distribution protein PAC1	1.02e-04	NA	2.56e-05
3. B	B5DHW4	WD repeat-containing protein on Y chromosome	2.87e-05	NA	5.87e-38
3. B	Q8N136	Dynein assembly factor with WDR repeat domains 1	1.71e-08	NA	4.50e-07
3. B	Q8H0T9	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4	3.32e-05	NA	2.07e-07
3. B	B6QC56	Nuclear distribution protein nudF 1	1.69e-05	NA	3.81e-06
3. B	O75083	WD repeat-containing protein 1	1.46e-06	NA	6.50e-05
3. B	Q4V7Y7	Katanin p80 WD40 repeat-containing subunit B1	5.10e-04	NA	4.56e-08
3. B	P0CS43	Nuclear distribution protein PAC1	1.37e-05	NA	1.54e-07
3. B	A8XZJ9	Lissencephaly-1 homolog	3.47e-13	NA	6.32e-07
3. B	A8XEN7	DDB1- and CUL4-associated factor 11 homolog	1.41e-03	NA	0.010
3. B	B6GZD3	Nuclear distribution protein nudF 2	6.41e-06	NA	0.046
3. B	Q8N0X2	Sperm-associated antigen 16 protein	1.87e-07	NA	0.001
3. B	Q5GIS3	Guanine nucleotide-binding protein subunit beta	1.78e-07	NA	1.85e-08
3. B	D3BUN1	Lissencephaly-1 homolog	1.87e-08	NA	8.14e-04
3. B	Q61ZF6	Guanine nucleotide-binding protein subunit beta-1	1.80e-07	NA	2.36e-07
3. B	A8IZG4	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	2.36e-08	NA	2.43e-05
3. B	Q7ZVA0	WD40 repeat-containing protein SMU1	7.23e-08	NA	0.001
3. B	Q8K450	Sperm-associated antigen 16 protein	1.19e-07	NA	0.002
3. B	Q9M0V4	U3 snoRNP-associated protein-like YAO	1.92e-07	NA	6.44e-05
3. B	Q54H44	WD repeat domain-containing protein 83 homolog	9.36e-08	NA	0.028
3. B	Q0D0X6	Nuclear distribution protein nudF	1.46e-05	NA	0.026
3. B	P70483	Striatin	1.54e-05	NA	0.001
3. B	Q54SA5	WD repeat-containing protein 55 homolog	6.51e-06	NA	0.025
3. B	Q6DIF4	WD repeat-containing protein 1	4.67e-07	NA	9.13e-07
3. B	O02195	Eukaryotic translation initiation factor 3 subunit I	8.10e-10	NA	2.91e-07
3. B	B0XFT7	Eukaryotic translation initiation factor 3 subunit I	1.47e-09	NA	3.41e-04
3. B	A7EKM8	Nuclear distribution protein PAC1	5.08e-06	NA	0.001
3. B	B7FF08	WD repeat-containing protein on Y chromosome	3.40e-07	NA	4.06e-39
3. B	Q15542	Transcription initiation factor TFIID subunit 5	1.10e-05	NA	1.42e-08
3. B	Q01369	Guanine nucleotide-binding protein subunit beta-like protein	3.03e-06	NA	9.54e-05
3. B	Q5RFF8	Notchless protein homolog 1	2.30e-05	NA	4.19e-05
3. B	P46800	Guanine nucleotide-binding protein subunit beta-like protein	3.39e-07	NA	4.32e-06
3. B	G5EES6	Ubiquitin fusion degradation protein 3 homolog	7.35e-03	NA	0.038
3. B	Q291L9	Lissencephaly-1 homolog	4.10e-09	NA	4.91e-04
3. B	Q9UKB1	F-box/WD repeat-containing protein 11	4.67e-06	NA	9.56e-05
3. B	Q96WV5	Putative coatomer subunit alpha	5.36e-05	NA	1.63e-04
3. B	O14775	Guanine nucleotide-binding protein subunit beta-5	5.22e-08	NA	4.18e-04
3. B	P87314	Protein hir1	3.53e-05	NA	0.030
3. B	Q8BPN8	DmX-like protein 2	NA	NA	0.009
3. B	Q5BLX8	WD repeat domain-containing protein 83	8.13e-09	NA	0.004
3. B	Q5RF51	U5 small nuclear ribonucleoprotein 40 kDa protein	1.74e-08	NA	3.74e-09
3. B	Q3Y8L7	Dynein assembly factor with WDR repeat domains 1	6.65e-07	NA	2.63e-06
3. B	Q5F3D7	U3 small nucleolar RNA-associated protein 15 homolog	5.63e-07	NA	2.97e-04
3. B	B7FF12	WD repeat-containing protein on Y chromosome	2.14e-07	NA	9.13e-39
3. B	Q3MKM6	U3 snoRNP-associated protein-like EMB2271	1.86e-07	NA	2.91e-06
3. B	P63004	Platelet-activating factor acetylhydrolase IB subunit alpha	6.38e-09	NA	2.67e-07
3. B	B8AP31	Guanine nucleotide-binding protein subunit beta	1.29e-07	NA	0.009
3. B	Q6PNB6	Guanine nucleotide-binding protein subunit beta-5	1.22e-07	NA	7.77e-04
3. B	O42248	Guanine nucleotide-binding protein subunit beta-2-like 1	1.20e-08	NA	0.004
3. B	Q5AXW3	Mitochondrial division protein 1	5.58e-04	NA	0.003
3. B	Q2GT28	Nuclear distribution protein PAC1-2	1.61e-07	NA	2.01e-05
3. B	Q8MY12	Myosin heavy chain kinase C	1.37e-05	NA	0.025
3. B	A7EF03	Eukaryotic translation initiation factor 3 subunit I	2.73e-09	NA	0.016
3. B	Q5XGI5	WD repeat domain-containing protein 83	5.31e-09	NA	3.80e-04
3. B	Q2KIG2	WD repeat-containing protein 5	5.84e-09	NA	5.42e-05
3. B	A1C7E4	Probable E3 ubiquitin ligase complex SCF subunit sconB	9.02e-04	NA	2.63e-07
3. B	P97499	Telomerase protein component 1	7.09e-03	NA	0.028
3. B	Q2HJ56	Periodic tryptophan protein 1 homolog	1.80e-05	NA	0.043
3. B	Q09990	F-box/WD repeat-containing protein lin-23	1.89e-05	NA	9.31e-08
3. B	P62880	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	1.89e-07	NA	4.36e-07
3. B	Q9LV28	Receptor for activated C kinase 1C	3.78e-06	NA	3.05e-04
3. B	O43017	Set1 complex component swd3	5.10e-08	NA	1.14e-04
3. B	Q3MV14	Protein DECREASED SIZE EXCLUSION LIMIT 1	4.56e-06	NA	0.029
3. B	Q3UKJ7	WD40 repeat-containing protein SMU1	7.87e-08	NA	1.76e-04
3. B	B5X3C4	Lissencephaly-1 homolog B	4.08e-09	NA	1.00e-06
3. B	B6Q4Z5	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.05e-04	NA	1.16e-06
3. B	D4D8P3	Probable E3 ubiquitin ligase complex SCF subunit sconB	6.44e-04	NA	7.59e-04
3. B	Q6NRT3	WD40 repeat-containing protein SMU1	9.41e-08	NA	3.19e-04
3. B	Q9Y297	F-box/WD repeat-containing protein 1A	8.66e-06	NA	6.50e-04
3. B	O43818	U3 small nucleolar RNA-interacting protein 2	4.93e-08	NA	1.98e-04
3. B	B8M0Q1	Nuclear distribution protein nudF	1.72e-05	NA	5.63e-06
3. B	Q38884	Eukaryotic translation initiation factor 3 subunit I	1.64e-09	NA	5.21e-04
3. B	Q25189	Guanine nucleotide-binding protein subunit beta-like protein	9.41e-09	NA	0.005
3. B	A2QCU8	Probable E3 ubiquitin ligase complex SCF subunit sconB	2.67e-04	NA	1.91e-07
3. B	Q9C4Z6	Receptor for activated C kinase 1B	3.79e-06	NA	0.002
3. B	Q6L4F8	Guanine nucleotide-binding protein subunit beta-like protein B	2.17e-07	NA	7.21e-04
3. B	Q54D08	Protein LST8 homolog	1.65e-09	NA	0.007
3. B	Q229Z6	POC1 centriolar protein homolog	2.46e-05	NA	0.003
3. B	C1GB49	Nuclear distribution protein PAC1	2.57e-05	NA	1.49e-05
3. B	Q9SJT9	Coatomer subunit alpha-2	5.66e-05	NA	0.008
3. B	C5PFX0	Nuclear distribution protein PAC1	7.25e-06	NA	3.20e-05
3. B	Q2KID6	Pleiotropic regulator 1	1.89e-06	NA	2.02e-04
3. B	O14435	Guanine nucleotide-binding protein subunit beta	1.65e-08	NA	0.005
3. B	Q99M63	WD40 repeat-containing protein SMU1	8.95e-08	NA	1.73e-04
3. B	P38123	COMPASS component SWD3	9.49e-12	NA	0.003
3. B	Q6NX08	Ribosome biogenesis protein wdr12	4.64e-08	NA	0.031
3. B	Q9BVA0	Katanin p80 WD40 repeat-containing subunit B1	1.74e-04	NA	6.29e-09
3. B	Q80ZD0	Guanine nucleotide-binding protein subunit beta-5	2.65e-08	NA	7.98e-04
3. B	O13282	Transcription initiation factor TFIID subunit 5	2.91e-03	NA	4.50e-06
3. B	O43660	Pleiotropic regulator 1	1.91e-06	NA	7.17e-05
3. B	B4P6P9	Lissencephaly-1 homolog	5.68e-09	NA	2.00e-04
3. B	B3S4I5	Lissencephaly-1 homolog	6.70e-07	NA	2.20e-04
3. B	Q4P9P9	Nuclear distribution protein PAC1	1.29e-11	NA	9.37e-07
3. B	P25387	Guanine nucleotide-binding protein subunit beta-like protein	6.18e-09	NA	3.93e-04
3. B	P79147	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	1.89e-07	NA	3.90e-06
3. B	B4LQ21	Lissencephaly-1 homolog	4.02e-09	NA	3.99e-04
3. B	B6GZA1	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.34e-03	NA	0.005
3. B	Q8NA23	WD repeat-containing protein 31	8.01e-09	NA	0.035
3. B	E9Q2M9	WD repeat- and FYVE domain-containing protein 4	NA	NA	1.24e-04
3. B	Q9UUG8	Transcriptional repressor tup12	2.39e-07	NA	0.039
3. B	Q2UGU1	Nuclear distribution protein nudF	5.52e-06	NA	6.48e-06
3. B	Q25306	Guanine nucleotide-binding protein subunit beta-like protein	1.49e-08	NA	0.029
3. B	P53621	Coatomer subunit alpha	4.52e-05	NA	5.86e-04
3. B	Q9UKT8	F-box/WD repeat-containing protein 2	1.22e-05	NA	0.008
3. B	Q91854	Beta-TrCP	3.38e-07	NA	2.96e-04
3. B	B4GQJ7	WD repeat-containing protein on Y chromosome	1.03e-04	NA	2.58e-40
3. B	P0CS33	Eukaryotic translation initiation factor 3 subunit I	8.61e-09	NA	6.68e-05
3. B	Q6P4J8	WD40 repeat-containing protein SMU1	7.90e-08	NA	2.75e-04
3. B	Q6PAX7	WD repeat-containing protein 1-B	4.74e-07	NA	3.30e-05
3. B	Q74ZN0	Protein HIR1	1.98e-05	NA	0.028
3. B	Q9Y2I8	WD repeat-containing protein 37	2.00e-05	NA	0.005
3. B	Q9M2Z2	COMPASS-like H3K4 histone methylase component WDR5A	3.85e-09	NA	1.70e-04
3. B	Q9AYE4	Target of rapamycin complex subunit LST8	3.18e-08	NA	0.003
3. B	B4HSL3	Lissencephaly-1 homolog	3.86e-09	NA	1.71e-04
3. B	P63005	Platelet-activating factor acetylhydrolase IB subunit beta	5.07e-09	NA	2.67e-07
3. B	Q292E8	Probable cytosolic iron-sulfur protein assembly protein Ciao1	1.25e-08	NA	0.014
3. B	P63243	Receptor of activated protein C kinase 1	1.23e-08	NA	0.018
3. B	Q09855	F-box/WD repeat-containing protein pof11	8.99e-08	NA	1.57e-05
3. B	B4I195	Eukaryotic translation initiation factor 3 subunit I	8.21e-10	NA	2.91e-07
3. B	Q5E966	Eukaryotic translation initiation factor 3 subunit I	1.60e-09	NA	0.012
3. B	P42841	Polyadenylation factor subunit 2	3.44e-05	NA	0.008
3. B	Q8CIE6	Coatomer subunit alpha	5.66e-05	NA	8.96e-04
3. B	Q00659	Probable E3 ubiquitin ligase complex SCF subunit sconB	2.89e-04	NA	7.71e-06
3. B	Q3KQ62	WD repeat domain-containing protein 83	6.36e-09	NA	6.12e-05
3. B	D1ZEB4	Nuclear distribution protein PAC1-1	2.03e-05	NA	0.006
3. B	Q6NVM2	Katanin p80 WD40 repeat-containing subunit B1	6.17e-06	NA	3.35e-08
3. B	B8N9H4	Nuclear distribution protein nudF	6.03e-06	NA	6.48e-06
3. B	Q5JTN6	WD repeat-containing protein 38	3.72e-08	NA	1.88e-05
3. B	P62879	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	1.90e-07	NA	4.36e-07
3. B	Q55563	Uncharacterized WD repeat-containing protein sll0163	3.85e-04	NA	7.07e-06
3. B	Q2H139	Mitochondrial division protein 1	3.19e-03	NA	1.73e-05
3. B	O42249	Guanine nucleotide-binding protein subunit beta-2-like 1	1.16e-08	NA	0.002
3. B	A2QEV8	Eukaryotic translation initiation factor 3 subunit I	2.52e-09	NA	0.029
3. B	O62471	Protein qui-1	3.21e-04	NA	0.005
3. B	P68040	Receptor of activated protein C kinase 1	1.18e-08	NA	0.018
3. B	D3TLL6	Lissencephaly-1 homolog	5.79e-09	NA	4.72e-05
3. B	A8ILK1	Cilia- and flagella-associated protein 52	5.84e-11	NA	2.42e-04
3. B	Q9WUC8	Pleiotropic regulator 1	2.17e-06	NA	1.19e-05
3. B	Q5RKI0	WD repeat-containing protein 1	3.99e-07	NA	4.65e-05
3. B	O61585	Katanin p80 WD40 repeat-containing subunit B1	1.01e-04	NA	2.61e-04
3. B	Q5ZME8	WD40 repeat-containing protein SMU1	8.55e-08	NA	3.44e-04
3. B	Q6PH57	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.98e-07	NA	3.71e-07
3. B	P20053	U4/U6 small nuclear ribonucleoprotein PRP4	1.09e-11	NA	0.003
3. B	Q5RE95	WD repeat-containing protein 5B	2.39e-09	NA	5.40e-08
3. B	Q5SRY7	F-box/WD repeat-containing protein 11	5.42e-06	NA	7.70e-05
3. B	Q4V8C4	WD repeat-containing protein 5B	5.41e-09	NA	1.38e-09
3. B	B3N4C7	Eukaryotic translation initiation factor 3 subunit I	1.71e-09	NA	2.69e-07
3. B	Q9VPR4	Protein Notchless	3.85e-05	NA	0.010
3. B	Q17N69	Lissencephaly-1 homolog	5.74e-09	NA	1.53e-05
3. B	B7PS00	Lissencephaly-1 homolog	2.12e-06	NA	1.82e-04
3. B	Q7ZUV2	Katanin p80 WD40 repeat-containing subunit B1	2.56e-04	NA	2.70e-12
3. B	Q6C709	Pre-mRNA-splicing factor PRP46	6.29e-07	NA	6.98e-04
3. B	Q8C7V3	U3 small nucleolar RNA-associated protein 15 homolog	9.80e-04	NA	0.004
3. B	Q758R7	Mitochondrial division protein 1	1.56e-05	NA	8.76e-05
3. B	P16520	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	1.89e-07	NA	1.08e-05
3. B	B4JB43	Eukaryotic translation initiation factor 3 subunit I	6.57e-10	NA	4.55e-07
3. B	Q93794	F-box/WD repeat-containing protein sel-10	2.22e-04	NA	2.43e-10
3. B	P43034	Platelet-activating factor acetylhydrolase IB subunit beta	1.95e-08	NA	2.65e-07
3. B	P11017	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	1.91e-07	NA	4.36e-07
3. B	Q6FT96	Mitochondrial division protein 1	6.37e-06	NA	1.64e-06
3. B	Q9FE91	Zinc finger CCCH domain-containing protein 62	7.14e-07	NA	3.19e-05
3. B	A8PTE4	Mitochondrial division protein 1	2.53e-06	NA	4.56e-04
3. B	O15736	Protein tipD	2.03e-06	NA	0.020
3. B	B3MEY6	Lissencephaly-1 homolog	4.41e-09	NA	5.48e-05
3. B	A1DHW6	Probable E3 ubiquitin ligase complex SCF subunit sconB	7.41e-04	NA	0.015
3. B	Q9JJA4	Ribosome biogenesis protein WDR12	1.34e-07	NA	0.021
3. B	Q00664	Nuclear distribution protein nudF	3.52e-06	NA	0.003
3. B	O14727	Apoptotic protease-activating factor 1	2.84e-05	NA	0.040
3. B	Q4RJN5	Lissencephaly-1 homolog	4.50e-09	NA	1.82e-06
3. B	Q0VA16	WD repeat-containing protein 70	2.34e-04	NA	0.033
3. B	O45040	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.99e-07	NA	2.87e-08
3. B	Q2KJH4	WD repeat-containing protein 1	4.09e-07	NA	0.002