Summary

Q8IV50

Homolog: Q9D7V2.
Function: LysM and putative peptidoglycan-binding domain-containing protein 2.

Statistics

Total GO Annotation: 26
Unique PROST Go: 0
Unique BLAST Go: 24

Total Homologs: 37
Unique PROST Homologs: 1
Unique BLAST Homologs: 25

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q9D7V2 (LysM and putative peptidoglycan-binding domain-containing protein 2) with a FATCAT P-Value: 8.96e-08 and RMSD of 2.62 angstrom. The sequence alignment identity is 88.8%.
Structural alignment shown in left. Query protein Q8IV50 colored as red in alignment, homolog Q9D7V2 colored as blue. Query protein Q8IV50 is also shown in right top, homolog Q9D7V2 showed in right bottom. They are colored based on secondary structures. 

  Q8IV50 MADSSPALSLREGGPRAPRPSAPSPPPRSRSGSESEEAELSLSLARTKTRSYGSTASVRAPLGAGVIERHVEHRVRAGDTLQGIALKYGVTMEQIKRANK 100
  Q9D7V2 MADLSPAPALREGGPRAHRPSAPSPPPRSRSTSEPEEAELSLSLARTKTRSYGSTASVRAPLGARVIERHVEHRVRAGDTLQGIALKYGVTMEQIKRANK 100

  Q8IV50 LFTNDCIFLKKTLNIPVISEKPLLFNGLNSIDSPENETADNSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFLQRLDLQIKLSTQAAKKLKEE 200
  Q9D7V2 LFTNDCIFLKKTLSIPILSEKPLLFNGLNSIDSPESETVDSSFCQEEEPVVSEEELPPPSPQDPDPKPAQPEEVSARDFLQRLDLQIKLSTQAARKLKEE 200

  Q8IV50 SRDEESPYATSLYHS 215
  Q9D7V2 SRDEESPYAASLYHS 215

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0007030 Golgi organization
1. PB GO:0005794 Golgi apparatus
3. B GO:0019867 outer membrane
3. B GO:0008152 metabolic process
3. B GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds
3. B GO:0071555 cell wall organization
3. B GO:0004040 amidase activity
3. B GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
3. B GO:0005576 extracellular region
3. B GO:0009253 peptidoglycan catabolic process
3. B GO:0008234 cysteine-type peptidase activity
3. B GO:0016787 hydrolase activity
3. B GO:0030435 sporulation resulting in formation of a cellular spore
3. B GO:0000917 division septum assembly
3. B GO:0008932 lytic endotransglycosylase activity
3. B GO:0016798 hydrolase activity, acting on glycosyl bonds
3. B GO:0003796 lysozyme activity
3. B GO:0051117 ATPase binding
3. B GO:0019835 cytolysis
3. B GO:0042742 defense response to bacterium
3. B GO:0030420 establishment of competence for transformation
3. B GO:0016021 integral component of membrane
3. B GO:0009254 peptidoglycan turnover
3. B GO:0043595 endospore cortex
3. B GO:0005654 nucleoplasm
3. B GO:0061784 peptidoglycan N-acetylglucosaminidase activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6DEF4 LysM and putative peptidoglycan-binding domain-containing protein 2 2.29e-06 8.06e-53 2.17e-61
1. PB Q1JQA8 LysM and putative peptidoglycan-binding domain-containing protein 2 1.05e-07 5.46e-81 3.74e-123
1. PB Q9N012 LysM and putative peptidoglycan-binding domain-containing protein 1 3.44e-04 1.07e-02 4.17e-30
1. PB Q28DG6 LysM and putative peptidoglycan-binding domain-containing protein 3 1.66e-03 3.83e-02 0.002
1. PB Q8IV50 LysM and putative peptidoglycan-binding domain-containing protein 2 0 7.31e-140 1.57e-155
1. PB Q3B7I8 LysM and putative peptidoglycan-binding domain-containing protein 2 1.60e-05 1.89e-44 4.30e-75
1. PB Q3KPL3 LysM and putative peptidoglycan-binding domain-containing protein 2 6.58e-05 7.47e-41 2.06e-69
1. PB Q96S90 LysM and putative peptidoglycan-binding domain-containing protein 1 2.45e-03 1.12e-03 6.86e-31
1. PB Q6P606 LysM and putative peptidoglycan-binding domain-containing protein 4 8.10e-03 3.38e-02 4.60e-04
1. PB Q5PQ30 LysM and putative peptidoglycan-binding domain-containing protein 1 7.75e-04 1.49e-04 5.74e-28
1. PB Q9D7V2 LysM and putative peptidoglycan-binding domain-containing protein 2 8.96e-08 1.44e-100 5.34e-109
2. P P0CY38 Uncharacterized protein AN12072 1.41e-01 7.23e-03 NA
3. B Q7A5Y8 Probable cell wall hydrolase LytN 3.36e-01 NA 0.026
3. B Q5HGI5 Probable cell wall hydrolase LytN 5.85e-02 NA 0.030
3. B A2RHZ5 Probable N-acetylmuramidase 3.79e-01 NA 0.030
3. B P0C2T5 Probable N-acetylmuramidase 1.00e-01 NA 0.030
3. B Q6DCC7 LysM and putative peptidoglycan-binding domain-containing protein 4 6.07e-03 NA 0.002
3. B Q99LE3 LysM and putative peptidoglycan-binding domain-containing protein 3 4.12e-03 NA 0.002
3. B O32062 SpoIVD-associated factor A 1.55e-01 NA 0.032
3. B P37710 Autolysin 6.54e-01 NA 0.018
3. B Q6G9W6 Probable cell wall hydrolase LytN 2.72e-02 NA 0.028
3. B Q5ZKK0 LysM and putative peptidoglycan-binding domain-containing protein 3 3.94e-03 NA 0.007
3. B Q6GHI8 Probable cell wall hydrolase LytN 1.47e-01 NA 0.026
3. B P39800 N-acetylmuramoyl-L-alanine amidase XlyA 2.26e-01 NA 0.045
3. B O34669 Cell wall-binding protein YocH 1.29e-01 NA 0.030
3. B Q9ZNI1 Probable cell wall hydrolase LytN 4.40e-02 NA 0.029
3. B Q6IQA2 LysM and putative peptidoglycan-binding domain-containing protein 3 8.03e-03 NA 3.34e-04
3. B Q7A123 Probable cell wall hydrolase LytN 1.07e-01 NA 0.028
3. B Q7Z3D4 LysM and putative peptidoglycan-binding domain-containing protein 3 1.59e-02 NA 6.76e-04
3. B Q5M836 LysM and putative peptidoglycan-binding domain-containing protein 3 6.70e-03 NA 0.002
3. B A0JNI1 LysM and putative peptidoglycan-binding domain-containing protein 1 1.96e-03 NA 2.12e-30
3. B Q01838 Probable endopeptidase p60 1.44e-01 NA 0.026
3. B Q99UM3 Probable cell wall hydrolase LytN 8.33e-02 NA 0.026
3. B Q9D0E3 LysM and putative peptidoglycan-binding domain-containing protein 1 4.63e-04 NA 1.22e-29
3. B Q9FZ32 F-box protein At1g55000 1.03e-01 NA 3.67e-04
3. B Q9CIT4 Probable N-acetylmuramidase 9.85e-02 NA 0.031
3. B Q5HZA4 LysM and putative peptidoglycan-binding domain-containing protein 1 3.07e-04 NA 1.17e-29