Summary

Q8IW50

Homolog: Q6DC60.
Function: Protein FAM219A.

Statistics

Total GO Annotation: 57
Unique PROST Go: 57
Unique BLAST Go: 0

Total Homologs: 30
Unique PROST Homologs: 24
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q6DC60 (Protein FAM219A) with a FATCAT P-Value: 3.39e-11 and RMSD of 2.81 angstrom. The sequence alignment identity is 87.1%.
Structural alignment shown in left. Query protein Q8IW50 colored as red in alignment, homolog Q6DC60 colored as blue. Query protein Q8IW50 is also shown in right top, homolog Q6DC60 showed in right bottom. They are colored based on secondary structures. 

  Q8IW50 MMEEIDRFQVPTAHSEMQPL-DPAAASISDGDCDAREGESVAMNYKPSPLQVKLEKQRELARKGSLKNGSMGSPVNQQPKKNNVMARTRLVVPNKGYSSL 99
  Q6DC60 MMEEIDRFQVPPVNPEMKLLQDPAETSTIENETAPREPESVAINYKPSPLQVKIEKQRELARKGSVKNGTVGSPVNQQPKKNNVMARTRLVVPNKGYSSL 100

  Q8IW50 DQSPDEKPLVALDTDSDDDFDMSRYSSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCCQATSSTACHIQ 185
  Q6DC60 DQSPDEKPLVALDTDSDDDFDMSRYSSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCCQATSSTACQIQ 186

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0070410 co-SMAD binding
2. P GO:0042438 melanin biosynthetic process
2. P GO:0071105 response to interleukin-11
2. P GO:0043473 pigmentation
2. P GO:0001570 vasculogenesis
2. P GO:0070670 response to interleukin-4
2. P GO:0030511 positive regulation of transforming growth factor beta receptor signaling pathway
2. P GO:0051301 cell division
2. P GO:0060711 labyrinthine layer development
2. P GO:0017124 SH3 domain binding
2. P GO:0009639 response to red or far red light
2. P GO:0009646 response to absence of light
2. P GO:0070555 response to interleukin-1
2. P GO:0030318 melanocyte differentiation
2. P GO:0030178 negative regulation of Wnt signaling pathway
2. P GO:0070741 response to interleukin-6
2. P GO:0051591 response to cAMP
2. P GO:0004869 cysteine-type endopeptidase inhibitor activity
2. P GO:1902462 positive regulation of mesenchymal stem cell proliferation
2. P GO:0000578 embryonic axis specification
2. P GO:0070669 response to interleukin-2
2. P GO:0045668 negative regulation of osteoblast differentiation
2. P GO:0007179 transforming growth factor beta receptor signaling pathway
2. P GO:0034341 response to interferon-gamma
2. P GO:0006281 DNA repair
2. P GO:0003713 transcription coactivator activity
2. P GO:0060231 mesenchymal to epithelial transition
2. P GO:1901000 regulation of response to salt stress
2. P GO:0071559 response to transforming growth factor beta
2. P GO:0035721 intraciliary retrograde transport
2. P GO:0061608 nuclear import signal receptor activity
2. P GO:0001658 branching involved in ureteric bud morphogenesis
2. P GO:0032868 response to insulin
2. P GO:0071107 response to parathyroid hormone
2. P GO:0030991 intraciliary transport particle A
2. P GO:0010218 response to far red light
2. P GO:2000816 negative regulation of mitotic sister chromatid separation
2. P GO:0051276 chromosome organization
2. P GO:0051457 maintenance of protein location in nucleus
2. P GO:0003340 negative regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis
2. P GO:0050693 LBD domain binding
2. P GO:0045143 homologous chromosome segregation
2. P GO:0005634 nucleus
2. P GO:0006913 nucleocytoplasmic transport
2. P GO:0034097 response to cytokine
2. P GO:0009640 photomorphogenesis
2. P GO:0060395 SMAD protein signal transduction
2. P GO:0001656 metanephros development
2. P GO:0010029 regulation of seed germination
2. P GO:0001890 placenta development
2. P GO:0010114 response to red light
2. P GO:0071104 response to interleukin-9
2. P GO:0045893 positive regulation of transcription, DNA-templated
2. P GO:0043627 response to estrogen
2. P GO:0031048 heterochromatin assembly by small RNA
2. P GO:0010018 far-red light signaling pathway
2. P GO:0060712 spongiotrophoblast layer development

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8IW50 Protein FAM219A 0 2.98e-152 5.58e-136
1. PB Q14DQ1 Protein FAM219B 1.87e-02 1.67e-17 2.99e-30
1. PB Q5XKK7 Protein FAM219B 1.13e-02 2.02e-17 3.48e-24
1. PB Q9D772 Protein FAM219A 1.14e-06 6.53e-29 8.91e-105
1. PB Q6DC60 Protein FAM219A 3.39e-11 5.92e-65 7.40e-98
1. PB Q9BGQ5 Protein FAM219A 2.54e-04 1.97e-25 4.48e-101
2. P Q2QD14 Putative pituitary tumor-transforming gene 3 protein 2.27e-01 9.75e-04 NA
2. P Q8S4Q6 Protein FAR-RED ELONGATED HYPOCOTYL 1 2.60e-01 2.69e-02 NA
2. P Q99MA0 Cbp/p300-interacting transactivator 4 2.98e-01 6.25e-04 NA
2. P Q3SZY3 Securin 3.61e-01 8.85e-05 NA
2. P P52820 40S ribosomal protein S15 (Fragment) 6.73e-01 6.32e-03 NA
2. P A0A1B0GUS0 Uncharacterized protein C19orf85 2.25e-01 3.83e-02 NA
2. P O74337 Uncharacterized protein C1A4.04 2.00e-01 3.81e-05 NA
2. P A1YF19 Securin 2.66e-01 1.65e-04 NA
2. P P30286 G2/mitotic-specific cyclin-1 (Fragment) 4.78e-01 3.12e-02 NA
2. P Q68D20 Protein PMS2CL 4.33e-01 3.79e-02 NA
2. P O13859 Meiotically up-regulated gene 125 protein 3.50e-01 1.12e-04 NA
2. P Q03233 Alpha1-proteinase inhibitor-degradation deficient protein 37 4.27e-01 2.10e-03 NA
2. P A2T767 Securin NA 1.35e-04 NA
2. P Q2HJ78 Cbp/p300-interacting transactivator 4 1.79e-01 4.10e-03 NA
2. P Q9WUL8 Cbp/p300-interacting transactivator 4 4.89e-01 2.19e-03 NA
2. P O95997 Securin 4.09e-01 2.34e-04 NA
2. P Q9NZH4 Putative pituitary tumor-transforming gene 3 protein 2.84e-01 2.97e-02 NA
2. P Q8N535 Putative uncharacterized protein encoded by LINC00471 3.40e-01 1.31e-02 NA
2. P Q96N06 Spermatogenesis-associated protein 33 2.18e-01 2.57e-02 NA
2. P Q99966 Cbp/p300-interacting transactivator 1 5.31e-02 1.24e-02 NA
2. P Q9NZH5 Securin-2 1.03e-01 2.89e-02 NA
2. P Q96RK1 Cbp/p300-interacting transactivator 4 4.95e-01 8.84e-03 NA
2. P Q9SGS5 Uncharacterized protein At1g76070 3.55e-01 3.93e-03 NA
2. P B5G1P1 Intraflagellar transport protein 43 homolog 7.54e-02 1.51e-03 NA