Summary

Q8IXQ4

Homolog: Q69ZC8.
Function: GPALPP motifs-containing protein 1.

Statistics

Total GO Annotation: 95
Unique PROST Go: 95
Unique BLAST Go: 0

Total Homologs: 205
Unique PROST Homologs: 199
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q69ZC8 (GPALPP motifs-containing protein 1) with a FATCAT P-Value: 2.31e-11 and RMSD of 3.00 angstrom. The sequence alignment identity is 89.3%.
Structural alignment shown in left. Query protein Q8IXQ4 colored as red in alignment, homolog Q69ZC8 colored as blue. Query protein Q8IXQ4 is also shown in right top, homolog Q69ZC8 showed in right bottom. They are colored based on secondary structures. 

  Q8IXQ4 MARDLIGPALPPGFKARGTAEDEERDPSPVAGPALPPNYKSSSSDSSDSDEDSSSLYEEGNQESEEDDSGPTARKQRKNQDDDDDDDDGFFGPALPPGFK 100
  Q69ZC8 MARDLIGPALPPGFKEHATVEDEERDPSPVAGPALPPNYRSCSSDSSDSDEDSSSLSEEGNQESEEEDTGPNAKKQRRNQ-DDDDDDDGFFGPALPPGFK 99

  Q8IXQ4 KQDDSPPRPIIGPALPPGFIKSTQKSDKGRDDPGQ-------QETDSSEDEDIIGPMPAKGPVNYNVTTEFEKRAQRMKEKLTKGDDDSSKPIVRESWMT 193
  Q69ZC8 KQDDSPPRPIIGPALPPGFIKSPQKNDKGREDPGQVSSFFNSEEAESGEDEDIVGPMPAKGPVNYSVTTEFEKRAQRMKEKLTKGDDDSSKPITRESWMT 199

  Q8IXQ4 ELPPEMKDFGLGPRTFKRRADDTSGDRSIWTDTPADRERKAKETQEARKSSSKKDEEHILSGRDKRLAEQVSSYNESKRSESLMDIHHKKLKSKAAEDKN 293
  Q69ZC8 ELPPEMKEFGLGPRTFKRRADDKSGDRSVWTDTPADRERKAKEIQEARKSFSKKDEENILSGRDKRLAEQVSSYNESKRSESLMDIHHKKLKSKAAEDKN 299

  Q8IXQ4 KPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKGNMFL 340
  Q69ZC8 KHQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKGNMFL 346

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0030628 pre-mRNA 3'-splice site binding
2. P GO:0035883 enteroendocrine cell differentiation
2. P GO:0000386 second spliceosomal transesterification activity
2. P GO:0010099 regulation of photomorphogenesis
2. P GO:0039586 modulation by virus of host PP1 activity
2. P GO:0000349 generation of catalytic spliceosome for first transesterification step
2. P GO:0006325 chromatin organization
2. P GO:0000469 cleavage involved in rRNA processing
2. P GO:0030291 protein serine/threonine kinase inhibitor activity
2. P GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
2. P GO:0043966 histone H3 acetylation
2. P GO:0007076 mitotic chromosome condensation
2. P GO:0043486 histone exchange
2. P GO:2000270 negative regulation of fibroblast apoptotic process
2. P GO:0071014 post-mRNA release spliceosomal complex
2. P GO:0045292 mRNA cis splicing, via spliceosome
2. P GO:0072686 mitotic spindle
2. P GO:0048546 digestive tract morphogenesis
2. P GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0080022 primary root development
2. P GO:1904761 negative regulation of myofibroblast differentiation
2. P GO:0071931 positive regulation of transcription involved in G1/S transition of mitotic cell cycle
2. P GO:0048268 clathrin coat assembly
2. P GO:0042273 ribosomal large subunit biogenesis
2. P GO:0030125 clathrin vesicle coat
2. P GO:0030687 preribosome, large subunit precursor
2. P GO:0048102 autophagic cell death
2. P GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0000375 RNA splicing, via transesterification reactions
2. P GO:0005634 nucleus
2. P GO:0000460 maturation of 5.8S rRNA
2. P GO:0072583 clathrin-dependent endocytosis
2. P GO:0030686 90S preribosome
2. P GO:0042127 regulation of cell population proliferation
2. P GO:0003723 RNA binding
2. P GO:0060303 regulation of nucleosome density
2. P GO:0042766 nucleosome mobilization
2. P GO:0070274 RES complex
2. P GO:0071008 U2-type post-mRNA release spliceosomal complex
2. P GO:0007155 cell adhesion
2. P GO:0005681 spliceosomal complex
2. P GO:0071004 U2-type prespliceosome
2. P GO:0006417 regulation of translation
2. P GO:0048024 regulation of mRNA splicing, via spliceosome
2. P GO:0045142 triplex DNA binding
2. P GO:0034457 Mpp10 complex
2. P GO:0006397 mRNA processing
2. P GO:0055121 response to high fluence blue light stimulus by blue high-fluence system
2. P GO:0045027 DNA end binding
2. P GO:0000775 chromosome, centromeric region
2. P GO:0030175 filopodium
2. P GO:0032040 small-subunit processome
2. P GO:0000398 mRNA splicing, via spliceosome
2. P GO:0001527 microfibril
2. P GO:0035303 regulation of dephosphorylation
2. P GO:0000470 maturation of LSU-rRNA
2. P GO:0007419 ventral cord development
2. P GO:1904667 negative regulation of ubiquitin protein ligase activity
2. P GO:0080040 positive regulation of cellular response to phosphate starvation
2. P GO:1901857 positive regulation of cellular respiration
2. P GO:0000124 SAGA complex
2. P GO:0008380 RNA splicing
2. P GO:0042274 ribosomal small subunit biogenesis
2. P GO:0071007 U2-type catalytic step 2 spliceosome
2. P GO:0030532 small nuclear ribonucleoprotein complex
2. P GO:0031929 TOR signaling
2. P GO:0000812 Swr1 complex
2. P GO:0043967 histone H4 acetylation
2. P GO:0071005 U2-type precatalytic spliceosome
2. P GO:0040001 establishment of mitotic spindle localization
2. P GO:0090503 RNA phosphodiester bond hydrolysis, exonucleolytic
2. P GO:0099631 postsynaptic endocytic zone cytoplasmic component
2. P GO:0031011 Ino80 complex
2. P GO:0005694 chromosome
2. P GO:0043044
2. P GO:0071013 catalytic step 2 spliceosome
2. P GO:0000281 mitotic cytokinesis
2. P GO:0000974 Prp19 complex
2. P GO:0051665 membrane raft localization
2. P GO:0071447 cellular response to hydroperoxide
2. P GO:0000776 kinetochore
2. P GO:0032050 clathrin heavy chain binding
2. P GO:0071006 U2-type catalytic step 1 spliceosome
2. P GO:0005671 obsolete Ada2/Gcn5/Ada3 transcription activator complex
2. P GO:1903097 regulation of CENP-A containing nucleosome assembly
2. P GO:0043558 regulation of translational initiation in response to stress
2. P GO:0005730 nucleolus
2. P GO:0030132 clathrin coat of coated pit
2. P GO:0001652 granular component
2. P GO:0030130 clathrin coat of trans-Golgi network vesicle
2. P GO:0072703 cellular response to methyl methanesulfonate
2. P GO:0005684 U2-type spliceosomal complex
2. P GO:0071439 clathrin complex
2. P GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8IXQ4 GPALPP motifs-containing protein 1 0 1.52e-138 0.0
1. PB Q4V893 GPALPP motifs-containing protein 1 2.96e-07 8.98e-85 0.0
1. PB Q69ZC8 GPALPP motifs-containing protein 1 2.31e-11 1.40e-87 0.0
1. PB Q93591 Uncharacterized protein F26A3.7 5.44e-02 5.92e-30 1.55e-19
1. PB Q5R863 GPALPP motifs-containing protein 1 2.25e-09 8.81e-104 0.0
1. PB Q3ZBM6 GPALPP motifs-containing protein 1 4.82e-06 6.49e-20 8.21e-127
2. P O57594 Surfeit locus protein 6 homolog 7.51e-02 5.87e-09 NA
2. P B6K8A0 rRNA biogenesis protein rrp36 1.73e-01 1.20e-05 NA
2. P B0CPQ8 rRNA biogenesis protein RRP36 1.43e-01 7.30e-04 NA
2. P Q93712 Microfibrillar-associated protein 1 2.40e-01 2.07e-03 NA
2. P Q4W9Z9 Pre-mRNA-splicing factor cwc26 1.83e-01 4.60e-04 NA
2. P Q5XIB5 Coiled-coil domain-containing protein 86 3.20e-01 9.97e-03 NA
2. P A4R1G4 rRNA biogenesis protein RRP36 2.39e-01 6.15e-10 NA
2. P Q0CH52 rRNA biogenesis protein rrp36 9.55e-02 9.27e-08 NA
2. P Q6CJ60 Pre-mRNA-splicing factor SPP381 9.50e-02 7.22e-04 NA
2. P Q09713 Uncharacterized protein C18B11.06 6.18e-01 4.93e-02 NA
2. P C1GXI3 rRNA biogenesis protein RRP36 1.40e-01 1.91e-08 NA
2. P Q9HEC4 rRNA biogenesis protein rrp-36 1.03e-01 3.54e-10 NA
2. P Q9P7H6 Uncharacterized protein C1782.03 1.30e-01 1.09e-06 NA
2. P A6ZPC2 rRNA biogenesis protein RRP36 1.79e-01 9.13e-13 NA
2. P Q6DGP2 Pre-mRNA-splicing factor syf2 9.37e-02 1.45e-05 NA
2. P Q5AWZ6 Pre-mRNA-splicing factor cwc26 1.26e-01 5.51e-05 NA
2. P Q8AVQ6 Pre-mRNA-splicing factor syf2 1.21e-01 1.08e-03 NA
2. P A7E4K0 rRNA biogenesis protein rrp36 1.75e-01 8.53e-10 NA
2. P Q66IZ5 Transcriptional adapter 3-B 2.38e-01 2.62e-02 NA
2. P Q4WRE2 SWR1-complex protein 5 2.65e-01 4.46e-05 NA
2. P Q6CU86 rRNA biogenesis protein RRP36 1.78e-01 2.30e-08 NA
2. P C4Y4A0 rRNA biogenesis protein RRP36 1.91e-01 1.40e-07 NA
2. P Q9UTD7 Ribosomal RNA-processing protein 15 1.08e-01 7.73e-08 NA
2. P Q4ADK4 Craniofacial development protein 1 1.20e-01 4.16e-07 NA
2. P P38326 SWR1-complex protein 5 1.22e-01 4.85e-03 NA
2. P P0CR21 rRNA biogenesis protein RRP36 2.06e-01 2.51e-08 NA
2. P Q752E4 Restriction of telomere capping protein 4 1.52e-01 1.22e-02 NA
2. P O14210 INO80 complex subunit 2 9.21e-02 2.39e-07 NA
2. P Q7RWR8 Pre-mRNA-splicing factor cwc-26 1.25e-01 1.91e-02 NA
2. P Q9VWA1 Clathrin light chain 2.42e-01 2.62e-02 NA
2. P Q9M2D8 Uncharacterized protein At3g61260 1.23e-01 1.99e-03 NA
2. P P0CR20 rRNA biogenesis protein RRP36 1.42e-01 2.51e-08 NA
2. P A8N142 rRNA biogenesis protein RRP36 1.71e-01 8.08e-12 NA
2. P Q23525 Uncharacterized protein ZK546.14 9.81e-02 8.64e-04 NA
2. P D4AIP9 rRNA biogenesis protein RRP36 1.43e-01 1.11e-06 NA
2. P A6RF22 rRNA biogenesis protein RRP36 1.87e-01 9.47e-10 NA
2. P P30640 BUD13 homolog 1.92e-01 1.99e-03 NA
2. P O00566 U3 small nucleolar ribonucleoprotein protein MPP10 3.69e-01 8.43e-03 NA
2. P O74897 SWR1-complex protein 5 7.54e-02 2.11e-10 NA
2. P P53952 Uncharacterized protein YNL050C 1.37e-01 3.28e-03 NA
2. P Q7SY21 Transcriptional adapter 3 4.72e-01 6.93e-03 NA
2. P Q6CQI2 Pre-mRNA-splicing factor CWC15 3.95e-01 8.75e-03 NA
2. P A3LP95 rRNA biogenesis protein RRP36 5.37e-02 2.29e-11 NA
2. P Q54SU3 Protein MFAP1 homolog 4.12e-01 3.38e-03 NA
2. P Q3KRF3 Uncharacterized protein C1orf131 homolog 2.46e-01 6.82e-05 NA
2. P P75143 Uncharacterized protein MPN_143 1.91e-01 6.08e-03 NA
2. P Q5EA98 Microfibrillar-associated protein 1 3.17e-01 3.75e-02 NA
2. P Q9P6P2 rRNA biogenesis protein rrp36 1.27e-01 3.91e-04 NA
2. P Q753K4 Pre-mRNA-splicing factor SYF2 1.30e-01 9.43e-03 NA
2. P Q5RB69 Coiled-coil domain-containing protein 86 2.18e-01 1.73e-02 NA
2. P Q5M947 RRP15-like protein 5.63e-02 2.11e-02 NA
2. P Q9CYX7 RRP15-like protein 6.69e-02 1.76e-05 NA
2. P Q09385 Pre-mRNA-splicing factor syf-2 1.17e-01 2.45e-04 NA
2. P Q6BWZ7 SWR1-complex protein 5 1.30e-01 6.45e-11 NA
2. P Q5R939 Protein FAM204A 1.90e-01 1.31e-02 NA
2. P Q75QI0 Craniofacial development protein 1 1.44e-01 9.63e-07 NA
2. P B2B720 rRNA biogenesis protein RRP36 2.45e-01 2.02e-10 NA
2. P P40154 Ino eighty subunit 2 2.01e-01 2.44e-03 NA
2. P C6HHV6 rRNA biogenesis protein RRP36 2.56e-01 2.88e-09 NA
2. P Q9NEU5 Ribosome biogenesis protein NOP53 3.45e-01 5.86e-04 NA
2. P Q52F10 Pre-mRNA-splicing factor CWC26 1.86e-01 2.39e-03 NA
2. P Q9DB96 Neuroguidin 1.68e-01 4.85e-03 NA
2. P B9WMA4 rRNA biogenesis protein RRP36 2.59e-01 1.55e-09 NA
2. P Q12481 rRNA biogenesis protein RRP36 1.27e-01 8.54e-12 NA
2. P Q4P6D5 SWR1-complex protein 5 2.00e-01 1.38e-09 NA
2. P Q60FC2 Craniofacial development protein 1 1.41e-01 1.25e-08 NA
2. P Q9BXS6 Nucleolar and spindle-associated protein 1 3.15e-01 1.67e-02 NA
2. P Q12035 rRNA-processing protein FCF2 1.12e-01 1.99e-05 NA
2. P Q752L7 rRNA biogenesis protein RRP36 2.05e-01 6.72e-07 NA
2. P Q8C6C7 Protein FAM204A 1.28e-01 3.41e-03 NA
2. P Q6FJP1 rRNA biogenesis protein RRP36 1.60e-01 1.43e-10 NA
2. P Q4WPM6 Pre-mRNA-splicing factor syf2 6.27e-02 1.43e-03 NA
2. P B6HGB5 rRNA biogenesis protein rrp36 4.16e-01 3.03e-07 NA
2. P A5DLD1 rRNA biogenesis protein RRP36 1.85e-01 3.97e-07 NA
2. P C5JYW1 rRNA biogenesis protein RRP36 2.12e-01 3.53e-09 NA
2. P Q9BQ61 Telomerase RNA component interacting RNase 1.28e-01 5.48e-03 NA
2. P Q08492 Bud site selection protein 21 1.27e-01 8.52e-08 NA
2. P Q4ADK7 Craniofacial development protein 1 7.94e-02 3.05e-08 NA
2. P Q80YE2 Tumor protein p53-inducible nuclear protein 1 5.27e-01 1.12e-02 NA
2. P Q06511 Ribosomal RNA-processing protein 15 3.85e-02 9.48e-09 NA
2. P P0CN00 Pre-mRNA-splicing factor CWC26 2.05e-01 2.09e-03 NA
2. P Q59SN0 rRNA biogenesis protein RRP36 2.32e-01 7.39e-10 NA
2. P O13910 U3 small nucleolar ribonucleoprotein protein mpp10 1.69e-01 5.19e-04 NA
2. P Q6FNZ4 Restriction of telomere capping protein 4 4.00e-02 3.65e-02 NA
2. P P17891 Clathrin light chain 2.73e-01 1.35e-03 NA
2. P Q5UQA4 HMG box-containing protein R545 NA 2.62e-02 NA
2. P Q5AL13 Pre-mRNA-splicing factor CWC26 2.35e-01 5.46e-04 NA
2. P Q10148 Telomere length and silencing protein 1 2.16e-01 2.63e-07 NA
2. P Q5A8H7 SWR1-complex protein 5 1.04e-01 1.75e-08 NA
2. P Q6CK06 Pre-mRNA-splicing factor SLU7 3.95e-01 8.20e-03 NA
2. P Q521C0 Pre-mRNA-splicing factor SYF2 7.51e-02 8.06e-04 NA
2. P Q9VDS6 Surfeit locus protein 6 homolog 1.07e-01 7.68e-03 NA
2. P Q3TQI7 Telomere length and silencing protein 1 homolog 3.39e-01 1.14e-03 NA
2. P Q9I8B0 Surfeit locus protein 6 homolog 1.91e-01 3.62e-13 NA
2. P Q6PFJ1 Neuroguidin 2.52e-01 3.55e-02 NA
2. P P36080 Ribosomal RNA-processing protein 14 2.27e-01 3.65e-04 NA
2. P D1Z670 rRNA biogenesis protein RRP36 2.65e-01 2.41e-12 NA
2. P A7TMH4 rRNA biogenesis protein RRP36 1.92e-01 6.37e-13 NA
2. P O75683 Surfeit locus protein 6 1.62e-01 4.00e-08 NA
2. P P0CN01 Pre-mRNA-splicing factor CWC26 1.34e-01 2.09e-03 NA
2. P Q74ZL7 Ribosome assembly protein 3 7.26e-02 1.09e-02 NA
2. P A1DLU6 rRNA biogenesis protein rrp36 8.62e-02 7.01e-09 NA
2. P Q6CFU2 rRNA biogenesis protein RRP36 2.22e-01 6.93e-06 NA
2. P Q5DHJ5 Intraflagellar transport protein 46 homolog 4.95e-01 3.28e-02 NA
2. P P40546 Protein FAF1 1.52e-01 5.19e-10 NA
2. P C0SGK2 rRNA biogenesis protein RRP36 1.11e-01 6.60e-08 NA
2. P P38282 Pre-mRNA-splicing factor SPP381 1.20e-01 2.66e-11 NA
2. P Q757H5 Pre-mRNA-splicing factor SPP381 5.90e-02 9.55e-06 NA
2. P Q54XT8 Ribosomal RNA processing protein 36 homolog 2.38e-01 3.06e-05 NA
2. P Q0VCY3 Surfeit locus protein 6 1.12e-01 2.99e-09 NA
2. P Q4KLC4 Neuroguidin-A 1.86e-01 2.95e-03 NA
2. P Q96EL1 PAK4-inhibitor INKA1 2.96e-01 3.59e-02 NA
2. P Q4WDF7 rRNA biogenesis protein rrp36 1.49e-01 3.81e-09 NA
2. P P55080 Microfibrillar-associated protein 1 1.87e-01 4.40e-02 NA
2. P B0YCZ3 rRNA biogenesis protein rrp36 2.35e-01 3.81e-09 NA
2. P Q4I650 SWR1-complex protein 5 2.69e-01 1.23e-06 NA
2. P C5P263 rRNA biogenesis protein RRP36 1.93e-01 1.48e-04 NA
2. P Q2U9C3 rRNA biogenesis protein rrp36 1.20e-01 6.14e-08 NA
2. P A7TEH5 Pre-mRNA-splicing factor SPP381 8.65e-02 3.79e-06 NA
2. P Q6PGT0 Transcriptional adapter 3-A 2.90e-01 9.17e-03 NA
2. P C5DPS9 rRNA biogenesis protein RRP36 1.80e-01 4.66e-11 NA
2. P O88271 Craniofacial development protein 1 1.45e-01 5.17e-09 NA
2. P Q8CIL4 Uncharacterized protein C1orf131 homolog 2.30e-01 7.11e-05 NA
2. P Q5BER4 SWR1-complex protein 5 4.92e-01 1.15e-07 NA
2. P C4YMC1 rRNA biogenesis protein RRP36 2.79e-01 1.26e-09 NA
2. P O42648 HMG box-containing protein C10F6.08c 2.24e-01 3.92e-02 NA
2. P Q6CKH1 SWR1-complex protein 5 9.19e-02 9.79e-03 NA
2. P Q8C4M7 Centromere protein U 4.94e-02 1.56e-02 NA
2. P B3LJV1 rRNA biogenesis protein RRP36 4.75e-02 3.68e-12 NA
2. P Q7RZK5 Pre-mRNA-splicing factor syf2 6.93e-02 1.03e-05 NA
2. P Q5BC69 Pre-mRNA-splicing factor syf2 9.55e-02 2.82e-03 NA
2. P C5DF79 rRNA biogenesis protein RRP36 2.79e-01 7.73e-08 NA
2. P Q8NDD1 Uncharacterized protein C1orf131 2.20e-01 2.66e-04 NA
2. P Q8NEJ9 Neuroguidin 2.37e-01 5.91e-03 NA
2. P C7YTL6 rRNA biogenesis protein RRP36 1.17e-01 3.62e-09 NA
2. P C9S8J9 rRNA biogenesis protein RRP36 9.52e-02 2.57e-10 NA
2. P Q9NZ63 Telomere length and silencing protein 1 homolog 2.33e-01 8.94e-06 NA
2. P Q3T062 RRP15-like protein 8.84e-02 9.26e-04 NA
2. P Q4PI72 Pre-mRNA-splicing factor CWC26 1.04e-01 4.62e-03 NA
2. P Q2YDJ0 Nucleolar and spindle-associated protein 1 3.08e-01 4.94e-03 NA
2. P B8MSM6 rRNA biogenesis protein rrp36 2.78e-01 1.88e-06 NA
2. P Q6FPZ6 Pre-mRNA-splicing factor SYF2 2.54e-01 1.20e-04 NA
2. P P0C754 Protein DP71L NA 1.73e-02 NA
2. P Q6BVE0 Pre-mRNA-splicing factor SYF2 5.12e-02 5.30e-04 NA
2. P Q28IV8 Neuroguidin 3.23e-01 2.61e-03 NA
2. P D4D4Q0 rRNA biogenesis protein RRP36 1.17e-01 4.43e-06 NA
2. P B6QVD3 rRNA biogenesis protein rrp36 1.66e-01 2.22e-07 NA
2. P A1CMA3 rRNA biogenesis protein rrp36 1.19e-01 7.86e-12 NA
2. P O94417 Pre-mRNA-splicing factor cwf26 2.46e-01 2.55e-02 NA
2. P Q2GXM5 rRNA biogenesis protein RRP36 1.72e-01 2.15e-07 NA
2. P Q9USK4 Pre-mRNA-splicing factor cwf20 6.94e-01 8.99e-10 NA
2. P O42882 Uncharacterized protein C8E11.05c 1.66e-01 2.98e-03 NA
2. P C1GG27 rRNA biogenesis protein RRP36 7.33e-02 1.40e-08 NA
2. P A2R4K5 rRNA biogenesis protein rrp36 2.63e-01 1.47e-06 NA
2. P Q5RC87 Telomere length and silencing protein 1 homolog 3.51e-01 1.24e-05 NA
2. P Q1ED39 Lysine-rich nucleolar protein 1 4.23e-01 1.22e-02 NA
2. P Q2KII6 Neuroguidin 1.83e-01 1.48e-02 NA
2. P F4HVZ5 Protein COP1 SUPPRESSOR 2 1.43e-01 1.59e-02 NA
2. P Q7RYI3 SWR1-complex protein 5 2.49e-01 1.80e-10 NA
2. P Q754T8 SWR1-complex protein 5 1.97e-01 1.48e-02 NA
2. P Q612R3 Pre-mRNA-splicing factor syf-2 1.05e-01 9.55e-06 NA
2. P Q0V389 rRNA biogenesis protein RRP36 8.58e-02 1.75e-08 NA
2. P Q9UEE9 Craniofacial development protein 1 3.17e-01 9.25e-09 NA
2. P A8Q6P6 rRNA biogenesis protein RRP36 1.87e-01 7.65e-05 NA
2. P Q0P4A6 Protein TSSC4 2.93e-01 1.71e-04 NA
2. P P70279 Surfeit locus protein 6 1.18e-01 1.22e-08 NA
2. P Q5AYR9 rRNA biogenesis protein rrp36 7.34e-02 1.49e-10 NA
2. P Q54G38 Surfeit locus protein 6 homolog 3.38e-01 2.29e-05 NA
2. P A6RKG5 rRNA biogenesis protein rrp36 2.20e-01 2.28e-10 NA
2. P A5E0U1 rRNA biogenesis protein RRP36 2.56e-01 2.47e-09 NA
2. P C5GLN0 rRNA biogenesis protein RRP36 1.37e-01 5.65e-09 NA
2. P Q9H6F5 Coiled-coil domain-containing protein 86 1.85e-01 1.75e-02 NA
2. P Q9UUI4 Ribosome biogenesis protein NOP53 2.90e-01 4.21e-02 NA
2. P A4QTA3 Eukaryotic translation initiation factor 3 subunit J 8.22e-02 6.25e-03 NA
2. P C0NZV4 rRNA biogenesis protein RRP36 1.86e-01 7.89e-10 NA
2. P C5FRS7 rRNA biogenesis protein RRP36 1.32e-01 5.05e-08 NA
2. P Q66JG5 Transcriptional adapter 3 1.47e-01 3.72e-03 NA
2. P Q08399 DNA-directed RNA polymerase subunit 6 homolog NA 4.52e-02 NA
2. P B2W2Y7 rRNA biogenesis protein RRP36 1.33e-01 9.05e-08 NA
2. P P39015 Suppressor protein STM1 4.73e-01 3.52e-02 NA
2. P P53277 Pre-mRNA-splicing factor SYF2 1.21e-01 1.02e-04 NA
2. P C7GWA5 rRNA biogenesis protein RRP36 1.78e-01 6.37e-12 NA
2. P B8NDQ2 rRNA biogenesis protein rrp36 7.79e-02 6.14e-08 NA
2. P A6ZL94 Pre-mRNA-splicing factor SPP381 4.29e-02 7.04e-07 NA
2. P Q8HXY9 Craniofacial development protein 1 1.28e-01 4.62e-07 NA
2. P Q10183 Uncharacterized protein C3F10.08c 1.30e-01 2.33e-06 NA
2. P Q7SZP2 UPF0690 protein C1orf52 homolog 5.31e-01 3.38e-06 NA
2. P C5MAP5 rRNA biogenesis protein RRP36 2.64e-01 5.30e-08 NA
2. P B5VSG4 rRNA biogenesis protein RRP36 8.56e-02 3.68e-12 NA
2. P Q6BGV5 rRNA biogenesis protein RRP36 9.10e-02 6.81e-11 NA
2. P O43082 Ribosomal RNA-processing protein 14-C 1.27e-01 5.74e-04 NA
2. P Q5M985 Neuroguidin-B (Fragment) 1.95e-01 7.00e-03 NA
2. P Q75UQ2 Craniofacial development protein 1 1.71e-01 3.50e-08 NA
2. P C4QVB0 rRNA biogenesis protein RRP36 2.08e-01 4.79e-11 NA
2. P A0A286YDK6 Protein PERCC1 1.22e-01 2.72e-05 NA
2. P Q9Y7T1 Uncharacterized protein C63.05 1.88e-01 3.25e-02 NA
2. P Q4PI84 rRNA biogenesis protein RRP36 1.63e-01 1.63e-05 NA
2. P D5GA77 rRNA biogenesis protein RRP36 4.24e-01 6.05e-07 NA
2. P C8ZH37 rRNA biogenesis protein RRP36 1.15e-01 3.68e-12 NA