Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q69ZC8
(GPALPP motifs-containing protein 1) with a FATCAT P-Value: 2.31e-11 and RMSD of 3.00 angstrom. The sequence alignment identity is 89.3%.
Structural alignment shown in left. Query protein Q8IXQ4 colored as red in alignment, homolog Q69ZC8 colored as blue.
Query protein Q8IXQ4 is also shown in right top, homolog Q69ZC8 showed in right bottom. They are colored based on secondary structures.
Q8IXQ4 MARDLIGPALPPGFKARGTAEDEERDPSPVAGPALPPNYKSSSSDSSDSDEDSSSLYEEGNQESEEDDSGPTARKQRKNQDDDDDDDDGFFGPALPPGFK 100 Q69ZC8 MARDLIGPALPPGFKEHATVEDEERDPSPVAGPALPPNYRSCSSDSSDSDEDSSSLSEEGNQESEEEDTGPNAKKQRRNQ-DDDDDDDGFFGPALPPGFK 99 Q8IXQ4 KQDDSPPRPIIGPALPPGFIKSTQKSDKGRDDPGQ-------QETDSSEDEDIIGPMPAKGPVNYNVTTEFEKRAQRMKEKLTKGDDDSSKPIVRESWMT 193 Q69ZC8 KQDDSPPRPIIGPALPPGFIKSPQKNDKGREDPGQVSSFFNSEEAESGEDEDIVGPMPAKGPVNYSVTTEFEKRAQRMKEKLTKGDDDSSKPITRESWMT 199 Q8IXQ4 ELPPEMKDFGLGPRTFKRRADDTSGDRSIWTDTPADRERKAKETQEARKSSSKKDEEHILSGRDKRLAEQVSSYNESKRSESLMDIHHKKLKSKAAEDKN 293 Q69ZC8 ELPPEMKEFGLGPRTFKRRADDKSGDRSVWTDTPADRERKAKEIQEARKSFSKKDEENILSGRDKRLAEQVSSYNESKRSESLMDIHHKKLKSKAAEDKN 299 Q8IXQ4 KPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKGNMFL 340 Q69ZC8 KHQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKGNMFL 346
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0030628 | pre-mRNA 3'-splice site binding |
| 2. P | GO:0035883 | enteroendocrine cell differentiation |
| 2. P | GO:0000386 | second spliceosomal transesterification activity |
| 2. P | GO:0010099 | regulation of photomorphogenesis |
| 2. P | GO:0039586 | modulation by virus of host PP1 activity |
| 2. P | GO:0000349 | generation of catalytic spliceosome for first transesterification step |
| 2. P | GO:0006325 | chromatin organization |
| 2. P | GO:0000469 | cleavage involved in rRNA processing |
| 2. P | GO:0030291 | protein serine/threonine kinase inhibitor activity |
| 2. P | GO:0005732 | sno(s)RNA-containing ribonucleoprotein complex |
| 2. P | GO:0043966 | histone H3 acetylation |
| 2. P | GO:0007076 | mitotic chromosome condensation |
| 2. P | GO:0043486 | histone exchange |
| 2. P | GO:2000270 | negative regulation of fibroblast apoptotic process |
| 2. P | GO:0071014 | post-mRNA release spliceosomal complex |
| 2. P | GO:0045292 | mRNA cis splicing, via spliceosome |
| 2. P | GO:0072686 | mitotic spindle |
| 2. P | GO:0048546 | digestive tract morphogenesis |
| 2. P | GO:0000447 | endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 2. P | GO:0080022 | primary root development |
| 2. P | GO:1904761 | negative regulation of myofibroblast differentiation |
| 2. P | GO:0071931 | positive regulation of transcription involved in G1/S transition of mitotic cell cycle |
| 2. P | GO:0048268 | clathrin coat assembly |
| 2. P | GO:0042273 | ribosomal large subunit biogenesis |
| 2. P | GO:0030125 | clathrin vesicle coat |
| 2. P | GO:0030687 | preribosome, large subunit precursor |
| 2. P | GO:0048102 | autophagic cell death |
| 2. P | GO:0000462 | maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 2. P | GO:0000472 | endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 2. P | GO:0000375 | RNA splicing, via transesterification reactions |
| 2. P | GO:0005634 | nucleus |
| 2. P | GO:0000460 | maturation of 5.8S rRNA |
| 2. P | GO:0072583 | clathrin-dependent endocytosis |
| 2. P | GO:0030686 | 90S preribosome |
| 2. P | GO:0042127 | regulation of cell population proliferation |
| 2. P | GO:0003723 | RNA binding |
| 2. P | GO:0060303 | regulation of nucleosome density |
| 2. P | GO:0042766 | nucleosome mobilization |
| 2. P | GO:0070274 | RES complex |
| 2. P | GO:0071008 | U2-type post-mRNA release spliceosomal complex |
| 2. P | GO:0007155 | cell adhesion |
| 2. P | GO:0005681 | spliceosomal complex |
| 2. P | GO:0071004 | U2-type prespliceosome |
| 2. P | GO:0006417 | regulation of translation |
| 2. P | GO:0048024 | regulation of mRNA splicing, via spliceosome |
| 2. P | GO:0045142 | triplex DNA binding |
| 2. P | GO:0034457 | Mpp10 complex |
| 2. P | GO:0006397 | mRNA processing |
| 2. P | GO:0055121 | response to high fluence blue light stimulus by blue high-fluence system |
| 2. P | GO:0045027 | DNA end binding |
| 2. P | GO:0000775 | chromosome, centromeric region |
| 2. P | GO:0030175 | filopodium |
| 2. P | GO:0032040 | small-subunit processome |
| 2. P | GO:0000398 | mRNA splicing, via spliceosome |
| 2. P | GO:0001527 | microfibril |
| 2. P | GO:0035303 | regulation of dephosphorylation |
| 2. P | GO:0000470 | maturation of LSU-rRNA |
| 2. P | GO:0007419 | ventral cord development |
| 2. P | GO:1904667 | negative regulation of ubiquitin protein ligase activity |
| 2. P | GO:0080040 | positive regulation of cellular response to phosphate starvation |
| 2. P | GO:1901857 | positive regulation of cellular respiration |
| 2. P | GO:0000124 | SAGA complex |
| 2. P | GO:0008380 | RNA splicing |
| 2. P | GO:0042274 | ribosomal small subunit biogenesis |
| 2. P | GO:0071007 | U2-type catalytic step 2 spliceosome |
| 2. P | GO:0030532 | small nuclear ribonucleoprotein complex |
| 2. P | GO:0031929 | TOR signaling |
| 2. P | GO:0000812 | Swr1 complex |
| 2. P | GO:0043967 | histone H4 acetylation |
| 2. P | GO:0071005 | U2-type precatalytic spliceosome |
| 2. P | GO:0040001 | establishment of mitotic spindle localization |
| 2. P | GO:0090503 | RNA phosphodiester bond hydrolysis, exonucleolytic |
| 2. P | GO:0099631 | postsynaptic endocytic zone cytoplasmic component |
| 2. P | GO:0031011 | Ino80 complex |
| 2. P | GO:0005694 | chromosome |
| 2. P | GO:0043044 | |
| 2. P | GO:0071013 | catalytic step 2 spliceosome |
| 2. P | GO:0000281 | mitotic cytokinesis |
| 2. P | GO:0000974 | Prp19 complex |
| 2. P | GO:0051665 | membrane raft localization |
| 2. P | GO:0071447 | cellular response to hydroperoxide |
| 2. P | GO:0000776 | kinetochore |
| 2. P | GO:0032050 | clathrin heavy chain binding |
| 2. P | GO:0071006 | U2-type catalytic step 1 spliceosome |
| 2. P | GO:0005671 | obsolete Ada2/Gcn5/Ada3 transcription activator complex |
| 2. P | GO:1903097 | regulation of CENP-A containing nucleosome assembly |
| 2. P | GO:0043558 | regulation of translational initiation in response to stress |
| 2. P | GO:0005730 | nucleolus |
| 2. P | GO:0030132 | clathrin coat of coated pit |
| 2. P | GO:0001652 | granular component |
| 2. P | GO:0030130 | clathrin coat of trans-Golgi network vesicle |
| 2. P | GO:0072703 | cellular response to methyl methanesulfonate |
| 2. P | GO:0005684 | U2-type spliceosomal complex |
| 2. P | GO:0071439 | clathrin complex |
| 2. P | GO:0005654 | nucleoplasm |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8IXQ4 | GPALPP motifs-containing protein 1 | 0 | 1.52e-138 | 0.0 |
| 1. PB | Q4V893 | GPALPP motifs-containing protein 1 | 2.96e-07 | 8.98e-85 | 0.0 |
| 1. PB | Q69ZC8 | GPALPP motifs-containing protein 1 | 2.31e-11 | 1.40e-87 | 0.0 |
| 1. PB | Q93591 | Uncharacterized protein F26A3.7 | 5.44e-02 | 5.92e-30 | 1.55e-19 |
| 1. PB | Q5R863 | GPALPP motifs-containing protein 1 | 2.25e-09 | 8.81e-104 | 0.0 |
| 1. PB | Q3ZBM6 | GPALPP motifs-containing protein 1 | 4.82e-06 | 6.49e-20 | 8.21e-127 |
| 2. P | O57594 | Surfeit locus protein 6 homolog | 7.51e-02 | 5.87e-09 | NA |
| 2. P | B6K8A0 | rRNA biogenesis protein rrp36 | 1.73e-01 | 1.20e-05 | NA |
| 2. P | B0CPQ8 | rRNA biogenesis protein RRP36 | 1.43e-01 | 7.30e-04 | NA |
| 2. P | Q93712 | Microfibrillar-associated protein 1 | 2.40e-01 | 2.07e-03 | NA |
| 2. P | Q4W9Z9 | Pre-mRNA-splicing factor cwc26 | 1.83e-01 | 4.60e-04 | NA |
| 2. P | Q5XIB5 | Coiled-coil domain-containing protein 86 | 3.20e-01 | 9.97e-03 | NA |
| 2. P | A4R1G4 | rRNA biogenesis protein RRP36 | 2.39e-01 | 6.15e-10 | NA |
| 2. P | Q0CH52 | rRNA biogenesis protein rrp36 | 9.55e-02 | 9.27e-08 | NA |
| 2. P | Q6CJ60 | Pre-mRNA-splicing factor SPP381 | 9.50e-02 | 7.22e-04 | NA |
| 2. P | Q09713 | Uncharacterized protein C18B11.06 | 6.18e-01 | 4.93e-02 | NA |
| 2. P | C1GXI3 | rRNA biogenesis protein RRP36 | 1.40e-01 | 1.91e-08 | NA |
| 2. P | Q9HEC4 | rRNA biogenesis protein rrp-36 | 1.03e-01 | 3.54e-10 | NA |
| 2. P | Q9P7H6 | Uncharacterized protein C1782.03 | 1.30e-01 | 1.09e-06 | NA |
| 2. P | A6ZPC2 | rRNA biogenesis protein RRP36 | 1.79e-01 | 9.13e-13 | NA |
| 2. P | Q6DGP2 | Pre-mRNA-splicing factor syf2 | 9.37e-02 | 1.45e-05 | NA |
| 2. P | Q5AWZ6 | Pre-mRNA-splicing factor cwc26 | 1.26e-01 | 5.51e-05 | NA |
| 2. P | Q8AVQ6 | Pre-mRNA-splicing factor syf2 | 1.21e-01 | 1.08e-03 | NA |
| 2. P | A7E4K0 | rRNA biogenesis protein rrp36 | 1.75e-01 | 8.53e-10 | NA |
| 2. P | Q66IZ5 | Transcriptional adapter 3-B | 2.38e-01 | 2.62e-02 | NA |
| 2. P | Q4WRE2 | SWR1-complex protein 5 | 2.65e-01 | 4.46e-05 | NA |
| 2. P | Q6CU86 | rRNA biogenesis protein RRP36 | 1.78e-01 | 2.30e-08 | NA |
| 2. P | C4Y4A0 | rRNA biogenesis protein RRP36 | 1.91e-01 | 1.40e-07 | NA |
| 2. P | Q9UTD7 | Ribosomal RNA-processing protein 15 | 1.08e-01 | 7.73e-08 | NA |
| 2. P | Q4ADK4 | Craniofacial development protein 1 | 1.20e-01 | 4.16e-07 | NA |
| 2. P | P38326 | SWR1-complex protein 5 | 1.22e-01 | 4.85e-03 | NA |
| 2. P | P0CR21 | rRNA biogenesis protein RRP36 | 2.06e-01 | 2.51e-08 | NA |
| 2. P | Q752E4 | Restriction of telomere capping protein 4 | 1.52e-01 | 1.22e-02 | NA |
| 2. P | O14210 | INO80 complex subunit 2 | 9.21e-02 | 2.39e-07 | NA |
| 2. P | Q7RWR8 | Pre-mRNA-splicing factor cwc-26 | 1.25e-01 | 1.91e-02 | NA |
| 2. P | Q9VWA1 | Clathrin light chain | 2.42e-01 | 2.62e-02 | NA |
| 2. P | Q9M2D8 | Uncharacterized protein At3g61260 | 1.23e-01 | 1.99e-03 | NA |
| 2. P | P0CR20 | rRNA biogenesis protein RRP36 | 1.42e-01 | 2.51e-08 | NA |
| 2. P | A8N142 | rRNA biogenesis protein RRP36 | 1.71e-01 | 8.08e-12 | NA |
| 2. P | Q23525 | Uncharacterized protein ZK546.14 | 9.81e-02 | 8.64e-04 | NA |
| 2. P | D4AIP9 | rRNA biogenesis protein RRP36 | 1.43e-01 | 1.11e-06 | NA |
| 2. P | A6RF22 | rRNA biogenesis protein RRP36 | 1.87e-01 | 9.47e-10 | NA |
| 2. P | P30640 | BUD13 homolog | 1.92e-01 | 1.99e-03 | NA |
| 2. P | O00566 | U3 small nucleolar ribonucleoprotein protein MPP10 | 3.69e-01 | 8.43e-03 | NA |
| 2. P | O74897 | SWR1-complex protein 5 | 7.54e-02 | 2.11e-10 | NA |
| 2. P | P53952 | Uncharacterized protein YNL050C | 1.37e-01 | 3.28e-03 | NA |
| 2. P | Q7SY21 | Transcriptional adapter 3 | 4.72e-01 | 6.93e-03 | NA |
| 2. P | Q6CQI2 | Pre-mRNA-splicing factor CWC15 | 3.95e-01 | 8.75e-03 | NA |
| 2. P | A3LP95 | rRNA biogenesis protein RRP36 | 5.37e-02 | 2.29e-11 | NA |
| 2. P | Q54SU3 | Protein MFAP1 homolog | 4.12e-01 | 3.38e-03 | NA |
| 2. P | Q3KRF3 | Uncharacterized protein C1orf131 homolog | 2.46e-01 | 6.82e-05 | NA |
| 2. P | P75143 | Uncharacterized protein MPN_143 | 1.91e-01 | 6.08e-03 | NA |
| 2. P | Q5EA98 | Microfibrillar-associated protein 1 | 3.17e-01 | 3.75e-02 | NA |
| 2. P | Q9P6P2 | rRNA biogenesis protein rrp36 | 1.27e-01 | 3.91e-04 | NA |
| 2. P | Q753K4 | Pre-mRNA-splicing factor SYF2 | 1.30e-01 | 9.43e-03 | NA |
| 2. P | Q5RB69 | Coiled-coil domain-containing protein 86 | 2.18e-01 | 1.73e-02 | NA |
| 2. P | Q5M947 | RRP15-like protein | 5.63e-02 | 2.11e-02 | NA |
| 2. P | Q9CYX7 | RRP15-like protein | 6.69e-02 | 1.76e-05 | NA |
| 2. P | Q09385 | Pre-mRNA-splicing factor syf-2 | 1.17e-01 | 2.45e-04 | NA |
| 2. P | Q6BWZ7 | SWR1-complex protein 5 | 1.30e-01 | 6.45e-11 | NA |
| 2. P | Q5R939 | Protein FAM204A | 1.90e-01 | 1.31e-02 | NA |
| 2. P | Q75QI0 | Craniofacial development protein 1 | 1.44e-01 | 9.63e-07 | NA |
| 2. P | B2B720 | rRNA biogenesis protein RRP36 | 2.45e-01 | 2.02e-10 | NA |
| 2. P | P40154 | Ino eighty subunit 2 | 2.01e-01 | 2.44e-03 | NA |
| 2. P | C6HHV6 | rRNA biogenesis protein RRP36 | 2.56e-01 | 2.88e-09 | NA |
| 2. P | Q9NEU5 | Ribosome biogenesis protein NOP53 | 3.45e-01 | 5.86e-04 | NA |
| 2. P | Q52F10 | Pre-mRNA-splicing factor CWC26 | 1.86e-01 | 2.39e-03 | NA |
| 2. P | Q9DB96 | Neuroguidin | 1.68e-01 | 4.85e-03 | NA |
| 2. P | B9WMA4 | rRNA biogenesis protein RRP36 | 2.59e-01 | 1.55e-09 | NA |
| 2. P | Q12481 | rRNA biogenesis protein RRP36 | 1.27e-01 | 8.54e-12 | NA |
| 2. P | Q4P6D5 | SWR1-complex protein 5 | 2.00e-01 | 1.38e-09 | NA |
| 2. P | Q60FC2 | Craniofacial development protein 1 | 1.41e-01 | 1.25e-08 | NA |
| 2. P | Q9BXS6 | Nucleolar and spindle-associated protein 1 | 3.15e-01 | 1.67e-02 | NA |
| 2. P | Q12035 | rRNA-processing protein FCF2 | 1.12e-01 | 1.99e-05 | NA |
| 2. P | Q752L7 | rRNA biogenesis protein RRP36 | 2.05e-01 | 6.72e-07 | NA |
| 2. P | Q8C6C7 | Protein FAM204A | 1.28e-01 | 3.41e-03 | NA |
| 2. P | Q6FJP1 | rRNA biogenesis protein RRP36 | 1.60e-01 | 1.43e-10 | NA |
| 2. P | Q4WPM6 | Pre-mRNA-splicing factor syf2 | 6.27e-02 | 1.43e-03 | NA |
| 2. P | B6HGB5 | rRNA biogenesis protein rrp36 | 4.16e-01 | 3.03e-07 | NA |
| 2. P | A5DLD1 | rRNA biogenesis protein RRP36 | 1.85e-01 | 3.97e-07 | NA |
| 2. P | C5JYW1 | rRNA biogenesis protein RRP36 | 2.12e-01 | 3.53e-09 | NA |
| 2. P | Q9BQ61 | Telomerase RNA component interacting RNase | 1.28e-01 | 5.48e-03 | NA |
| 2. P | Q08492 | Bud site selection protein 21 | 1.27e-01 | 8.52e-08 | NA |
| 2. P | Q4ADK7 | Craniofacial development protein 1 | 7.94e-02 | 3.05e-08 | NA |
| 2. P | Q80YE2 | Tumor protein p53-inducible nuclear protein 1 | 5.27e-01 | 1.12e-02 | NA |
| 2. P | Q06511 | Ribosomal RNA-processing protein 15 | 3.85e-02 | 9.48e-09 | NA |
| 2. P | P0CN00 | Pre-mRNA-splicing factor CWC26 | 2.05e-01 | 2.09e-03 | NA |
| 2. P | Q59SN0 | rRNA biogenesis protein RRP36 | 2.32e-01 | 7.39e-10 | NA |
| 2. P | O13910 | U3 small nucleolar ribonucleoprotein protein mpp10 | 1.69e-01 | 5.19e-04 | NA |
| 2. P | Q6FNZ4 | Restriction of telomere capping protein 4 | 4.00e-02 | 3.65e-02 | NA |
| 2. P | P17891 | Clathrin light chain | 2.73e-01 | 1.35e-03 | NA |
| 2. P | Q5UQA4 | HMG box-containing protein R545 | NA | 2.62e-02 | NA |
| 2. P | Q5AL13 | Pre-mRNA-splicing factor CWC26 | 2.35e-01 | 5.46e-04 | NA |
| 2. P | Q10148 | Telomere length and silencing protein 1 | 2.16e-01 | 2.63e-07 | NA |
| 2. P | Q5A8H7 | SWR1-complex protein 5 | 1.04e-01 | 1.75e-08 | NA |
| 2. P | Q6CK06 | Pre-mRNA-splicing factor SLU7 | 3.95e-01 | 8.20e-03 | NA |
| 2. P | Q521C0 | Pre-mRNA-splicing factor SYF2 | 7.51e-02 | 8.06e-04 | NA |
| 2. P | Q9VDS6 | Surfeit locus protein 6 homolog | 1.07e-01 | 7.68e-03 | NA |
| 2. P | Q3TQI7 | Telomere length and silencing protein 1 homolog | 3.39e-01 | 1.14e-03 | NA |
| 2. P | Q9I8B0 | Surfeit locus protein 6 homolog | 1.91e-01 | 3.62e-13 | NA |
| 2. P | Q6PFJ1 | Neuroguidin | 2.52e-01 | 3.55e-02 | NA |
| 2. P | P36080 | Ribosomal RNA-processing protein 14 | 2.27e-01 | 3.65e-04 | NA |
| 2. P | D1Z670 | rRNA biogenesis protein RRP36 | 2.65e-01 | 2.41e-12 | NA |
| 2. P | A7TMH4 | rRNA biogenesis protein RRP36 | 1.92e-01 | 6.37e-13 | NA |
| 2. P | O75683 | Surfeit locus protein 6 | 1.62e-01 | 4.00e-08 | NA |
| 2. P | P0CN01 | Pre-mRNA-splicing factor CWC26 | 1.34e-01 | 2.09e-03 | NA |
| 2. P | Q74ZL7 | Ribosome assembly protein 3 | 7.26e-02 | 1.09e-02 | NA |
| 2. P | A1DLU6 | rRNA biogenesis protein rrp36 | 8.62e-02 | 7.01e-09 | NA |
| 2. P | Q6CFU2 | rRNA biogenesis protein RRP36 | 2.22e-01 | 6.93e-06 | NA |
| 2. P | Q5DHJ5 | Intraflagellar transport protein 46 homolog | 4.95e-01 | 3.28e-02 | NA |
| 2. P | P40546 | Protein FAF1 | 1.52e-01 | 5.19e-10 | NA |
| 2. P | C0SGK2 | rRNA biogenesis protein RRP36 | 1.11e-01 | 6.60e-08 | NA |
| 2. P | P38282 | Pre-mRNA-splicing factor SPP381 | 1.20e-01 | 2.66e-11 | NA |
| 2. P | Q757H5 | Pre-mRNA-splicing factor SPP381 | 5.90e-02 | 9.55e-06 | NA |
| 2. P | Q54XT8 | Ribosomal RNA processing protein 36 homolog | 2.38e-01 | 3.06e-05 | NA |
| 2. P | Q0VCY3 | Surfeit locus protein 6 | 1.12e-01 | 2.99e-09 | NA |
| 2. P | Q4KLC4 | Neuroguidin-A | 1.86e-01 | 2.95e-03 | NA |
| 2. P | Q96EL1 | PAK4-inhibitor INKA1 | 2.96e-01 | 3.59e-02 | NA |
| 2. P | Q4WDF7 | rRNA biogenesis protein rrp36 | 1.49e-01 | 3.81e-09 | NA |
| 2. P | P55080 | Microfibrillar-associated protein 1 | 1.87e-01 | 4.40e-02 | NA |
| 2. P | B0YCZ3 | rRNA biogenesis protein rrp36 | 2.35e-01 | 3.81e-09 | NA |
| 2. P | Q4I650 | SWR1-complex protein 5 | 2.69e-01 | 1.23e-06 | NA |
| 2. P | C5P263 | rRNA biogenesis protein RRP36 | 1.93e-01 | 1.48e-04 | NA |
| 2. P | Q2U9C3 | rRNA biogenesis protein rrp36 | 1.20e-01 | 6.14e-08 | NA |
| 2. P | A7TEH5 | Pre-mRNA-splicing factor SPP381 | 8.65e-02 | 3.79e-06 | NA |
| 2. P | Q6PGT0 | Transcriptional adapter 3-A | 2.90e-01 | 9.17e-03 | NA |
| 2. P | C5DPS9 | rRNA biogenesis protein RRP36 | 1.80e-01 | 4.66e-11 | NA |
| 2. P | O88271 | Craniofacial development protein 1 | 1.45e-01 | 5.17e-09 | NA |
| 2. P | Q8CIL4 | Uncharacterized protein C1orf131 homolog | 2.30e-01 | 7.11e-05 | NA |
| 2. P | Q5BER4 | SWR1-complex protein 5 | 4.92e-01 | 1.15e-07 | NA |
| 2. P | C4YMC1 | rRNA biogenesis protein RRP36 | 2.79e-01 | 1.26e-09 | NA |
| 2. P | O42648 | HMG box-containing protein C10F6.08c | 2.24e-01 | 3.92e-02 | NA |
| 2. P | Q6CKH1 | SWR1-complex protein 5 | 9.19e-02 | 9.79e-03 | NA |
| 2. P | Q8C4M7 | Centromere protein U | 4.94e-02 | 1.56e-02 | NA |
| 2. P | B3LJV1 | rRNA biogenesis protein RRP36 | 4.75e-02 | 3.68e-12 | NA |
| 2. P | Q7RZK5 | Pre-mRNA-splicing factor syf2 | 6.93e-02 | 1.03e-05 | NA |
| 2. P | Q5BC69 | Pre-mRNA-splicing factor syf2 | 9.55e-02 | 2.82e-03 | NA |
| 2. P | C5DF79 | rRNA biogenesis protein RRP36 | 2.79e-01 | 7.73e-08 | NA |
| 2. P | Q8NDD1 | Uncharacterized protein C1orf131 | 2.20e-01 | 2.66e-04 | NA |
| 2. P | Q8NEJ9 | Neuroguidin | 2.37e-01 | 5.91e-03 | NA |
| 2. P | C7YTL6 | rRNA biogenesis protein RRP36 | 1.17e-01 | 3.62e-09 | NA |
| 2. P | C9S8J9 | rRNA biogenesis protein RRP36 | 9.52e-02 | 2.57e-10 | NA |
| 2. P | Q9NZ63 | Telomere length and silencing protein 1 homolog | 2.33e-01 | 8.94e-06 | NA |
| 2. P | Q3T062 | RRP15-like protein | 8.84e-02 | 9.26e-04 | NA |
| 2. P | Q4PI72 | Pre-mRNA-splicing factor CWC26 | 1.04e-01 | 4.62e-03 | NA |
| 2. P | Q2YDJ0 | Nucleolar and spindle-associated protein 1 | 3.08e-01 | 4.94e-03 | NA |
| 2. P | B8MSM6 | rRNA biogenesis protein rrp36 | 2.78e-01 | 1.88e-06 | NA |
| 2. P | Q6FPZ6 | Pre-mRNA-splicing factor SYF2 | 2.54e-01 | 1.20e-04 | NA |
| 2. P | P0C754 | Protein DP71L | NA | 1.73e-02 | NA |
| 2. P | Q6BVE0 | Pre-mRNA-splicing factor SYF2 | 5.12e-02 | 5.30e-04 | NA |
| 2. P | Q28IV8 | Neuroguidin | 3.23e-01 | 2.61e-03 | NA |
| 2. P | D4D4Q0 | rRNA biogenesis protein RRP36 | 1.17e-01 | 4.43e-06 | NA |
| 2. P | B6QVD3 | rRNA biogenesis protein rrp36 | 1.66e-01 | 2.22e-07 | NA |
| 2. P | A1CMA3 | rRNA biogenesis protein rrp36 | 1.19e-01 | 7.86e-12 | NA |
| 2. P | O94417 | Pre-mRNA-splicing factor cwf26 | 2.46e-01 | 2.55e-02 | NA |
| 2. P | Q2GXM5 | rRNA biogenesis protein RRP36 | 1.72e-01 | 2.15e-07 | NA |
| 2. P | Q9USK4 | Pre-mRNA-splicing factor cwf20 | 6.94e-01 | 8.99e-10 | NA |
| 2. P | O42882 | Uncharacterized protein C8E11.05c | 1.66e-01 | 2.98e-03 | NA |
| 2. P | C1GG27 | rRNA biogenesis protein RRP36 | 7.33e-02 | 1.40e-08 | NA |
| 2. P | A2R4K5 | rRNA biogenesis protein rrp36 | 2.63e-01 | 1.47e-06 | NA |
| 2. P | Q5RC87 | Telomere length and silencing protein 1 homolog | 3.51e-01 | 1.24e-05 | NA |
| 2. P | Q1ED39 | Lysine-rich nucleolar protein 1 | 4.23e-01 | 1.22e-02 | NA |
| 2. P | Q2KII6 | Neuroguidin | 1.83e-01 | 1.48e-02 | NA |
| 2. P | F4HVZ5 | Protein COP1 SUPPRESSOR 2 | 1.43e-01 | 1.59e-02 | NA |
| 2. P | Q7RYI3 | SWR1-complex protein 5 | 2.49e-01 | 1.80e-10 | NA |
| 2. P | Q754T8 | SWR1-complex protein 5 | 1.97e-01 | 1.48e-02 | NA |
| 2. P | Q612R3 | Pre-mRNA-splicing factor syf-2 | 1.05e-01 | 9.55e-06 | NA |
| 2. P | Q0V389 | rRNA biogenesis protein RRP36 | 8.58e-02 | 1.75e-08 | NA |
| 2. P | Q9UEE9 | Craniofacial development protein 1 | 3.17e-01 | 9.25e-09 | NA |
| 2. P | A8Q6P6 | rRNA biogenesis protein RRP36 | 1.87e-01 | 7.65e-05 | NA |
| 2. P | Q0P4A6 | Protein TSSC4 | 2.93e-01 | 1.71e-04 | NA |
| 2. P | P70279 | Surfeit locus protein 6 | 1.18e-01 | 1.22e-08 | NA |
| 2. P | Q5AYR9 | rRNA biogenesis protein rrp36 | 7.34e-02 | 1.49e-10 | NA |
| 2. P | Q54G38 | Surfeit locus protein 6 homolog | 3.38e-01 | 2.29e-05 | NA |
| 2. P | A6RKG5 | rRNA biogenesis protein rrp36 | 2.20e-01 | 2.28e-10 | NA |
| 2. P | A5E0U1 | rRNA biogenesis protein RRP36 | 2.56e-01 | 2.47e-09 | NA |
| 2. P | C5GLN0 | rRNA biogenesis protein RRP36 | 1.37e-01 | 5.65e-09 | NA |
| 2. P | Q9H6F5 | Coiled-coil domain-containing protein 86 | 1.85e-01 | 1.75e-02 | NA |
| 2. P | Q9UUI4 | Ribosome biogenesis protein NOP53 | 2.90e-01 | 4.21e-02 | NA |
| 2. P | A4QTA3 | Eukaryotic translation initiation factor 3 subunit J | 8.22e-02 | 6.25e-03 | NA |
| 2. P | C0NZV4 | rRNA biogenesis protein RRP36 | 1.86e-01 | 7.89e-10 | NA |
| 2. P | C5FRS7 | rRNA biogenesis protein RRP36 | 1.32e-01 | 5.05e-08 | NA |
| 2. P | Q66JG5 | Transcriptional adapter 3 | 1.47e-01 | 3.72e-03 | NA |
| 2. P | Q08399 | DNA-directed RNA polymerase subunit 6 homolog | NA | 4.52e-02 | NA |
| 2. P | B2W2Y7 | rRNA biogenesis protein RRP36 | 1.33e-01 | 9.05e-08 | NA |
| 2. P | P39015 | Suppressor protein STM1 | 4.73e-01 | 3.52e-02 | NA |
| 2. P | P53277 | Pre-mRNA-splicing factor SYF2 | 1.21e-01 | 1.02e-04 | NA |
| 2. P | C7GWA5 | rRNA biogenesis protein RRP36 | 1.78e-01 | 6.37e-12 | NA |
| 2. P | B8NDQ2 | rRNA biogenesis protein rrp36 | 7.79e-02 | 6.14e-08 | NA |
| 2. P | A6ZL94 | Pre-mRNA-splicing factor SPP381 | 4.29e-02 | 7.04e-07 | NA |
| 2. P | Q8HXY9 | Craniofacial development protein 1 | 1.28e-01 | 4.62e-07 | NA |
| 2. P | Q10183 | Uncharacterized protein C3F10.08c | 1.30e-01 | 2.33e-06 | NA |
| 2. P | Q7SZP2 | UPF0690 protein C1orf52 homolog | 5.31e-01 | 3.38e-06 | NA |
| 2. P | C5MAP5 | rRNA biogenesis protein RRP36 | 2.64e-01 | 5.30e-08 | NA |
| 2. P | B5VSG4 | rRNA biogenesis protein RRP36 | 8.56e-02 | 3.68e-12 | NA |
| 2. P | Q6BGV5 | rRNA biogenesis protein RRP36 | 9.10e-02 | 6.81e-11 | NA |
| 2. P | O43082 | Ribosomal RNA-processing protein 14-C | 1.27e-01 | 5.74e-04 | NA |
| 2. P | Q5M985 | Neuroguidin-B (Fragment) | 1.95e-01 | 7.00e-03 | NA |
| 2. P | Q75UQ2 | Craniofacial development protein 1 | 1.71e-01 | 3.50e-08 | NA |
| 2. P | C4QVB0 | rRNA biogenesis protein RRP36 | 2.08e-01 | 4.79e-11 | NA |
| 2. P | A0A286YDK6 | Protein PERCC1 | 1.22e-01 | 2.72e-05 | NA |
| 2. P | Q9Y7T1 | Uncharacterized protein C63.05 | 1.88e-01 | 3.25e-02 | NA |
| 2. P | Q4PI84 | rRNA biogenesis protein RRP36 | 1.63e-01 | 1.63e-05 | NA |
| 2. P | D5GA77 | rRNA biogenesis protein RRP36 | 4.24e-01 | 6.05e-07 | NA |
| 2. P | C8ZH37 | rRNA biogenesis protein RRP36 | 1.15e-01 | 3.68e-12 | NA |