Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q4R989
(PDZ domain-containing protein 9) with a FATCAT P-Value: 2.79e-11 and RMSD of 2.34 angstrom. The sequence alignment identity is 94.7%.
Structural alignment shown in left. Query protein Q8IXQ8 colored as red in alignment, homolog Q4R989 colored as blue.
Query protein Q8IXQ8 is also shown in right top, homolog Q4R989 showed in right bottom. They are colored based on secondary structures.
Q8IXQ8 MQKASHKNKKERGVSNKVKTSVHNLSKTQQTKLTVGSLGLGLIIIQHGPYLQITHLIRKGAAANDGKLQPGDVLISVGHANVLGYTLREFLQLLQHITIG 100 Q4R989 MQKASRKNKKERGVSIKVKTSVHNLSKTQQTKLTVGRLGLGLIIIQHGPYLQITHLIRKGAAANDGKLQPGDVLISVGYANVLGYTLREFLQLLQHITVG 100 Q8IXQ8 TVLQIKVYRDFINIPEEWQEIYDLIPEAKFPVTSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISISRDWHGYKKKNHTISVGK 200 Q4R989 TVLQIKVYRDFINIPEEWLEIYDLIPEAKFPVTSTPKKMELAKDESFTSSDDNENVDLDRRLQYYRYPWSTAHHPARRPISISRDWHGYKKKNHTISVGK 200 Q8IXQ8 DINCDVMIHRDDKKEVRAPSPYWIMVKQDNESSSSSTSSTSDAFWLEDCAQVEEGKAQLVSKVG 264 Q4R989 DIDCDVMIHRDDKKEVKAPSPYWIMVKQDNETSSSSTSSTSDAFWLEDCAQVEEGKAQPVSKFG 264
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0012505 | endomembrane system |
| 1. PB | GO:0070830 | bicellular tight junction assembly |
| 1. PB | GO:0071944 | cell periphery |
| 1. PB | GO:0008104 | protein localization |
| 1. PB | GO:0014069 | postsynaptic density |
| 1. PB | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 1. PB | GO:0016324 | apical plasma membrane |
| 1. PB | GO:0005938 | cell cortex |
| 1. PB | GO:0043113 | receptor clustering |
| 1. PB | GO:0051898 | negative regulation of protein kinase B signaling |
| 2. P | GO:0070293 | renal absorption |
| 2. P | GO:0098978 | glutamatergic synapse |
| 2. P | GO:0005902 | microvillus |
| 2. P | GO:0048471 | perinuclear region of cytoplasm |
| 2. P | GO:0003117 | regulation of vasoconstriction by circulating norepinephrine |
| 2. P | GO:0030155 | regulation of cell adhesion |
| 2. P | GO:0016010 | dystrophin-associated glycoprotein complex |
| 2. P | GO:0016055 | Wnt signaling pathway |
| 2. P | GO:0006487 | protein N-linked glycosylation |
| 2. P | GO:0030175 | filopodium |
| 2. P | GO:0097120 | receptor localization to synapse |
| 2. P | GO:0005641 | nuclear envelope lumen |
| 2. P | GO:0045859 | regulation of protein kinase activity |
| 2. P | GO:0031528 | microvillus membrane |
| 2. P | GO:0005769 | early endosome |
| 2. P | GO:0034635 | glutathione transport |
| 2. P | GO:1902083 | negative regulation of peptidyl-cysteine S-nitrosylation |
| 2. P | GO:2000146 | negative regulation of cell motility |
| 2. P | GO:0005794 | Golgi apparatus |
| 2. P | GO:0031267 | small GTPase binding |
| 2. P | GO:0014067 | negative regulation of phosphatidylinositol 3-kinase signaling |
| 2. P | GO:0072659 | protein localization to plasma membrane |
| 2. P | GO:0002027 | regulation of heart rate |
| 2. P | GO:0060307 | regulation of ventricular cardiac muscle cell membrane repolarization |
| 2. P | GO:0010642 | negative regulation of platelet-derived growth factor receptor signaling pathway |
| 2. P | GO:0061951 | establishment of protein localization to plasma membrane |
| 2. P | GO:0050774 | negative regulation of dendrite morphogenesis |
| 2. P | GO:1902305 | regulation of sodium ion transmembrane transport |
| 2. P | GO:0032782 | bile acid secretion |
| 2. P | GO:0030165 | PDZ domain binding |
| 2. P | GO:0015031 | protein transport |
| 2. P | GO:0017081 | chloride channel regulator activity |
| 2. P | GO:0007030 | Golgi organization |
| 2. P | GO:0097291 | renal phosphate ion absorption |
| 2. P | GO:0086005 | ventricular cardiac muscle cell action potential |
| 2. P | GO:0007528 | neuromuscular junction development |
| 2. P | GO:0051286 | cell tip |
| 2. P | GO:0099152 | regulation of neurotransmitter receptor transport, endosome to postsynaptic membrane |
| 2. P | GO:0000139 | Golgi membrane |
| 2. P | GO:0098685 | Schaffer collateral - CA1 synapse |
| 2. P | GO:0050998 | nitric-oxide synthase binding |
| 2. P | GO:0043495 | protein-membrane adaptor activity |
| 2. P | GO:0097225 | sperm midpiece |
| 2. P | GO:0033116 | endoplasmic reticulum-Golgi intermediate compartment membrane |
| 2. P | GO:0045211 | postsynaptic membrane |
| 2. P | GO:0017080 | sodium channel regulator activity |
| 2. P | GO:0001726 | ruffle |
| 3. B | GO:0003402 | planar cell polarity pathway involved in axis elongation |
| 3. B | GO:0071346 | cellular response to interferon-gamma |
| 3. B | GO:0005770 | late endosome |
| 3. B | GO:0030159 | signaling receptor complex adaptor activity |
| 3. B | GO:0097118 | neuroligin clustering involved in postsynaptic membrane assembly |
| 3. B | GO:0043296 | apical junction complex |
| 3. B | GO:0044319 | wound healing, spreading of cells |
| 3. B | GO:0003094 | glomerular filtration |
| 3. B | GO:0008286 | insulin receptor signaling pathway |
| 3. B | GO:0005819 | spindle |
| 3. B | GO:0032926 | negative regulation of activin receptor signaling pathway |
| 3. B | GO:0072015 | glomerular visceral epithelial cell development |
| 3. B | GO:0044295 | axonal growth cone |
| 3. B | GO:0007205 | protein kinase C-activating G protein-coupled receptor signaling pathway |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0008022 | protein C-terminus binding |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0030010 | establishment of cell polarity |
| 3. B | GO:0090162 | establishment of epithelial cell polarity |
| 3. B | GO:0070699 | type II activin receptor binding |
| 3. B | GO:0005911 | cell-cell junction |
| 3. B | GO:0019894 | kinesin binding |
| 3. B | GO:0030425 | dendrite |
| 3. B | GO:0019903 | protein phosphatase binding |
| 3. B | GO:0000226 | microtubule cytoskeleton organization |
| 3. B | GO:0099179 | regulation of synaptic membrane adhesion |
| 3. B | GO:0060395 | SMAD protein signal transduction |
| 3. B | GO:0098919 | structural constituent of postsynaptic density |
| 3. B | GO:1902808 | positive regulation of cell cycle G1/S phase transition |
| 3. B | GO:0061178 | regulation of insulin secretion involved in cellular response to glucose stimulus |
| 3. B | GO:0051660 | establishment of centrosome localization |
| 3. B | GO:0098879 | structural constituent of postsynaptic specialization |
| 3. B | GO:0031697 | beta-1 adrenergic receptor binding |
| 3. B | GO:0007155 | cell adhesion |
| 3. B | GO:0070697 | activin receptor binding |
| 3. B | GO:0007163 | establishment or maintenance of cell polarity |
| 3. B | GO:0098890 | extrinsic component of postsynaptic membrane |
| 3. B | GO:0098696 | regulation of neurotransmitter receptor localization to postsynaptic specialization membrane |
| 3. B | GO:0046328 | regulation of JNK cascade |
| 3. B | GO:0060341 | regulation of cellular localization |
| 3. B | GO:0030336 | negative regulation of cell migration |
| 3. B | GO:0051642 | centrosome localization |
| 3. B | GO:0005109 | frizzled binding |
| 3. B | GO:0008356 | asymmetric cell division |
| 3. B | GO:0030054 | cell junction |
| 3. B | GO:0060090 | molecular adaptor activity |
| 3. B | GO:0010827 | regulation of glucose transmembrane transport |
| 3. B | GO:0043219 | lateral loop |
| 3. B | GO:0016327 | apicolateral plasma membrane |
| 3. B | GO:0042995 | cell projection |
| 3. B | GO:0043220 | Schmidt-Lanterman incisure |
| 3. B | GO:0065003 | protein-containing complex assembly |
| 3. B | GO:0002092 | positive regulation of receptor internalization |
| 3. B | GO:0032516 | positive regulation of phosphoprotein phosphatase activity |
| 3. B | GO:0038180 | nerve growth factor signaling pathway |
| 3. B | GO:0098982 | GABA-ergic synapse |
| 3. B | GO:0005547 | phosphatidylinositol-3,4,5-trisphosphate binding |
| 3. B | GO:0035091 | phosphatidylinositol binding |
| 3. B | GO:0043025 | neuronal cell body |
| 3. B | GO:0046332 | SMAD binding |
| 3. B | GO:0051393 | alpha-actinin binding |
| 3. B | GO:1990090 | cellular response to nerve growth factor stimulus |
| 3. B | GO:0036057 | slit diaphragm |
| 3. B | GO:0019902 | phosphatase binding |
| 3. B | GO:2000809 | positive regulation of synaptic vesicle clustering |
| 3. B | GO:0032991 | protein-containing complex |
| 3. B | GO:0005923 | bicellular tight junction |
| 3. B | GO:0006612 | protein targeting to membrane |
| 3. B | GO:0010801 | negative regulation of peptidyl-threonine phosphorylation |
| 3. B | GO:0022409 | positive regulation of cell-cell adhesion |
| 3. B | GO:0043507 | positive regulation of JUN kinase activity |
| 3. B | GO:0045202 | synapse |
| 3. B | GO:0042552 | myelination |
| 3. B | GO:0051726 | regulation of cell cycle |
| 3. B | GO:0005546 | phosphatidylinositol-4,5-bisphosphate binding |
| 3. B | GO:0031643 | positive regulation of myelination |
| 3. B | GO:0005912 | adherens junction |
| 3. B | GO:0019905 | syntaxin binding |
| 3. B | GO:0032266 | phosphatidylinositol-3-phosphate binding |
| 3. B | GO:0045335 | phagocytic vesicle |
| 3. B | GO:0010838 | positive regulation of keratinocyte proliferation |
| 3. B | GO:0010976 | positive regulation of neuron projection development |
| 3. B | GO:0003383 | apical constriction |
| 3. B | GO:0032970 | regulation of actin filament-based process |
| 3. B | GO:0033269 | internode region of axon |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q4R989 | PDZ domain-containing protein 9 | 2.79e-11 | 3.95e-95 | 0.0 |
| 1. PB | Q8IXQ8 | PDZ domain-containing protein 9 | 0 | 3.43e-133 | 0.0 |
| 1. PB | Q32KW7 | PDZ domain-containing protein 9 | 3.00e-09 | 1.12e-76 | 6.66e-143 |
| 1. PB | Q9D9M4 | PDZ domain-containing protein 9 | 4.55e-07 | 1.07e-59 | 9.80e-123 |
| 2. P | Q91X51 | Golgi reassembly-stacking protein 1 | 2.58e-01 | 1.08e-02 | NA |
| 2. P | O60759 | Cytohesin-interacting protein | 8.80e-03 | 8.25e-08 | NA |
| 2. P | A8MUH7 | Putative PDZ domain-containing protein PDZK1P1 | 6.92e-02 | 1.27e-05 | NA |
| 2. P | Q22638 | Mitochondrial scaffolding protein 1 | 2.69e-03 | 1.38e-04 | NA |
| 2. P | Q91VY6 | Cytohesin-interacting protein | 1.80e-02 | 1.81e-07 | NA |
| 2. P | G5EDM4 | Na(+)/H(+) exchange regulatory cofactor-like protein nrfl-1 | 2.55e-01 | 1.89e-08 | NA |
| 2. P | Q6IN97 | Putative protein FRMPD2-like | 5.29e-03 | 1.81e-03 | NA |
| 2. P | Q9BQQ3 | Golgi reassembly-stacking protein 1 | 2.45e-01 | 7.44e-05 | NA |
| 2. P | Q5ZM14 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 | 8.40e-02 | 1.52e-02 | NA |
| 2. P | O35254 | Golgi reassembly-stacking protein 1 | 2.34e-01 | 1.25e-03 | NA |
| 2. P | Q7Z6J2 | Protein TAMALIN | 1.24e-02 | 8.74e-03 | NA |
| 2. P | Q5I0L6 | Cytohesin-interacting protein | 1.18e-02 | 4.95e-08 | NA |
| 2. P | Q09354 | Uncharacterized protein T15H9.4 | 4.39e-02 | 3.33e-04 | NA |
| 2. P | Q8R4T5 | General receptor for phosphoinositides 1-associated scaffold protein | 1.53e-02 | 4.03e-02 | NA |
| 2. P | Q28619 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 | 1.04e-02 | 4.96e-02 | NA |
| 2. P | Q10149 | Uncharacterized protein C1D4.02c | 1.31e-01 | 2.88e-06 | NA |
| 2. P | Q0P5E6 | Alpha-1-syntrophin | 2.95e-02 | 1.08e-02 | NA |
| 2. P | Q9JJA9 | General receptor for phosphoinositides 1-associated scaffold protein | 1.02e-02 | 4.96e-02 | NA |
| 3. B | Q9JK71 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | 4.81e-01 | NA | 2.17e-08 |
| 3. B | Q4L1J4 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | 3.46e-01 | NA | 2.23e-08 |
| 3. B | Q8VBX6 | Multiple PDZ domain protein | 6.54e-01 | NA | 0.019 |
| 3. B | A1A5G4 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | 2.29e-01 | NA | 2.50e-08 |
| 3. B | Q5F488 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | 2.24e-01 | NA | 6.72e-07 |
| 3. B | Q9CSB4 | Partitioning defective 3 homolog B | 2.99e-01 | NA | 1.86e-04 |
| 3. B | Q6RHR9 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | 4.08e-01 | NA | 1.19e-08 |
| 3. B | Q9Z340 | Partitioning defective 3 homolog | 4.96e-01 | NA | 0.002 |
| 3. B | Q9WV89 | Syntaxin-binding protein 4 | 4.41e-02 | NA | 0.008 |
| 3. B | Q9EQJ9 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | 7.49e-01 | NA | 3.40e-07 |
| 3. B | O75970 | Multiple PDZ domain protein | 7.02e-01 | NA | 6.62e-04 |
| 3. B | Q6ZWJ1 | Syntaxin-binding protein 4 | 4.03e-02 | NA | 0.004 |
| 3. B | O88382 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 | 3.88e-01 | NA | 4.30e-07 |
| 3. B | Q8TEW0 | Partitioning defective 3 homolog | 4.37e-01 | NA | 0.002 |
| 3. B | Q86UL8 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 | 4.17e-01 | NA | 3.62e-07 |
| 3. B | Q99NH2 | Partitioning defective 3 homolog | 5.79e-01 | NA | 0.002 |
| 3. B | Q9WVQ1 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 | 3.15e-01 | NA | 4.19e-07 |
| 3. B | O55164 | Multiple PDZ domain protein | 6.57e-01 | NA | 0.012 |
| 3. B | Q5TCQ9 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | 4.54e-01 | NA | 3.25e-07 |
| 3. B | Q96QZ7 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | 4.50e-01 | NA | 1.11e-08 |
| 3. B | Q8TEW8 | Partitioning defective 3 homolog B | 4.44e-01 | NA | 6.82e-04 |