Summary

Q8IXR5

Homolog: Q24JP3.
Function: Protein FAM178B.

Statistics

Total GO Annotation: 149
Unique PROST Go: 136
Unique BLAST Go: 9

Total Homologs: 86
Unique PROST Homologs: 81
Unique BLAST Homologs: 4

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q24JP3 (Protein FAM178B) with a FATCAT P-Value: 1.11e-16 and RMSD of 3.00 angstrom. The sequence alignment identity is 51.3%.
Structural alignment shown in left. Query protein Q8IXR5 colored as red in alignment, homolog Q24JP3 colored as blue. Query protein Q8IXR5 is also shown in right top, homolog Q24JP3 showed in right bottom. They are colored based on secondary structures. 

  Q8IXR5 MWPRLPGAGLAPQLRRQDQRLHFTGQMSHGLQMAGPQETVLALPLREGVQAAATVPILLYNLEDGLSDHPLDQGPRCPARRPCSPASAPAPTSPKKPKIQ 100
  Q24JP3 ---------------------------------------------------------------------------------------------------- 0

  Q8IXR5 APGETFPTDWSPPPVEFLNPRVLQASREAPAQRWVGVVGPQGLRRLAGELPEELEQEHLDLDPKRGLALPEKLFWNTSGLSQQAAAPEFSWGGSGSYFNN 200
  Q24JP3 ----------------------------------------------------------------------------MASPSQQAGTPEISSGSSQCYINN 24

  Q8IXR5 LDYLLQEKREQALEQERERLLLQECLNLNSLDLDEEEVPLTPEHRMLVEKYSVSLQTIPPVHPGETVFLPRCHPLPCILDSSLLKPRSHLEGLFL-SSPP 299
  Q24JP3 LDYLLQEK------------------------------------RMLVEKFSVSLQVISPVHPGETVFLPRRHPLPCFLDSSRLKPHSPLEELFLRSSLP 88

  Q8IXR5 AQQLSFLRSGLLNILYLHMPDCPVSLLQWLFQLLTWPPETSLGAFGLLWDLIVDGIFLQPDEDKHLWCPSLQEVREAFHSLGAHSPALYPLGPFWHGGRV 399
  Q24JP3 -EQLSFLHNGLLSNLYLHAADCPQPLLQWLFQLLTWPPETSSRAFGLLWDLSIDGLFRQPDEDMHFWCPSLQEVKEVFSSLGAYNPALYPQGPFQHSARV 187

  Q8IXR5 LPGEAGLNENEEQDAPQEIALDISLGHIYKFLALCAQAQPGAYTDENLMGLIELLCRTSLDVGLRLLPKVDLQQLLLLLLENIREWPGKLQELCCTLSWV 499
  Q24JP3 LESEASL---DSQDPPQEVALDIKLNYIYKFLTLCLLVRPVSYTDASILDLMELLCRAGLDVGLCLLPKTDLQQLLLLLLERIQEWPGKLQPLCCALSWV 284

  Q8IXR5 SDHHHNLLALVQFFPDMTSRSRRLRSQLSLVVIARMLGQQEMLPLWQEKTQLSSLSRLLGLMRPSSLRQYLDSVPLPPCQEQQPKASAELDHKACYLCHS 599
  Q24JP3 SDHHHNLLALVQFFLDVTPRGRQLRSQLSLVIIARMLGQQESLPFSAEKTQLALLSQLLSLMRPSSLRQCLGIETLPSSLGQHSKASAELDYKVCYLCHS 384

  Q8IXR5 LLMLAGVVVSCQDITPDQWGELQLLCMQLDRHISTQIRESPQAMHRTMLKDLATQTYIRWQELLTHCQPQAQYFSPWKDI 679
  Q24JP3 LLTLAGVVVSSQDITPNQWGELQLLCMQLDRHISTHIRESPQAMHRTKLKDLATQTYIRWQDLLAHCQPQGQYFSPWKDI 464

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005634 nucleus
1. PB GO:0006281 DNA repair
1. PB GO:0005654 nucleoplasm
1. PB GO:0006974 cellular response to DNA damage stimulus
2. P GO:0007442 hindgut morphogenesis
2. P GO:0016973 poly(A)+ mRNA export from nucleus
2. P GO:0010737 protein kinase A signaling
2. P GO:0070530 K63-linked polyubiquitin modification-dependent protein binding
2. P GO:0005881 cytoplasmic microtubule
2. P GO:0045177 apical part of cell
2. P GO:0010607 negative regulation of cytoplasmic mRNA processing body assembly
2. P GO:0008283 cell population proliferation
2. P GO:0033625 positive regulation of integrin activation
2. P GO:0051026 chiasma assembly
2. P GO:0030691 Noc2p-Noc3p complex
2. P GO:0060623 regulation of chromosome condensation
2. P GO:0007143 female meiotic nuclear division
2. P GO:0030688 preribosome, small subunit precursor
2. P GO:0001825 blastocyst formation
2. P GO:0001701 in utero embryonic development
2. P GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0007444 imaginal disc development
2. P GO:0140223 general transcription initiation factor activity
2. P GO:0034508 centromere complex assembly
2. P GO:0007348 regulation of syncytial blastoderm mitotic cell cycle
2. P GO:0005911 cell-cell junction
2. P GO:0070198 protein localization to chromosome, telomeric region
2. P GO:1902373 negative regulation of mRNA catabolic process
2. P GO:0033314 mitotic DNA replication checkpoint signaling
2. P GO:0009553 embryo sac development
2. P GO:0043073 germ cell nucleus
2. P GO:0005788 endoplasmic reticulum lumen
2. P GO:1905412 negative regulation of mitotic cohesin loading
2. P GO:0030998 linear element
2. P GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0030915 Smc5-Smc6 complex
2. P GO:0007165 signal transduction
2. P GO:0010044 response to aluminum ion
2. P GO:0030371 translation repressor activity
2. P GO:0001533 cornified envelope
2. P GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
2. P GO:0034183 negative regulation of maintenance of mitotic sister chromatid cohesion
2. P GO:0071922 regulation of cohesin loading
2. P GO:1904749 regulation of protein localization to nucleolus
2. P GO:0032040 small-subunit processome
2. P GO:0030054 cell junction
2. P GO:1902751 positive regulation of cell cycle G2/M phase transition
2. P GO:0042995 cell projection
2. P GO:0034511 U3 snoRNA binding
2. P GO:0010466 negative regulation of peptidase activity
2. P GO:0035277 spiracle morphogenesis, open tracheal system
2. P GO:0072718 response to cisplatin
2. P GO:0030057 desmosome
2. P GO:1902340 negative regulation of chromosome condensation
2. P GO:0007129 homologous chromosome pairing at meiosis
2. P GO:0010696 positive regulation of mitotic spindle pole body separation
2. P GO:0042274 ribosomal small subunit biogenesis
2. P GO:0072659 protein localization to plasma membrane
2. P GO:0071923 negative regulation of cohesin loading
2. P GO:0045296 cadherin binding
2. P GO:1905168 positive regulation of double-strand break repair via homologous recombination
2. P GO:0101003 ficolin-1-rich granule membrane
2. P GO:0005694 chromosome
2. P GO:0000932 P-body
2. P GO:0009555 pollen development
2. P GO:0030280 structural constituent of skin epidermis
2. P GO:2000299 negative regulation of Rho-dependent protein serine/threonine kinase activity
2. P GO:0071013 catalytic step 2 spliceosome
2. P GO:0048619 embryonic hindgut morphogenesis
2. P GO:0032184 SUMO polymer binding
2. P GO:0048236 plant-type sporogenesis
2. P GO:0005912 adherens junction
2. P GO:0048477 oogenesis
2. P GO:0005730 nucleolus
2. P GO:0005914 spot adherens junction
2. P GO:0061781 mitotic cohesin unloading
2. P GO:0033962 P-body assembly
2. P GO:0000228 nuclear chromosome
2. P GO:0035361 Cul8-RING ubiquitin ligase complex
2. P GO:0006613 cotranslational protein targeting to membrane
2. P GO:0035220 wing disc development
2. P GO:0030692 Noc4p-Nop14p complex
2. P GO:0140445 chromosome, telomeric repeat region
2. P GO:0043008 ATP-dependent protein binding
2. P GO:0045294 alpha-catenin binding
2. P GO:0030430 host cell cytoplasm
2. P GO:1903394 protein localization to kinetochore involved in kinetochore assembly
2. P GO:0007440 foregut morphogenesis
2. P GO:0005521 lamin binding
2. P GO:2000636 positive regulation of primary miRNA processing
2. P GO:0048820 hair follicle maturation
2. P GO:0007043 cell-cell junction assembly
2. P GO:0007131 reciprocal meiotic recombination
2. P GO:0000774 adenyl-nucleotide exchange factor activity
2. P GO:0042138 meiotic DNA double-strand break formation
2. P GO:0030690 Noc1p-Noc2p complex
2. P GO:1905709 negative regulation of membrane permeability
2. P GO:0007093 mitotic cell cycle checkpoint signaling
2. P GO:0045110 intermediate filament bundle assembly
2. P GO:0090695 Wpl/Pds5 cohesin loading/unloading complex
2. P GO:0098641 cadherin binding involved in cell-cell adhesion
2. P GO:1990423 RZZ complex
2. P GO:0034046 poly(G) binding
2. P GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0000212 meiotic spindle organization
2. P GO:0048617 embryonic foregut morphogenesis
2. P GO:0030476 ascospore wall assembly
2. P GO:0019033 viral tegument
2. P GO:0017148 negative regulation of translation
2. P GO:1903024 positive regulation of ascospore-type prospore membrane formation
2. P GO:0030686 90S preribosome
2. P GO:0030515 snoRNA binding
2. P GO:1905339 positive regulation of cohesin unloading
2. P GO:0019073 viral DNA genome packaging
2. P GO:0002151 G-quadruplex RNA binding
2. P GO:0072710 response to hydroxyurea
2. P GO:0031030 negative regulation of septation initiation signaling
2. P GO:0000723 telomere maintenance
2. P GO:0016321 female meiosis chromosome segregation
2. P GO:0007367 segment polarity determination
2. P GO:0019215 intermediate filament binding
2. P GO:1990124 messenger ribonucleoprotein complex
2. P GO:0002159 desmosome assembly
2. P GO:0045875 negative regulation of sister chromatid cohesion
2. P GO:0050839 cell adhesion molecule binding
2. P GO:1905342 positive regulation of protein localization to kinetochore
2. P GO:0140588 chromatin looping
2. P GO:0000800 lateral element
2. P GO:0042025 host cell nucleus
2. P GO:0044095 host cell nucleoplasm
2. P GO:0098609 cell-cell adhesion
2. P GO:0006364 rRNA processing
2. P GO:0097078 FAL1-SGD1 complex
2. P GO:1903800 positive regulation of production of miRNAs involved in gene silencing by miRNA
2. P GO:0045144 meiotic sister chromatid segregation
2. P GO:0000077 DNA damage checkpoint signaling
2. P GO:0001829 trophectodermal cell differentiation
2. P GO:0070310 ATR-ATRIP complex
2. P GO:0009946 proximal/distal axis specification
3. B GO:0031625 ubiquitin protein ligase binding
3. B GO:2000781 positive regulation of double-strand break repair
3. B GO:0044877 protein-containing complex binding
3. B GO:0031334 positive regulation of protein-containing complex assembly
3. B GO:0043231 intracellular membrane-bounded organelle
3. B GO:0034184 positive regulation of maintenance of mitotic sister chromatid cohesion
3. B GO:0000785 chromatin
3. B GO:1990166 protein localization to site of double-strand break
3. B GO:0035861 site of double-strand break

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8IXR5 Protein FAM178B 0 3.15e-147 0.0
2. P A7S7F2 Bystin 4.96e-02 1.72e-07 NA
2. P A2ARM1 Protein PAT1 homolog 2 6.24e-03 3.21e-04 NA
2. P Q5C9Z4 Nucleolar MIF4G domain-containing protein 1 4.79e-02 4.70e-02 NA
2. P Q06164 E3 ubiquitin-protein ligase substrate receptor MMS22 6.56e-02 2.59e-02 NA
2. P Q28161 Plakophilin-1 3.03e-02 3.68e-02 NA
2. P Q8RWS4 Bystin 1.96e-02 1.26e-05 NA
2. P P0DOO9 Protein A47 NA 2.96e-02 NA
2. P P25073 Tegument protein UL47 homolog NA 5.19e-03 NA
2. P Q6BW57 Probable nucleolar complex protein 14 1.96e-02 2.26e-03 NA
2. P Q6IRM9 Protein zwilch homolog 3.66e-01 1.06e-02 NA
2. P Q6CIJ2 ATPase expression protein 1, mitochondrial 1.76e-02 6.36e-08 NA
2. P O13688 Non-structural maintenance of chromosome element 6 9.28e-05 1.88e-04 NA
2. P P10231 Tegument protein UL47 NA 2.96e-02 NA
2. P Q54IS0 Bystin 1.42e-02 1.09e-04 NA
2. P O94364 Wings apart-like protein homolog 1 8.44e-03 4.20e-11 NA
2. P P0DOP0 Protein A47 NA 2.96e-02 NA
2. P Q9UUJ4 Meiotic recombination protein rec24 1.30e-02 1.38e-02 NA
2. P P78759 Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta 2 isoform 6.14e-03 5.18e-06 NA
2. P Q06132 Suppressor of glycerol defect protein 1 3.74e-02 7.37e-04 NA
2. P Q09622 Pumilio domain-containing protein 12 1.58e-02 1.42e-02 NA
2. P P93008 DEAD-box ATP-dependent RNA helicase 21 2.47e-01 3.11e-02 NA
2. P Q0VF22 Coiled-coil domain-containing protein 138 3.02e-03 5.19e-03 NA
2. P Q5E9N0 Bystin 1.16e-02 2.32e-09 NA
2. P Q95JJ5 Coiled-coil domain-containing protein 138 3.62e-03 6.45e-05 NA
2. P Q4I7F9 Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 3.34e-01 1.79e-03 NA
2. P Q99207 Nucleolar complex protein 14 2.21e-02 2.23e-02 NA
2. P Q8BRM6 Meiosis-specific protein MEI4 7.48e-03 2.67e-05 NA
2. P P36632 DNA repair protein rad26 5.00e-03 1.75e-03 NA
2. P Q9Y446 Plakophilin-3 4.93e-03 6.99e-03 NA
2. P P0C664 Protein zwilch homolog 1.98e-01 6.91e-04 NA
2. P A9UNU6 Bystin 1.41e-02 3.10e-05 NA
2. P Q9V4Z9 Protein lines 7.69e-02 1.42e-03 NA
2. P Q9QY23 Plakophilin-3 4.78e-03 6.52e-03 NA
2. P Q08DQ0 Plakophilin-3 1.67e-02 1.39e-02 NA
2. P O42958 DNA topoisomerase 2-associated protein pat1 8.21e-03 4.12e-03 NA
2. P Q5PNP6 Meiosis-specific protein MEI4 7.70e-03 4.87e-05 NA
2. P Q8R060 Protein zwilch homolog 2.26e-01 7.91e-06 NA
2. P Q13895 Bystin 1.23e-02 1.91e-10 NA
2. P Q9H173 Nucleotide exchange factor SIL1 1.44e-02 5.77e-04 NA
2. P O54825 Bystin 6.64e-03 2.73e-09 NA
2. P Q6S6Q8 Tegument protein UL47 homolog NA 2.24e-04 NA
2. P P26673 Protein A47 NA 1.82e-02 NA
2. P A9CB88 Packaging protein 3 NA 1.73e-03 NA
2. P Q6UDF9 Tegument protein UL47 homolog NA 3.23e-03 NA
2. P Q8CCC3 Uncharacterized protein C12orf56 homolog 1.60e-02 3.15e-07 NA
2. P O13874 Uncharacterized NOC2 family protein C1B3.09c 2.55e-03 3.07e-04 NA
2. P Q32KV6 Nucleotide exchange factor SIL1 1.89e-02 1.86e-02 NA
2. P Q06134 Sporulation-specific protein 77 3.06e-02 1.38e-03 NA
2. P Q6FNV1 Probable nucleolar complex protein 14 1.57e-02 2.00e-02 NA
2. P H2L0H5 Wings apart-like protein homolog 1 1.88e-02 4.53e-02 NA
2. P Q9EPK6 Nucleotide exchange factor SIL1 2.11e-02 2.47e-02 NA
2. P Q8BMG1 ATR-interacting protein 1.02e-02 2.14e-09 NA
2. P Q96M89 Coiled-coil domain-containing protein 138 2.60e-03 2.02e-03 NA
2. P Q8NDZ2 SUMO-interacting motif-containing protein 1 6.36e-04 3.42e-04 NA
2. P A8MW99 Meiosis-specific protein MEI4 7.27e-03 1.24e-07 NA
2. P P28929 Tegument protein UL47 homolog NA 2.88e-04 NA
2. P Q99359 Protein RAD61 7.35e-03 7.02e-16 NA
2. P Q9N077 ATR-interacting protein (Fragment) 2.16e-02 2.66e-03 NA
2. P Q8AYS7 Centromere protein I 2.47e-02 3.90e-02 NA
2. P P51406 Bystin 3.67e-03 9.71e-07 NA
2. P P21067 Protein A47 NA 2.46e-03 NA
2. P Q4P7X6 Transcription factor IWS1 1.32e-01 2.88e-02 NA
2. P P40317 Protein SOK1 6.13e-02 1.22e-02 NA
2. P Q6P6S4 Nucleotide exchange factor SIL1 2.76e-02 3.11e-02 NA
2. P Q0IJ01 Protein zwilch homolog 1.29e-01 3.81e-04 NA
2. P P38333 Essential nuclear protein 1 5.44e-03 2.32e-04 NA
2. P F4KDF5 Protein MULTIPOLAR SPINDLE 1 4.82e-04 1.30e-02 NA
2. P C9JE40 Protein PAT1 homolog 2 1.30e-02 2.25e-05 NA
2. P C9K7F3 AM-toxin biosynthesis protein 12-2 3.06e-02 3.93e-02 NA
2. P Q20932 Uncharacterized protein byn-1 1.99e-02 4.88e-06 NA
2. P Q7SEL0 Pre-mRNA-splicing ATP-dependent RNA helicase prp-28 1.78e-01 1.32e-02 NA
2. P Q3U0S6 Ras-interacting protein 1 4.72e-02 4.60e-03 NA
2. P P30021 Tegument protein UL47 NA 5.90e-04 NA
2. P C8KI33 Protein SENSITIVE TO UV 2 1.02e-03 2.12e-11 NA
2. P Q04377 DNA damage checkpoint protein LCD1 2.88e-02 1.69e-04 NA
2. P Q80WL2 Bystin 2.13e-02 1.99e-10 NA
2. P Q13835 Plakophilin-1 1.60e-02 2.36e-03 NA
2. P P40026 DNA repair protein KRE29 2.72e-02 3.55e-02 NA
2. P Q9VVN4 ATR-interacting protein mus304 1.38e-02 8.06e-05 NA
2. P Q8WXE1 ATR-interacting protein 2.07e-02 5.44e-07 NA
2. P O60071 Uncharacterized protein C13G1.09 5.35e-03 3.48e-07 NA
3. B Q24JP3 Protein FAM178B 1.11e-16 NA 0.0
3. B Q6P9P0 SMC5-SMC6 complex localization factor protein 2 1.44e-07 NA 1.20e-59
3. B Q8IX21 SMC5-SMC6 complex localization factor protein 2 1.69e-08 NA 7.22e-56
3. B Q5REF4 SMC5-SMC6 complex localization factor protein 2 1.27e-07 NA 9.13e-56