Summary

Q8IXR9

Homolog: Q99359.
Function: Protein RAD61.

Statistics

Total GO Annotation: 76
Unique PROST Go: 76
Unique BLAST Go: 0

Total Homologs: 29
Unique PROST Homologs: 26
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q99359 (Protein RAD61) with a FATCAT P-Value: 0.00173 and RMSD of 7.99 angstrom. The sequence alignment identity is 21.0%.
Structural alignment shown in left. Query protein Q8IXR9 colored as red in alignment, homolog Q99359 colored as blue. Query protein Q8IXR9 is also shown in right top, homolog Q99359 showed in right bottom. They are colored based on secondary structures. 

  Q8IXR9 ----------MASPLPS--GFPARR---------NSRL-DV------FLRRH----L---PPEVYDAVRAYE-----PCIVVS---NSENHILKYVVLSD 57
  Q99359 MRAYGKRGPVLRTPFRSNKGLPSSSDVEFSDDDVNSVIPDVSSTISSSIADHPIEGLLDEPRKAQDSSSSFDGANEKPSSQLDSKRNDQN--VKIITSSD 98

  Q8IXR9 -RLVYLTE------N---PPKSI----RRVVALRDVVAIDLIDDYPEFLSSPDREISQH-----IRIIYSSTVLKKECKKSNSVRKFL--FPFHHTKAN- 135
  Q99359 TSMAFMKDEKLSAFNFLDGSKASKRKRRRTYQKHDANITSSIE--PD-VQDEDS-ITMHNEFESIRKIY------------NDINEFILKLP----RADD 178

  Q8IXR9 ---NKKVKEEKNGLAFWRSKESRSLKESPLRDQQESSTPSKDSTLCPRPGLKKLSLHGQGAFRP-LPSPSRRSSQSAPTTGKAVSEPSCTT------NTK 225
  Q99359 DILNKML---EN-----EMKMDDSIENNSIR------T-SKD---------KK-----YGKFRTILINKNKEN----EIMGEEVDQKANTLSLNNADNSN 245

  Q8IXR9 -EPQGLPDHNSISEIPFKCN-G-----NGN-EFYLGNSLLDSPSQSNSNL---E--KKESELHLYVISTTSSIFLHLKSSWNNYIIKATLLQ---D-P-- 306
  Q99359 AEKEGLTSTNHYNEL--K-NMGDTIKYQDDIEFLLSN----SKSNDNTTVPINEYFKKLLNLSLMIIN-DEEFFQYAKRYFKKEIIKLSFAQFRSDFPEL 337

  Q8IXR9 ----FY--------ASEFSPAIGS-----QK---PYRSEEKIKHFSQLKSELFLKDNSLRRI---LSLLMELKV-AAQKNF---ILKR--LFWKTSDLFY 377
  Q99359 ILLQGYLLHKVSESQSDFPPSFDNFSIELSKDDGKIRT-KKNKHIKKL-SHLNFED-FLRKTQFKTGLYYSLSLWEMHGNLSLDIIKRISILASNKDLFS 434

  Q8IXR9 -----FI--VNKL-------HEYL--PESRD---KNALQNQ-SQRVDE--LVACIEIIQT-LVL----MFRETET--ESSRLNTLA--------AKKGAL 440
  Q99359 RHVKTFIPLLEKLITASEFCHMYIEQPEMFDSLISN-LNNQFKDMLDDDSLIK-ILILLTNMEVHNYTLWKEADMIFQSS-MNTILESIHPLTDAK---V 528

  Q8IXR9 FNLLVIL-ISEPQIPKSCP-----V-FDIQLVAD--SALVRM---SFDAELQKLI--LEYTNTATALLYEILLVFQQGNLGLGSTKFAISWIMSFLQSCP 526
  Q99359 DNILLHLGLC-LNI---CSRENSRLKLDGKLWYDMKTIFVKMIRDGSDTE-NRLVQGLFYLN-FSFLIKQ---RKENSNLDPG----ELNLLLVELEA-- 613

  Q8IXR9 PIITFVASIVKQVVRGLSASFQLLSPCQAVLLYQQFYILKSCLRHSR-TLAEYIRNNYREEFRYFIHMPALQKRLPLCYPITQPTIQLFHEVLKLVE 622
  Q99359 ----F-KSETSQFNEGISNKIEI------ALNY-----LKSIYTSERITI----------------------------------------------- 647

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0005768 endosome
2. P GO:0006367 transcription initiation from RNA polymerase II promoter
2. P GO:0070530 K63-linked polyubiquitin modification-dependent protein binding
2. P GO:0005881 cytoplasmic microtubule
2. P GO:0001829 trophectodermal cell differentiation
2. P GO:0043008 ATP-dependent protein binding
2. P GO:0034501 protein localization to kinetochore
2. P GO:0045177 apical part of cell
2. P GO:0000245 spliceosomal complex assembly
2. P GO:0008283 cell population proliferation
2. P GO:0010976 positive regulation of neuron projection development
2. P GO:0060623 regulation of chromosome condensation
2. P GO:0043130 ubiquitin binding
2. P GO:0030688 preribosome, small subunit precursor
2. P GO:0000132 establishment of mitotic spindle orientation
2. P GO:0016573 histone acetylation
2. P GO:0042138 meiotic DNA double-strand break formation
2. P GO:0031902 late endosome membrane
2. P GO:0001825 blastocyst formation
2. P GO:0001701 in utero embryonic development
2. P GO:0016197 endosomal transport
2. P GO:0007093 mitotic cell cycle checkpoint signaling
2. P GO:0097504 Gemini of coiled bodies
2. P GO:0008180 COP9 signalosome
2. P GO:0090695 Wpl/Pds5 cohesin loading/unloading complex
2. P GO:0016251 RNA polymerase II general transcription initiation factor activity
2. P GO:1990423 RZZ complex
2. P GO:0006897 endocytosis
2. P GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0010212 response to ionizing radiation
2. P GO:0008092 cytoskeletal protein binding
2. P GO:1905339 positive regulation of cohesin unloading
2. P GO:0030515 snoRNA binding
2. P GO:1905412 negative regulation of mitotic cohesin loading
2. P GO:0000814 ESCRT II complex
2. P GO:0072710 response to hydroxyurea
2. P GO:0072517 host cell viral assembly compartment
2. P GO:0071363 cellular response to growth factor stimulus
2. P GO:0010044 response to aluminum ion
2. P GO:0005669 transcription factor TFIID complex
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0051301 cell division
2. P GO:0017124 SH3 domain binding
2. P GO:0034183 negative regulation of maintenance of mitotic sister chromatid cohesion
2. P GO:1904749 regulation of protein localization to nucleolus
2. P GO:0071922 regulation of cohesin loading
2. P GO:1902751 positive regulation of cell cycle G2/M phase transition
2. P GO:0000387 spliceosomal snRNP assembly
2. P GO:0034719 SMN-Sm protein complex
2. P GO:0042995 cell projection
2. P GO:0007283 spermatogenesis
2. P GO:0140588 chromatin looping
2. P GO:0072718 response to cisplatin
2. P GO:0010332 response to gamma radiation
2. P GO:0000800 lateral element
2. P GO:1902340 negative regulation of chromosome condensation
2. P GO:0007129 homologous chromosome pairing at meiosis
2. P GO:0000124 SAGA complex
2. P GO:0005694 chromosome
2. P GO:0008494 translation activator activity
2. P GO:0032797 SMN complex
2. P GO:0017022 myosin binding
2. P GO:0006364 rRNA processing
2. P GO:0007064 mitotic sister chromatid cohesion
2. P GO:0043328 protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
2. P GO:0010224 response to UV-B
2. P GO:0071933 Arp2/3 complex binding
2. P GO:0071407 cellular response to organic cyclic compound
2. P GO:0048477 oogenesis
2. P GO:0000077 DNA damage checkpoint signaling
2. P GO:0032266 phosphatidylinositol-3-phosphate binding
2. P GO:0005730 nucleolus
2. P GO:0006446 regulation of translational initiation
2. P GO:0061781 mitotic cohesin unloading
2. P GO:0000228 nuclear chromosome
2. P GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q4R9E9 Uncharacterized protein C12orf56 homolog 0.00e+00 1.17e-89 0.0
1. PB Q8CCC3 Uncharacterized protein C12orf56 homolog 2.00e-10 2.39e-03 0.0
1. PB Q8IXR9 Uncharacterized protein C12orf56 0 3.46e-157 0.0
2. P Q0IJ01 Protein zwilch homolog 3.28e-01 1.08e-03 NA
2. P Q21341 Protein let-99 9.18e-02 3.04e-04 NA
2. P O74462 Transcription initiation factor TFIID subunit 6 4.69e-02 3.94e-03 NA
2. P A5PK00 Vacuolar protein-sorting-associated protein 36 2.00e-02 4.17e-02 NA
2. P Q8SUN2 Uncharacterized protein ECU08_1280 5.06e-02 1.82e-04 NA
2. P Q8IXR5 Protein FAM178B 1.70e-02 9.31e-04 NA
2. P Q8BRM6 Meiosis-specific protein MEI4 3.95e-03 1.99e-02 NA
2. P Q0V9S3 CBP80/20-dependent translation initiation factor 1.07e-02 1.39e-02 NA
2. P O42260 Gem-associated protein 2 1.45e-01 5.77e-03 NA
2. P Q8BMG1 ATR-interacting protein 3.04e-03 2.76e-03 NA
2. P F5H9F9 Protein UL88 NA 1.53e-02 NA
2. P Q6IRM9 Protein zwilch homolog 2.41e-01 2.75e-02 NA
2. P A8MW99 Meiosis-specific protein MEI4 1.62e-02 4.63e-05 NA
2. P A9UNU6 Bystin 4.94e-02 5.83e-03 NA
2. P C8KI33 Protein SENSITIVE TO UV 2 3.85e-03 7.78e-03 NA
2. P O94364 Wings apart-like protein homolog 1 2.99e-03 2.70e-03 NA
2. P Q99359 Protein RAD61 1.73e-03 2.79e-07 NA
2. P Q80WL2 Bystin 5.34e-02 1.05e-02 NA
2. P Q9NZQ3 NCK-interacting protein with SH3 domain 1.63e-02 2.01e-04 NA
2. P Q9ESJ4 NCK-interacting protein with SH3 domain 3.05e-02 5.07e-05 NA
2. P Q8R060 Protein zwilch homolog 3.19e-01 2.03e-03 NA
2. P P16731 Protein UL88 NA 1.53e-02 NA
2. P Q13895 Bystin 2.35e-02 1.14e-02 NA
2. P Q8WXE1 ATR-interacting protein 6.48e-03 6.70e-03 NA
2. P O54825 Bystin 2.98e-02 8.67e-03 NA
2. P Q91XD6 Vacuolar protein-sorting-associated protein 36 2.24e-02 3.00e-02 NA