Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q7ZYD5
(Calcium-binding mitochondrial carrier protein SCaMC-2) with a FATCAT P-Value: 0.0342 and RMSD of 6.34 angstrom. The sequence alignment identity is 14.5%.
Structural alignment shown in left. Query protein Q8IY85 colored as red in alignment, homolog Q7ZYD5 colored as blue.
Query protein Q8IY85 is also shown in right top, homolog Q7ZYD5 showed in right bottom. They are colored based on secondary structures.
Q8IY85 METKVHLFCQAEENIDLLDDGSNSFA-TDLSSGTINHKKYIKFSKTIEKEISPEIRSLSPEYKKIFETSIIF--CGEEKSSDFSGEKKVGRKSLQVQQHS 97 Q7ZYD5 MARPRSLVS------PLL-SG--VFCQCDTVSGA-PHS-----HET------PA----SP---SLAAAALAADPCG----GLLCG----G------PEHE 58 Q8IY85 KRTEIIPPFLKLSKEKVTRKENSLC--KLP---NQYSVHKTSSPLCTSSAITR--EKEMLSNLYMTLYDEVTHGYL--HSKELSALHKACKIFSKIRSGK 188 Q7ZYD5 RRLQIL--FQELD----VNKDGAICINDLAVGLKRLGVHRTELEL---RKIVKAGDKDQDGQLD---FDEFVH-YLRDHEKKLRLVFKS---LDKKNDGR 142 Q8IY85 IYVNDLPVILCILR---ISISDLEMRQALKTVDIDAFQDALKIFCRIKGGRVSTD-----DVFAVLDSM-GIPINREILEEV-TKHTYIDSNHMVDIGD- 277 Q7ZYD5 I---DAQEIMQSLRDLGVNISEQQAEKILKSMD--------------KNGTMTIDWNEWRD-YHLLHSAENIP---EII--LYWKHSTI-----FDVGEN 214 Q8IY85 II----FTLNELQEQYEDVSITEGSPLNEITSDRKLSSVAGCYLKYKKKNSLSSKLPEPSISK-KLNKKSNQYYSKIMENDDLESKRPKNTWQIRKFLGG 372 Q7ZYD5 LLVPDEFTVEEKQ--------T-GMWW------RHL--VAG-----GGAGAVSRTCTAP-LDRLKV----------LMQ---VHASRSNN----MSILGG 274 Q8IY85 V------GSSNVGVQEPYSKNGINFKKHSEKGEI----HDS-K----SKPQSLK-----SSTSLSKSLDKSDISSIPKLQ-KPAVRKHSSLQKQVSSTEK 451 Q7ZYD5 FTHMIREG----GFRSLWRGNGINVIKIAPESAIKFMAYEQIKRIIGSNQETLGIHERFVAGSLAGVIAQSSIYPMEVLKTRMALRKTGQYQGVLDCGKK 370 Q8IY85 TAISTLENFCEAISKLQENYIAAEELQSILPSTGINL-----LDEEF-QKIVTDTSRNENGMVELDDFVNALAKERSFPECNALPGVIKAIDKIKDKNVD 545 Q7ZYD5 --I-LLQ---EGLSAFYKGYV--PNMLGIIPYAGIDLAVYETLKNAWLQRYATSSA--DPGV-----FV-LLA-------C----GTVS----------- 432 Q8IY85 YEDLNTC--LQNFGIYLSKPEFKKITELTEAGE---T-KKVNFKEFIDT---------MMSNTECFSEKLVLPDAIETLDDLRKETMSVSDLWNTLSSLN 630 Q7ZYD5 ----STCGQLASYPLALVRTRMQ--AEASVEGAPQMTMSKL-FKHIVKTEGAFGLYRGLAPN---FM-K-VIP-AV-SISYVVYENLKL-----TL-GVQ 512 Q8IY85 SNLKKDEFLAALELVTVDEGDKVQFEEFAKVVRNMRDAARLEELQEVVLAADLLEGDMIAGKNLEDFLRNVGIKSPKEEVEKILQSDFVSEDNMVNIKDC 730 Q7ZYD5 SR-------------------------------------------------------------------------------------------------- 514 Q8IY85 MRALRDTQKFSNYIDFRKEASNLKLPKVNEIKEAANILSHVDNGKIGIPDLEHALKCLNVNLTEEDFNEALNCCNVSDNMEVDLKDFLMKMKESPHFQKS 830 Q7ZYD5 ---------------------------------------------------------------------------------------------------- 514 Q8IY85 KATQILLATTQILQNDLVDVSDLKTLLMDKDLHTANAILTVMLRHVPEHESGKVSIQEFMTKLSDILTIPKAAGKFYLICTYCPDLERQAVVYMLKTIQD 930 Q7ZYD5 ---------------------------------------------------------------------------------------------------- 514 Q8IY85 SIVKAQVSKKQYNMNIKQHKISLHNFCLNSKANIAKLNPNSKF 973 Q7ZYD5 ------------------------------------------- 514
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005509 | calcium ion binding |
| 2. P | GO:0001227 | DNA-binding transcription repressor activity, RNA polymerase II-specific |
| 2. P | GO:0000981 | DNA-binding transcription factor activity, RNA polymerase II-specific |
| 2. P | GO:0006366 | transcription by RNA polymerase II |
| 2. P | GO:0014886 | transition between slow and fast fiber |
| 2. P | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 2. P | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding |
| 3. B | GO:0019904 | protein domain specific binding |
| 3. B | GO:0051028 | mRNA transport |
| 3. B | GO:0010880 | regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum |
| 3. B | GO:0051401 | CH domain binding |
| 3. B | GO:0016060 | metarhodopsin inactivation |
| 3. B | GO:0051412 | response to corticosterone |
| 3. B | GO:0044615 | nuclear pore nuclear basket |
| 3. B | GO:0055117 | regulation of cardiac muscle contraction |
| 3. B | GO:0035307 | positive regulation of protein dephosphorylation |
| 3. B | GO:0098901 | regulation of cardiac muscle cell action potential |
| 3. B | GO:0016460 | myosin II complex |
| 3. B | GO:1901842 | negative regulation of high voltage-gated calcium channel activity |
| 3. B | GO:2001259 | positive regulation of cation channel activity |
| 3. B | GO:0030426 | growth cone |
| 3. B | GO:0018105 | peptidyl-serine phosphorylation |
| 3. B | GO:0030234 | enzyme regulator activity |
| 3. B | GO:0072542 | protein phosphatase activator activity |
| 3. B | GO:0030235 | nitric-oxide synthase regulator activity |
| 3. B | GO:0010856 | adenylate cyclase activator activity |
| 3. B | GO:0007190 | activation of adenylate cyclase activity |
| 3. B | GO:0051343 | positive regulation of cyclic-nucleotide phosphodiesterase activity |
| 3. B | GO:0031477 | myosin VII complex |
| 3. B | GO:0016237 | lysosomal microautophagy |
| 3. B | GO:1903525 | regulation of membrane tubulation |
| 3. B | GO:0005513 | detection of calcium ion |
| 3. B | GO:0060315 | negative regulation of ryanodine-sensitive calcium-release channel activity |
| 3. B | GO:0036156 | inner dynein arm |
| 3. B | GO:0046777 | protein autophosphorylation |
| 3. B | GO:0005246 | calcium channel regulator activity |
| 3. B | GO:0060316 | positive regulation of ryanodine-sensitive calcium-release channel activity |
| 3. B | GO:0031475 | myosin V complex |
| 3. B | GO:0032465 | regulation of cytokinesis |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0008076 | voltage-gated potassium channel complex |
| 3. B | GO:1902584 | positive regulation of response to water deprivation |
| 3. B | GO:0005935 | cellular bud neck |
| 3. B | GO:0019901 | protein kinase binding |
| 3. B | GO:0019722 | calcium-mediated signaling |
| 3. B | GO:0001975 | response to amphetamine |
| 3. B | GO:1903476 | protein localization to cell division site involved in mitotic actomyosin contractile ring assembly |
| 3. B | GO:0072499 | photoreceptor cell axon guidance |
| 3. B | GO:0032038 | myosin II heavy chain binding |
| 3. B | GO:0032516 | positive regulation of phosphoprotein phosphatase activity |
| 3. B | GO:0000922 | spindle pole |
| 3. B | GO:0070855 | myosin VI head/neck binding |
| 3. B | GO:0021762 | substantia nigra development |
| 3. B | GO:0005823 | central plaque of spindle pole body |
| 3. B | GO:0090151 | establishment of protein localization to mitochondrial membrane |
| 3. B | GO:0010881 | regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion |
| 3. B | GO:0008179 | adenylate cyclase binding |
| 3. B | GO:0071942 | XPC complex |
| 3. B | GO:0010941 | regulation of cell death |
| 3. B | GO:0019855 | calcium channel inhibitor activity |
| 3. B | GO:0097718 | disordered domain specific binding |
| 3. B | GO:0034704 | calcium channel complex |
| 3. B | GO:0051300 | spindle pole body organization |
| 3. B | GO:0004683 | calmodulin-dependent protein kinase activity |
| 3. B | GO:0031683 | G-protein beta/gamma-subunit complex binding |
| 3. B | GO:1990274 | mitotic actomyosin contractile ring disassembly |
| 3. B | GO:0031954 | positive regulation of protein autophosphorylation |
| 3. B | GO:0050998 | nitric-oxide synthase binding |
| 3. B | GO:0000131 | incipient cellular bud site |
| 3. B | GO:0005347 | ATP transmembrane transporter activity |
| 3. B | GO:0097729 | 9+2 motile cilium |
| 3. B | GO:2000300 | regulation of synaptic vesicle exocytosis |
| 3. B | GO:0031800 | type 3 metabotropic glutamate receptor binding |
| 3. B | GO:1903087 | mitotic spindle pole body duplication |
| 3. B | GO:0000742 | karyogamy involved in conjugation with cellular fusion |
| 3. B | GO:0005876 | spindle microtubule |
| 3. B | GO:0010099 | regulation of photomorphogenesis |
| 3. B | GO:0006903 | vesicle targeting |
| 3. B | GO:0035071 | salivary gland cell autophagic cell death |
| 3. B | GO:0051383 | kinetochore organization |
| 3. B | GO:0048306 | calcium-dependent protein binding |
| 3. B | GO:0043209 | myelin sheath |
| 3. B | GO:0032036 | myosin heavy chain binding |
| 3. B | GO:0000142 | cellular bud neck contractile ring |
| 3. B | GO:0007114 | cell budding |
| 3. B | GO:1901841 | regulation of high voltage-gated calcium channel activity |
| 3. B | GO:0002027 | regulation of heart rate |
| 3. B | GO:0043539 | protein serine/threonine kinase activator activity |
| 3. B | GO:0000086 | G2/M transition of mitotic cell cycle |
| 3. B | GO:0044325 | transmembrane transporter binding |
| 3. B | GO:0016028 | rhabdomere |
| 3. B | GO:0051592 | response to calcium ion |
| 3. B | GO:0016059 | deactivation of rhodopsin mediated signaling |
| 3. B | GO:1990456 | mitochondrion-endoplasmic reticulum membrane tethering |
| 3. B | GO:0016061 | regulation of light-activated channel activity |
| 3. B | GO:0031489 | myosin V binding |
| 3. B | GO:1901339 | regulation of store-operated calcium channel activity |
| 3. B | GO:1905913 | negative regulation of calcium ion export across plasma membrane |
| 3. B | GO:0007099 | centriole replication |
| 3. B | GO:0016240 | autophagosome membrane docking |
| 3. B | GO:0140056 | organelle localization by membrane tethering |
| 3. B | GO:0031997 | N-terminal myristoylation domain binding |
| 3. B | GO:0042052 | rhabdomere development |
| 3. B | GO:1901844 | regulation of cell communication by electrical coupling involved in cardiac conduction |
| 3. B | GO:0071902 | positive regulation of protein serine/threonine kinase activity |
| 3. B | GO:0010800 | positive regulation of peptidyl-threonine phosphorylation |
| 3. B | GO:0070390 | transcription export complex 2 |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:0050848 | regulation of calcium-mediated signaling |
| 3. B | GO:0051000 | positive regulation of nitric-oxide synthase activity |
| 3. B | GO:0031432 | titin binding |
| 3. B | GO:0043548 | phosphatidylinositol 3-kinase binding |
| 3. B | GO:0005825 | half bridge of spindle pole body |
| 3. B | GO:1902494 | catalytic complex |
| 3. B | GO:0016062 | adaptation of rhodopsin mediated signaling |
| 3. B | GO:1900242 | regulation of synaptic vesicle endocytosis |
| 3. B | GO:0005814 | centriole |
| 3. B | GO:0032795 | heterotrimeric G-protein binding |
| 3. B | GO:1901020 | negative regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:0031966 | mitochondrial membrane |
| 3. B | GO:1902441 | protein localization to meiotic spindle pole body |
| 3. B | GO:1901527 | abscisic acid-activated signaling pathway involved in stomatal movement |
| 3. B | GO:0061496 | half bridge of mitotic spindle pole body |
| 3. B | GO:0030672 | synaptic vesicle membrane |
| 3. B | GO:0000278 | mitotic cell cycle |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0035974 | meiotic spindle pole body |
| 3. B | GO:0032391 | photoreceptor connecting cilium |
| 3. B | GO:0031476 | myosin VI complex |
| 3. B | GO:0043388 | positive regulation of DNA binding |
| 3. B | GO:0005813 | centrosome |
| 3. B | GO:0032991 | protein-containing complex |
| 3. B | GO:0120155 | MIH complex |
| 3. B | GO:0047485 | protein N-terminus binding |
| 3. B | GO:0010801 | negative regulation of peptidyl-threonine phosphorylation |
| 3. B | GO:0051296 | establishment of meiotic spindle orientation |
| 3. B | GO:0009931 | calcium-dependent protein serine/threonine kinase activity |
| 3. B | GO:0031982 | vesicle |
| 3. B | GO:0060314 | regulation of ryanodine-sensitive calcium-release channel activity |
| 3. B | GO:0035556 | intracellular signal transduction |
| 3. B | GO:0005934 | cellular bud tip |
| 3. B | GO:0010152 | pollen maturation |
| 3. B | GO:0090150 | establishment of protein localization to membrane |
| 3. B | GO:0030017 | sarcomere |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8IY85 | EF-hand calcium-binding domain-containing protein 13 | 0 | 9.68e-145 | 0.0 |
| 2. P | Q9UHL9 | General transcription factor II-I repeat domain-containing protein 1 | 5.82e-01 | 5.87e-04 | NA |
| 2. P | Q8BUG5 | Calcyphosin-2 | 1.41e-01 | 2.43e-02 | NA |
| 3. B | P24044 | Calmodulin | 1.78e-01 | NA | 0.016 |
| 3. B | P0DP31 | Calmodulin-3 | 1.90e-01 | NA | 0.020 |
| 3. B | P0DP35 | Calmodulin-2 B | 1.76e-01 | NA | 0.020 |
| 3. B | P93171 | Calmodulin | 1.78e-01 | NA | 0.001 |
| 3. B | Q9D6P8 | Calmodulin-like protein 3 | 1.78e-01 | NA | 0.018 |
| 3. B | P53440 | Calmodulin, flagellar | 1.98e-01 | NA | 0.028 |
| 3. B | P62152 | Calmodulin | 1.82e-01 | NA | 0.019 |
| 3. B | P07463 | Calmodulin | 1.75e-01 | NA | 0.049 |
| 3. B | Q9GRJ1 | Calmodulin | 1.80e-01 | NA | 0.005 |
| 3. B | Q2TBN3 | Centrin-2 | 1.24e-01 | NA | 0.022 |
| 3. B | P04464 | Calmodulin | 1.83e-01 | NA | 2.62e-04 |
| 3. B | P04353 | Calmodulin | NA | NA | 0.001 |
| 3. B | Q7DMN9 | Calmodulin-5/6/7/8 | 1.77e-01 | NA | 0.002 |
| 3. B | A3E4F9 | Calmodulin | 1.73e-01 | NA | 0.006 |
| 3. B | P02597 | Calmodulin, striated muscle | 2.80e-01 | NA | 0.013 |
| 3. B | P0DH96 | Calmodulin-4 | 1.77e-01 | NA | 6.07e-04 |
| 3. B | A2WN93 | Calmodulin-1 | 1.76e-01 | NA | 0.001 |
| 3. B | Q41420 | Putative calmodulin-3 (Fragment) | 2.17e-01 | NA | 8.77e-05 |
| 3. B | P93087 | Calmodulin | 1.74e-01 | NA | 0.002 |
| 3. B | P62157 | Calmodulin | 1.86e-01 | NA | 0.020 |
| 3. B | Q9LIK5 | Calmodulin-like protein 11 | 1.36e-01 | NA | 2.58e-05 |
| 3. B | P62160 | Calmodulin | 1.74e-01 | NA | 0.020 |
| 3. B | Q71UH6 | Calmodulin | 1.74e-01 | NA | 0.020 |
| 3. B | Q2R1Z5 | Putative calmodulin-like protein 6 | 1.31e-01 | NA | 0.027 |
| 3. B | A4UHC0 | Calmodulin | 1.70e-01 | NA | 0.006 |
| 3. B | P0DH97 | Calmodulin-2 | 1.77e-01 | NA | 0.001 |
| 3. B | Q0JNS6 | Calmodulin-1 | 1.77e-01 | NA | 0.001 |
| 3. B | Q40302 | Calmodulin | 2.97e-01 | NA | 0.011 |
| 3. B | P23286 | Calmodulin | 2.83e-01 | NA | 0.021 |
| 3. B | Q9UB37 | Calmodulin-2 | 1.87e-01 | NA | 0.015 |
| 3. B | Q9R1K9 | Centrin-2 | 1.36e-01 | NA | 0.015 |
| 3. B | P17928 | Calmodulin | 1.81e-01 | NA | 0.001 |
| 3. B | O97341 | Calmodulin | 1.71e-01 | NA | 0.020 |
| 3. B | Q7ZYD5 | Calcium-binding mitochondrial carrier protein SCaMC-2 | 3.42e-02 | NA | 0.008 |
| 3. B | Q7Y052 | Calmodulin | 1.77e-01 | NA | 0.001 |
| 3. B | P0DH95 | Calmodulin-1 | 1.78e-01 | NA | 6.07e-04 |
| 3. B | Q682T9 | Calmodulin-5 | 1.76e-01 | NA | 0.001 |
| 3. B | P0DP26 | Calmodulin-1 | 1.87e-01 | NA | 0.020 |
| 3. B | Q5XH95 | Calcium-binding mitochondrial carrier protein SCaMC-2 | 8.07e-02 | NA | 0.039 |
| 3. B | P62156 | Calmodulin | 1.83e-01 | NA | 0.020 |
| 3. B | P59220 | Calmodulin-7 | 1.78e-01 | NA | 0.001 |
| 3. B | P48976 | Calmodulin | 1.81e-01 | NA | 0.031 |
| 3. B | A2WNH1 | Calmodulin-3 | 1.75e-01 | NA | 0.002 |
| 3. B | Q71UH5 | Calmodulin | 2.91e-01 | NA | 0.010 |
| 3. B | Q8TD86 | Calmodulin-like protein 6 | 1.23e-01 | NA | 0.034 |
| 3. B | P05434 | Caltractin | 1.52e-01 | NA | 6.20e-04 |
| 3. B | Q39752 | Calmodulin | 1.99e-01 | NA | 0.001 |
| 3. B | A2Y609 | Calmodulin-2 | 1.76e-01 | NA | 7.63e-04 |
| 3. B | Q9S9V0 | Calcium-dependent protein kinase 31 | 2.71e-01 | NA | 6.36e-04 |
| 3. B | P21251 | Calmodulin | 1.78e-01 | NA | 0.025 |
| 3. B | P05932 | Calmodulin-beta (Fragment) | 1.69e-01 | NA | 0.030 |
| 3. B | Q6YNX6 | Calmodulin | 1.78e-01 | NA | 0.020 |
| 3. B | Q9U6D3 | Calmodulin | 1.78e-01 | NA | 0.015 |
| 3. B | P41208 | Centrin-2 | 2.75e-01 | NA | 0.011 |
| 3. B | O94739 | Calmodulin | 1.71e-01 | NA | 0.004 |
| 3. B | P62200 | Calmodulin-1/11/16 | 1.78e-01 | NA | 0.001 |
| 3. B | O96102 | Calmodulin | 2.00e-01 | NA | 0.006 |
| 3. B | Q0JNL7 | Calmodulin-3 | 1.76e-01 | NA | 0.001 |
| 3. B | Q8S1Y9 | Calmodulin-like protein 1 | 1.55e-01 | NA | 3.13e-04 |
| 3. B | P0DP27 | Calmodulin-2 | 1.75e-01 | NA | 0.020 |
| 3. B | Q6PI52 | Calmodulin | 1.78e-01 | NA | 0.020 |
| 3. B | Q7T3T2 | Calmodulin | 1.74e-01 | NA | 0.023 |
| 3. B | P02598 | Calmodulin | 1.74e-01 | NA | 0.006 |
| 3. B | P62201 | Calmodulin | 1.81e-01 | NA | 0.001 |
| 3. B | P62163 | Calmodulin-2 | 1.85e-01 | NA | 0.001 |
| 3. B | P62203 | Calmodulin | 1.83e-01 | NA | 0.016 |
| 3. B | P62184 | Calmodulin | 1.74e-01 | NA | 0.022 |
| 3. B | Q2QY37 | Calcium-dependent protein kinase 26 | 1.04e-01 | NA | 0.014 |
| 3. B | P27164 | Calmodulin-related protein | 2.68e-01 | NA | 1.27e-04 |
| 3. B | P0DP23 | Calmodulin-1 | 1.87e-01 | NA | 0.020 |
| 3. B | Q07167 | 16 kDa calcium-binding protein | 2.24e-01 | NA | 0.016 |
| 3. B | Q95NR9 | Calmodulin | 1.84e-01 | NA | 0.013 |
| 3. B | Q5U206 | Calmodulin-like protein 3 | 1.77e-01 | NA | 0.023 |
| 3. B | Q6F332 | Calmodulin-2 | 1.77e-01 | NA | 7.63e-04 |
| 3. B | P62202 | Calmodulin | 1.75e-01 | NA | 0.001 |
| 3. B | Q2RAV0 | Calcium-dependent protein kinase 25 | 3.34e-01 | NA | 0.014 |
| 3. B | O23184 | Calcium-binding protein CML19 | 1.66e-01 | NA | 0.039 |
| 3. B | P62148 | Calmodulin-1 | 1.75e-01 | NA | 0.019 |
| 3. B | P62147 | Calmodulin-1 | 1.76e-01 | NA | 0.019 |
| 3. B | P53141 | Myosin light chain 1 | 7.87e-02 | NA | 0.010 |
| 3. B | P0DH98 | Calmodulin-3 | 1.79e-01 | NA | 0.001 |
| 3. B | P62150 | Calmodulin-A (Fragment) | 3.29e-01 | NA | 0.016 |
| 3. B | Q40642 | Calmodulin-like protein 1 | 1.54e-01 | NA | 3.10e-04 |
| 3. B | P02589 | Troponin C, skeletal muscle | 1.59e-01 | NA | 0.016 |
| 3. B | P41040 | Calmodulin | 2.02e-01 | NA | 0.010 |
| 3. B | P62144 | Calmodulin | 1.97e-01 | NA | 0.020 |
| 3. B | Q9NZT1 | Calmodulin-like protein 5 | 2.15e-01 | NA | 6.76e-05 |
| 3. B | P62145 | Calmodulin | 1.89e-01 | NA | 0.019 |
| 3. B | P62162 | Calmodulin | 1.77e-01 | NA | 0.001 |
| 3. B | P05419 | Neo-calmodulin (Fragment) | 3.59e-01 | NA | 0.010 |
| 3. B | Q96GE6 | Calmodulin-like protein 4 | 3.24e-01 | NA | 0.003 |
| 3. B | P11120 | Calmodulin | 1.78e-01 | NA | 0.007 |
| 3. B | Q06827 | Caltractin | 2.41e-01 | NA | 0.045 |
| 3. B | Q06580 | Myosin light chain 2 | 5.50e-01 | NA | 0.017 |
| 3. B | A3E4D8 | Calmodulin | 1.73e-01 | NA | 0.006 |
| 3. B | O16305 | Calmodulin | 1.76e-01 | NA | 0.016 |
| 3. B | Q95NI4 | Calmodulin | 1.76e-01 | NA | 0.027 |
| 3. B | Q948R0 | Calmodulin-like protein 5 | 1.91e-01 | NA | 0.035 |
| 3. B | P62199 | Calmodulin-1 | 1.74e-01 | NA | 0.001 |
| 3. B | A8I1Q0 | Calmodulin | 1.73e-01 | NA | 0.019 |
| 3. B | Q03509 | Calmodulin-6 | 1.77e-01 | NA | 4.78e-04 |
| 3. B | P62149 | Calmodulin | 1.88e-01 | NA | 0.020 |
| 3. B | P27166 | Calmodulin | 1.68e-01 | NA | 0.003 |
| 3. B | P84339 | Calmodulin | 1.81e-01 | NA | 0.022 |
| 3. B | P04352 | Calmodulin | 1.60e-01 | NA | 4.34e-04 |
| 3. B | P27161 | Calmodulin | 1.77e-01 | NA | 7.21e-04 |
| 3. B | P0DP28 | Calmodulin-3 | 1.90e-01 | NA | 0.020 |
| 3. B | P18061 | Calmodulin | 1.83e-01 | NA | 0.022 |
| 3. B | P0DP33 | Calmodulin-1 | 1.83e-01 | NA | 0.020 |
| 3. B | P15094 | Calmodulin | 1.71e-01 | NA | 0.021 |
| 3. B | P11121 | Calmodulin | 1.75e-01 | NA | 0.024 |
| 3. B | Q9N1Q9 | Calcium-binding protein 2 | 4.22e-01 | NA | 0.022 |
| 3. B | Q6AVI8 | Calcium-dependent protein kinase 9 | 8.29e-02 | NA | 0.025 |
| 3. B | Q0IUU4 | Putative calmodulin-like protein 2 | 1.61e-01 | NA | 0.001 |
| 3. B | P27482 | Calmodulin-like protein 3 | 1.76e-01 | NA | 0.022 |
| 3. B | P0DP34 | Calmodulin-2 A | 1.77e-01 | NA | 0.020 |
| 3. B | Q9JM83 | Calmodulin-4 | 1.92e-01 | NA | 0.006 |
| 3. B | P0DP29 | Calmodulin-1 | 1.87e-01 | NA | 0.020 |
| 3. B | Q8X187 | Calmodulin | 1.74e-01 | NA | 0.004 |
| 3. B | Q5RAD2 | Calmodulin | 2.89e-01 | NA | 0.020 |
| 3. B | P02594 | Calmodulin | 1.78e-01 | NA | 0.025 |
| 3. B | P62154 | Calmodulin | 1.83e-01 | NA | 0.019 |
| 3. B | Q6NLQ6 | Calcium-dependent protein kinase 32 | 2.02e-01 | NA | 0.010 |
| 3. B | P0DP24 | Calmodulin-2 | 1.70e-01 | NA | 0.020 |
| 3. B | P69098 | Calmodulin | 2.37e-01 | NA | 0.028 |
| 3. B | Q0IQB6 | Calmodulin-like protein 3 | 2.21e-01 | NA | 0.007 |
| 3. B | P62151 | Calmodulin | 1.74e-01 | NA | 0.020 |
| 3. B | P02595 | Calmodulin | 1.89e-01 | NA | 0.031 |
| 3. B | Q9ZSA4 | Calcium-dependent protein kinase 27 | 2.53e-01 | NA | 0.018 |
| 3. B | P13868 | Calmodulin-1 | 1.65e-01 | NA | 7.07e-04 |
| 3. B | O23320 | Calmodulin-like protein 8 | 1.85e-01 | NA | 6.94e-05 |
| 3. B | O82659 | Probable calcium-binding protein CML20 | 1.89e-01 | NA | 0.001 |
| 3. B | O74435 | Cell division control protein 31 | 1.20e-01 | NA | 0.043 |
| 3. B | P69097 | Calmodulin | 1.90e-01 | NA | 0.028 |
| 3. B | Q7DMP0 | Calmodulin-2/4 (Fragment) | 3.13e-01 | NA | 0.001 |
| 3. B | O82018 | Calmodulin | 1.71e-01 | NA | 1.82e-04 |
| 3. B | A3E3H0 | Calmodulin | 1.74e-01 | NA | 0.006 |
| 3. B | P0DP25 | Calmodulin-3 | 1.87e-01 | NA | 0.020 |
| 3. B | P02587 | Troponin C, skeletal muscle | 1.58e-01 | NA | 0.042 |
| 3. B | P27163 | Calmodulin-2 | 1.84e-01 | NA | 2.25e-04 |
| 3. B | P0DP30 | Calmodulin-2 | 1.82e-01 | NA | 0.020 |
| 3. B | P27165 | Calmodulin | 1.86e-01 | NA | 0.010 |
| 3. B | Q3T0E8 | Calmodulin-like protein 4 | 1.11e-01 | NA | 0.012 |
| 3. B | O02367 | Calmodulin | 1.88e-01 | NA | 0.013 |
| 3. B | P04630 | Calmodulin-like protein | 1.60e-01 | NA | 0.014 |
| 3. B | P06787 | Calmodulin | 1.52e-01 | NA | 2.36e-06 |
| 3. B | Q84MN0 | Calmodulin-like protein 4 | 1.58e-01 | NA | 8.39e-04 |
| 3. B | Q6IT78 | Calmodulin | 1.75e-01 | NA | 0.020 |
| 3. B | P62146 | Calmodulin-alpha (Fragment) | 2.50e-01 | NA | 0.021 |
| 3. B | Q9HFY6 | Calmodulin | 1.77e-01 | NA | 0.016 |
| 3. B | P62153 | Calmodulin-A | 1.84e-01 | NA | 0.019 |
| 3. B | O18757 | Calcium-binding mitochondrial carrier protein SCaMC-1 | 8.48e-02 | NA | 0.014 |