Summary

Q8IYA2

Homolog: B8JK76.
Function: Serologically defined colon cancer antigen 8 homolog.

Statistics

Total GO Annotation: 234
Unique PROST Go: 216
Unique BLAST Go: 15

Total Homologs: 141
Unique PROST Homologs: 105
Unique BLAST Homologs: 31

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was B8JK76 (Serologically defined colon cancer antigen 8 homolog) with a FATCAT P-Value: 4.44e-09 and RMSD of 5.37 angstrom. The sequence alignment identity is 17.0%.
Structural alignment shown in left. Query protein Q8IYA2 colored as red in alignment, homolog B8JK76 colored as blue. Query protein Q8IYA2 is also shown in right top, homolog B8JK76 showed in right bottom. They are colored based on secondary structures. 

  Q8IYA2 MVSWGGEKRGGAEGSPKPAVYATRKTGSVRSQEDQWYLGYPGDQWSSGFSYSWWKNSVGSESKHGEGALDQPQHDVRLEDLGELHRAARSGDVPGVEHVL 100
  B8JK76 ---------------------------------------------------------------------------------------------------- 0

  Q8IYA2 VPGDTGVDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPDWHPTNLTLSDETCQRSKNLKVDDKCPSVSPSMPENQSATKELGQMNLTEREKMDTGVK--T 198
  B8JK76 ------------------------------------------------------------------MKPSL-ESDEE-EELGALQKTLRERANRSIQHLS 32

  Q8IYA2 SQEPEM----AKDCDREDIP-IYPVLPHVQKSEEMRIEQGKLEWKNQLKLVINELKQRFGEIYEKYKIPACPEEEPLLDNSTRGTDVKDIPFNLTNNIPG 293
  B8JK76 S----MLAGHSSDSETSE-PNQQELLSSVQQNPCSPVQQS--EAVSQLRSLLQ-MKTKDANI---QSL--SPSRRKLA--AKRATD--D----------G 105

  Q8IYA2 CEEEDASEISVSVVFETFPEQKEPSLKNIIHSYYHPYSGSQ-EHVCQSSSKLHLH-ENKLDCDN---DNKPGIG-HIFSTDKNFHNDASTKKARNPEVVT 387
  B8JK76 ----SSS---------------QPGVHNLV-----PIINNQSEYI-Q-----HLEAEVKF-CKEELLEMKQRVRVVIVENEK-LHHEL---KAK-----T 165

  Q8IYA2 VE--MKEDQEFDLQMTKNMNQNSDSGSTNNYKSLKPKLENLSSLPPDSDRTSEVYLHEELQQDMQKFK----NEVNTLEEEFLALKKENVQLHKEVEEEM 481
  B8JK76 IEDTLKE-YTF-VDSTLNMEHTAE----N---TLK---ERLGSVNQAED-------H-KWRKEMEQLKCLYQAQTETLEAQVVSLKKDLACIQKEYEE-- 243

  Q8IYA2 EKHRSNSTELSGTLTDGTTVGNDDDGLNQQIPRKENGEHDRLALKQENEEKRNADMLYNKDSEQLRIKEEECGKVVETKQQLKWNLRRLVK---ELRTVV 578
  B8JK76 SKERLRHKE-AMAVAAGT--G-------QRV----SG----LCLKCAQHE---A-VL----AE------------THTNVHVQ-SIERLTKERDELMTVL 304

  Q8IYA2 ----QERNDAQKQLSEEQDARILQDQILTSKQKELEMA-----QKKR---NPEISHRHQKEKDLFHENCMLQEEIALLRLEIDTIKNQNK--QKEKKYFE 664
  B8JK76 CSLRASQTDAQQR---EWGA---YQQV---KQ-AVEMAEEANLEKTRALVQCE--HFHN---ELTRQRERLERELA---SEQDKISQAREAARSESK--- 383

  Q8IYA2 DIEVVKEKNDNLQKIIKRNEETLTETILQYSGQLNNLTAE---NKMLNSELENGKENQERLEI-EMESYR-C---R--LAAAVHDCDQSQTARDLKLDFQ 754
  B8JK76 -----KER-EELMQTLS----SLSQKVAELQGLLDR--GERDRNS-LNSQLE---EAYKKLTVQETDSSKMCAELRFLLSQA--QLKKEEAERDVR-DIS 464

  Q8IYA2 RT--RQEWVRLHD----KMKVDMSG----L--------QAKNEI--LSEKLSNAESKINSLQIQLHNTR---DA----LGRESLIL----ERVQRDLSQT 823
  B8JK76 SKLGRQ--LELAEQEVQKLGVELSGYRQRLEEAQRAEGRARAEAAGLAEGLSRA-------QRQLHLTRQEKEASERCCGEDMAALTFQAQRRERELTQT 555

  Q8IYA2 QCQKKETEQMYQSKLKKYIAKQESVEERLSQLQSENMLLRQQL-DDVHKKANSQEKTI-STIQDQFHSAAKNLQAESEKQILSLQEKNKELMDEYNHLK- 920
  B8JK76 ------LQQM-EAQHEKSV--RET--DAL--LSAQNSLIR-KLKEECH--------TLGAKLEE----LAQSSRAEMEQ--LSL-ER-EHLQESAEKLRG 625

  Q8IYA2 --ERM-DQCEKEKAGR-----KIDLTEAQETVPSRCLHLDAENEVLQLQQTLFSMKAIQKQCETLQKNKKQLKQEVVNLKSYME--RNMLERGEAEWHKL 1010
  B8JK76 RCEEMEEQCVQH--GRMHQRMKQRL---QQ-LDQHCQA--SSQQVLQL---L-SR---QKQ---LMQERQQLTEDLHSLKSQVHAGKRM-DR-------L 699

  Q8IYA2 LIEERARKEIEEKLNEAILTLQKQAAVSHEQLAQLREDNTTSIKTQMELTVIDLESEISRIKTSQADFNKTKLERYKELYLEEVKVRESLSNELSRTNEM 1110
  B8JK76 AV-------------------------------------------------------------------------------------------------- 701

  Q8IYA2 IAEVSTQLTVEKEQTRSRSLFTAYATRPVLESPCVGNLNDSEGLNRKHIPRKKRSALKDMESYLLKMQQKLQNDLTAEVAGSSQTGLHRIPQCSSFSSSS 1210
  B8JK76 ---------------------------------------------------------------------------------------------------- 701

  Q8IYA2 LHLLLCSICQPFFLILQLLLNMNLDPI 1237
  B8JK76 --------------------------- 701

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0045599 negative regulation of fat cell differentiation
1. PB GO:0070373 negative regulation of ERK1 and ERK2 cascade
1. PB GO:0005813 centrosome
2. P GO:0045616 regulation of keratinocyte differentiation
2. P GO:0097539 ciliary transition fiber
2. P GO:0016055 Wnt signaling pathway
2. P GO:0098831 presynaptic active zone cytoplasmic component
2. P GO:0060050 positive regulation of protein glycosylation
2. P GO:0030374 nuclear receptor coactivator activity
2. P GO:0090161 Golgi ribbon formation
2. P GO:0043296 apical junction complex
2. P GO:0071539 protein localization to centrosome
2. P GO:0005874 microtubule
2. P GO:0050729 positive regulation of inflammatory response
2. P GO:0032059 bleb
2. P GO:0001934 positive regulation of protein phosphorylation
2. P GO:0010375 stomatal complex patterning
2. P GO:0035148 tube formation
2. P GO:0048786 presynaptic active zone
2. P GO:0051294 establishment of spindle orientation
2. P GO:0001819 positive regulation of cytokine production
2. P GO:0055037 recycling endosome
2. P GO:0030010 establishment of cell polarity
2. P GO:0034451 centriolar satellite
2. P GO:1902993 positive regulation of amyloid precursor protein catabolic process
2. P GO:0098882 structural constituent of presynaptic active zone
2. P GO:0150105 protein localization to cell-cell junction
2. P GO:0051058 negative regulation of small GTPase mediated signal transduction
2. P GO:0001675 acrosome assembly
2. P GO:0085032 modulation by symbiont of host I-kappaB kinase/NF-kappaB cascade
2. P GO:0031032 actomyosin structure organization
2. P GO:0032275 luteinizing hormone secretion
2. P GO:0032091 negative regulation of protein binding
2. P GO:0030334 regulation of cell migration
2. P GO:0010497 plasmodesmata-mediated intercellular transport
2. P GO:0009101 glycoprotein biosynthetic process
2. P GO:0051224 negative regulation of protein transport
2. P GO:0048193 Golgi vesicle transport
2. P GO:0046602 regulation of mitotic centrosome separation
2. P GO:0030426 growth cone
2. P GO:0000138 Golgi trans cisterna
2. P GO:0018105 peptidyl-serine phosphorylation
2. P GO:0007030 Golgi organization
2. P GO:0071394 cellular response to testosterone stimulus
2. P GO:1905832 positive regulation of spindle assembly
2. P GO:1902961 positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process
2. P GO:0008017 microtubule binding
2. P GO:0007020 microtubule nucleation
2. P GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
2. P GO:0048790 maintenance of presynaptic active zone structure
2. P GO:0120103 centriolar subdistal appendage
2. P GO:0045019 negative regulation of nitric oxide biosynthetic process
2. P GO:0051645 Golgi localization
2. P GO:0001837 epithelial to mesenchymal transition
2. P GO:0034994 microtubule organizing center attachment site organization
2. P GO:0097431 mitotic spindle pole
2. P GO:0007266 Rho protein signal transduction
2. P GO:0032956 regulation of actin cytoskeleton organization
2. P GO:0090166 Golgi disassembly
2. P GO:0010595 positive regulation of endothelial cell migration
2. P GO:0006939 smooth muscle contraction
2. P GO:0051988 regulation of attachment of spindle microtubules to kinetochore
2. P GO:0098978 glutamatergic synapse
2. P GO:0000301 retrograde transport, vesicle recycling within Golgi
2. P GO:0005524 ATP binding
2. P GO:0051496 positive regulation of stress fiber assembly
2. P GO:0005628 prospore membrane
2. P GO:0072518 Rho-dependent protein serine/threonine kinase activity
2. P GO:0008356 asymmetric cell division
2. P GO:0030054 cell junction
2. P GO:0031616 spindle pole centrosome
2. P GO:1990776 response to angiotensin
2. P GO:0097120 receptor localization to synapse
2. P GO:0010507 negative regulation of autophagy
2. P GO:0051246 regulation of protein metabolic process
2. P GO:0007098 centrosome cycle
2. P GO:0031023 microtubule organizing center organization
2. P GO:0030036 actin cytoskeleton organization
2. P GO:0004674 protein serine/threonine kinase activity
2. P GO:1900037 regulation of cellular response to hypoxia
2. P GO:0007283 spermatogenesis
2. P GO:0000922 spindle pole
2. P GO:0051451 myoblast migration
2. P GO:0005879 axonemal microtubule
2. P GO:0072659 protein localization to plasma membrane
2. P GO:0048167 regulation of synaptic plasticity
2. P GO:0061136 regulation of proteasomal protein catabolic process
2. P GO:0045296 cadherin binding
2. P GO:0010457 centriole-centriole cohesion
2. P GO:0010506 regulation of autophagy
2. P GO:0001520 outer dense fiber
2. P GO:0030030 cell projection organization
2. P GO:0036464 cytoplasmic ribonucleoprotein granule
2. P GO:0030165 PDZ domain binding
2. P GO:0048813 dendrite morphogenesis
2. P GO:0090306 meiotic spindle assembly
2. P GO:0030521 androgen receptor signaling pathway
2. P GO:0000281 mitotic cytokinesis
2. P GO:0005816 spindle pole body
2. P GO:0051298 centrosome duplication
2. P GO:0005863 striated muscle myosin thick filament
2. P GO:0005856 cytoskeleton
2. P GO:0061676 importin-alpha family protein binding
2. P GO:1905515 non-motile cilium assembly
2. P GO:0043195 terminal bouton
2. P GO:0090235 regulation of metaphase plate congression
2. P GO:0060077 inhibitory synapse
2. P GO:1905145 cellular response to acetylcholine
2. P GO:1901888 regulation of cell junction assembly
2. P GO:2000845 positive regulation of testosterone secretion
2. P GO:0042734 presynaptic membrane
2. P GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors
2. P GO:0032580 Golgi cisterna membrane
2. P GO:0043124 negative regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0006412 translation
2. P GO:0051225 spindle assembly
2. P GO:0003180 aortic valve morphogenesis
2. P GO:0032970 regulation of actin filament-based process
2. P GO:0051497 negative regulation of stress fiber assembly
2. P GO:0036126 sperm flagellum
2. P GO:0031985 Golgi cisterna
2. P GO:0097730 non-motile cilium
2. P GO:1903140 regulation of establishment of endothelial barrier
2. P GO:1902004 positive regulation of amyloid-beta formation
2. P GO:0048598 embryonic morphogenesis
2. P GO:0110061 regulation of angiotensin-activated signaling pathway
2. P GO:0032388 positive regulation of intracellular transport
2. P GO:0033327 Leydig cell differentiation
2. P GO:0070056 prospore membrane leading edge
2. P GO:0007005 mitochondrion organization
2. P GO:0005819 spindle
2. P GO:0002931 response to ischemia
2. P GO:0048511 rhythmic process
2. P GO:0007249 I-kappaB kinase/NF-kappaB signaling
2. P GO:0098974 postsynaptic actin cytoskeleton organization
2. P GO:0071559 response to transforming growth factor beta
2. P GO:0035329 hippo signaling
2. P GO:0072686 mitotic spindle
2. P GO:1903003 positive regulation of protein deubiquitination
2. P GO:0030134 COPII-coated ER to Golgi transport vesicle
2. P GO:0007289 spermatid nucleus differentiation
2. P GO:2000145 regulation of cell motility
2. P GO:0001843 neural tube closure
2. P GO:0090498 extrinsic component of Golgi membrane
2. P GO:0008385 IkappaB kinase complex
2. P GO:0030496 midbody
2. P GO:0097733 photoreceptor cell cilium
2. P GO:0010613 positive regulation of cardiac muscle hypertrophy
2. P GO:0000242 pericentriolar material
2. P GO:0035509 negative regulation of myosin-light-chain-phosphatase activity
2. P GO:0097746 blood vessel diameter maintenance
2. P GO:0036064 ciliary basal body
2. P GO:0032120 ascospore-type prospore membrane formation
2. P GO:0010629 negative regulation of gene expression
2. P GO:0031593 polyubiquitin modification-dependent protein binding
2. P GO:0098685 Schaffer collateral - CA1 synapse
2. P GO:0031410 cytoplasmic vesicle
2. P GO:0090307 mitotic spindle assembly
2. P GO:0031644 regulation of nervous system process
2. P GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
2. P GO:0016459 myosin complex
2. P GO:0000070 mitotic sister chromatid segregation
2. P GO:0051019 mitogen-activated protein kinase binding
2. P GO:0042803 protein homodimerization activity
2. P GO:0001764 neuron migration
2. P GO:0034454 microtubule anchoring at centrosome
2. P GO:1905205 positive regulation of connective tissue replacement
2. P GO:1902966 positive regulation of protein localization to early endosome
2. P GO:0007051 spindle organization
2. P GO:0018107 peptidyl-threonine phosphorylation
2. P GO:0001525 angiogenesis
2. P GO:0043410 positive regulation of MAPK cascade
2. P GO:0005814 centriole
2. P GO:0016082 synaptic vesicle priming
2. P GO:0007159 leukocyte cell-cell adhesion
2. P GO:0005798 Golgi-associated vesicle
2. P GO:0005794 Golgi apparatus
2. P GO:0098982 GABA-ergic synapse
2. P GO:0050681 androgen receptor binding
2. P GO:0007286 spermatid development
2. P GO:0035974 meiotic spindle pole body
2. P GO:0031267 small GTPase binding
2. P GO:0060271 cilium assembly
2. P GO:0007252 I-kappaB phosphorylation
2. P GO:0099635 voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels
2. P GO:0002755 MyD88-dependent toll-like receptor signaling pathway
2. P GO:0140058 neuron projection arborization
2. P GO:0030317 flagellated sperm motility
2. P GO:0010825 positive regulation of centrosome duplication
2. P GO:0030866 cortical actin cytoskeleton organization
2. P GO:0030663 COPI-coated vesicle membrane
2. P GO:0045103 intermediate filament-based process
2. P GO:0016525 negative regulation of angiogenesis
2. P GO:0005923 bicellular tight junction
2. P GO:0035371 microtubule plus-end
2. P GO:0061157 mRNA destabilization
2. P GO:0045202 synapse
2. P GO:0000137 Golgi cis cisterna
2. P GO:0090521 glomerular visceral epithelial cell migration
2. P GO:0005801 cis-Golgi network
2. P GO:0022614 membrane to membrane docking
2. P GO:0005797 Golgi medial cisterna
2. P GO:0000139 Golgi membrane
2. P GO:0007274 neuromuscular synaptic transmission
2. P GO:0090271 positive regulation of fibroblast growth factor production
2. P GO:0006469 negative regulation of protein kinase activity
2. P GO:1903347 negative regulation of bicellular tight junction assembly
2. P GO:1902017 regulation of cilium assembly
2. P GO:0035253 ciliary rootlet
2. P GO:0044782 cilium organization
2. P GO:1902992 negative regulation of amyloid precursor protein catabolic process
2. P GO:0150033 negative regulation of protein localization to lysosome
2. P GO:0019905 syntaxin binding
2. P GO:0032723 positive regulation of connective tissue growth factor production
2. P GO:0070168 negative regulation of biomineral tissue development
2. P GO:0003365 establishment of cell polarity involved in ameboidal cell migration
2. P GO:0003383 apical constriction
2. P GO:0048788 cytoskeleton of presynaptic active zone
2. P GO:0042752 regulation of circadian rhythm
3. B GO:0001895 retina homeostasis
3. B GO:0046627 negative regulation of insulin receptor signaling pathway
3. B GO:0040015 negative regulation of multicellular organism growth
3. B GO:0046621 negative regulation of organ growth
3. B GO:0015629 actin cytoskeleton
3. B GO:0070062 extracellular exosome
3. B GO:0019217 regulation of fatty acid metabolic process
3. B GO:0008200 ion channel inhibitor activity
3. B GO:0019216 regulation of lipid metabolic process
3. B GO:0060259 regulation of feeding behavior
3. B GO:0072562 blood microparticle
3. B GO:0005615 extracellular space
3. B GO:0042593 glucose homeostasis
3. B GO:0021762 substantia nigra development
3. B GO:0005938 cell cortex

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9UPS8 Ankyrin repeat domain-containing protein 26 6.05e-04 4.78e-04 4.22e-151
1. PB Q8IYA2 Putative coiled-coil domain-containing protein 144C 0 2.75e-134 0.0
1. PB Q811D2 Ankyrin repeat domain-containing protein 26 2.27e-04 7.91e-05 7.83e-116
1. PB A2A2Z9 Ankyrin repeat domain-containing protein 18B 9.28e-06 4.33e-02 1.17e-54
1. PB A2RUR9 Coiled-coil domain-containing protein 144A 7.60e-05 6.13e-38 0.0
2. P Q86SQ7 Serologically defined colon cancer antigen 8 8.80e-08 1.88e-05 NA
2. P B9EKI3 TATA element modulatory factor 8.65e-04 7.19e-04 NA
2. P A7YH32 Cingulin 2.58e-06 8.97e-03 NA
2. P Q8K371 Angiomotin-like protein 2 1.28e-02 1.58e-02 NA
2. P P35416 Paramyosin, short form 1.95e-05 1.33e-04 NA
2. P Q08379 Golgin subfamily A member 2 4.05e-05 2.78e-02 NA
2. P Q7SXE4 Golgin subfamily A member 5 5.58e-05 5.78e-04 NA
2. P Q3TMW1 Coiled-coil domain-containing protein 102A 4.14e-07 2.23e-02 NA
2. P P70336 Rho-associated protein kinase 2 7.26e-04 2.44e-02 NA
2. P Q8IY63 Angiomotin-like protein 1 1.91e-02 2.44e-02 NA
2. P Q6NZW0 Coiled-coil domain-containing protein 102A 7.62e-05 5.83e-05 NA
2. P P82094 TATA element modulatory factor 8.10e-05 1.25e-03 NA
2. P Q5BJE1 Coiled-coil domain-containing protein 178 3.69e-06 5.91e-03 NA
2. P A6NGH7 Coiled-coil domain-containing protein 160 1.13e-03 2.21e-02 NA
2. P Q5R829 Outer dense fiber protein 2 4.75e-02 6.26e-04 NA
2. P Q6DFL0 Coiled-coil domain-containing protein 102A 4.08e-06 1.64e-05 NA
2. P Q28021 Rho-associated protein kinase 2 1.75e-05 1.26e-03 NA
2. P Q5SZL2 Centrosomal protein of 85 kDa-like 6.92e-03 4.21e-03 NA
2. P Q6NZL0 Protein SOGA3 6.47e-03 7.18e-03 NA
2. P B3DGU2 Rab11 family-interacting protein 4B 2.86e-02 2.83e-03 NA
2. P B1WB65 Cingulin 1.18e-03 2.77e-05 NA
2. P M3TYT0 Rho-associated protein kinase 2 3.85e-06 1.06e-03 NA
2. P Q5ZKK5 Outer dense fiber protein 2 1.80e-06 4.54e-03 NA
2. P Q9UPV0 Centrosomal protein of 164 kDa 3.88e-03 2.98e-04 NA
2. P Q5BJF6 Outer dense fiber protein 2 2.28e-02 9.38e-04 NA
2. P Q6PH08 ERC protein 2 5.54e-05 4.13e-03 NA
2. P Q5PQ23 Outer dense fiber protein 2 6.88e-02 6.54e-03 NA
2. P Q6AW69 Cingulin-like protein 1 1.70e-02 3.35e-06 NA
2. P Q9UDT6 CAP-Gly domain-containing linker protein 2 1.33e-04 1.68e-02 NA
2. P E7F5E1 Centrosomal protein of 162 kDa 1.68e-03 2.36e-08 NA
2. P Q8BMK0 Centrosomal protein of 85 kDa 1.56e-02 2.19e-02 NA
2. P Q08378 Golgin subfamily A member 3 2.72e-05 6.42e-03 NA
2. P Q6P2H3 Centrosomal protein of 85 kDa 1.68e-02 2.97e-03 NA
2. P Q9Y2J4 Angiomotin-like protein 2 5.01e-03 3.45e-02 NA
2. P B8JK76 Serologically defined colon cancer antigen 8 homolog 4.44e-09 4.41e-02 NA
2. P Q62839 Golgin subfamily A member 2 1.04e-05 4.61e-02 NA
2. P Q84WU4 Golgin candidate 3 8.51e-09 4.73e-02 NA
2. P O15083 ERC protein 2 2.39e-04 3.52e-03 NA
2. P Q15025 TNFAIP3-interacting protein 1 2.62e-04 2.62e-03 NA
2. P Q0VF96 Cingulin-like protein 1 2.51e-04 1.96e-02 NA
2. P A3KGV1 Outer dense fiber protein 2 1.46e-05 6.91e-04 NA
2. P Q8WP33 Coiled-coil domain-containing protein 30 9.07e-07 1.33e-02 NA
2. P Q9Y228 TRAF3-interacting JNK-activating modulator 1.28e-02 4.77e-05 NA
2. P Q96R06 Sperm-associated antigen 5 2.34e-04 4.57e-02 NA
2. P Q07732 Accumulates dyads protein 3 3.73e-03 6.77e-04 NA
2. P Q8K3M6 ERC protein 2 1.06e-06 4.94e-03 NA
2. P Q5TB80 Centrosomal protein of 162 kDa 2.30e-03 5.19e-05 NA
2. P Q8VYU6 Golgin candidate 4 2.07e-06 3.21e-02 NA
2. P O42657 GRIP and coiled-coil domain-containing protein C27D7.02c 1.77e-05 9.83e-03 NA
2. P Q8N8E3 Centrosomal protein of 112 kDa 5.41e-02 5.34e-04 NA
2. P Q8TBZ0 Coiled-coil domain-containing protein 110 3.13e-03 3.02e-02 NA
2. P O75116 Rho-associated protein kinase 2 9.18e-04 1.75e-03 NA
2. P G3V735 Angiomotin-like protein 2 1.21e-02 1.57e-02 NA
2. P Q5PR68 Centrosomal protein of 112 kDa 3.15e-05 1.75e-04 NA
2. P Q9CZX2 Centrosomal protein of 89 kDa 2.41e-05 2.47e-07 NA
2. P A0A1W2P884 Centrosomal protein of 85 kDa-like 2.00e-02 1.79e-04 NA
2. P A0JNH6 Coiled-coil domain-containing protein 102A 1.90e-03 1.51e-02 NA
2. P Q2T9U9 Coiled-coil domain-containing protein 160 2.93e-02 3.80e-02 NA
2. P Q63644 Rho-associated protein kinase 1 1.76e-03 1.91e-02 NA
2. P Q95JR0 Cancer-associated gene 1 protein homolog 1.65e-05 6.76e-05 NA
2. P Q99MI1 ELKS/Rab6-interacting/CAST family member 1 1.86e-06 2.86e-03 NA
2. P Q8TC20 Cancer-associated gene 1 protein 1.02e-04 1.11e-08 NA
2. P Q9LEZ4 Protein MICROTUBULE BINDING PROTEIN 2C 7.14e-02 4.50e-03 NA
2. P F1MRK3 Angiomotin-like protein 2 3.86e-02 2.91e-02 NA
2. P Q96ST8 Centrosomal protein of 89 kDa 5.77e-02 1.78e-09 NA
2. P Q4KLH6 Centrosomal protein of 162 kDa 4.59e-04 1.61e-08 NA
2. P Q6P402 Centrosomal protein of 89 kDa 8.33e-05 2.80e-04 NA
2. P Q8TBA6 Golgin subfamily A member 5 1.41e-04 2.31e-02 NA
2. P Q9PTD7 Cingulin 2.52e-04 2.88e-03 NA
2. P Q8C0G2 TRAF3-interacting JNK-activating modulator 3.70e-02 4.33e-03 NA
2. P A6H5Y1 M-phase phosphoprotein 9 1.42e-01 1.21e-03 NA
2. P P59242 Cingulin 1.83e-05 8.64e-03 NA
2. P C8Z5R8 Spindle pole body component 110 5.70e-04 2.96e-02 NA
2. P Q2T9U2 Outer dense fiber protein 2 7.17e-08 1.56e-03 NA
2. P P11929 Blastoderm-specific protein 25D 3.82e-04 7.32e-03 NA
2. P Q0WVL7 Golgin candidate 5 1.15e-03 1.50e-05 NA
2. P Q91365 Centrosomal protein of 162 kDa (Fragment) 5.18e-03 1.38e-04 NA
2. P Q6GNT7 Golgin subfamily A member 5 7.23e-06 1.10e-03 NA
2. P Q12411 Sporulation-specific protein 21 8.07e-03 4.49e-02 NA
2. P Q4R8C3 Outer dense fiber protein 2 7.37e-02 7.55e-04 NA
2. P Q9EPM5 Syncoilin 2.93e-03 5.04e-03 NA
2. P Q1L8T5 Cingulin 3.42e-05 1.60e-04 NA
2. P Q5IR70 Cancer-associated gene 1 protein homolog 7.54e-05 2.62e-07 NA
2. P Q9U389 Allophagy receptor allo-1 1.79e-03 7.81e-03 NA
2. P Q9P2M7 Cingulin 1.97e-04 5.34e-04 NA
2. P Q9QYE6 Golgin subfamily A member 5 7.31e-06 7.12e-03 NA
2. P A6ZYV5 Spindle pole body component 110 1.14e-04 4.65e-02 NA
2. P Q5DU05 Centrosomal protein of 164 kDa 4.97e-03 7.78e-04 NA
2. P Q7TME2 Sperm-associated antigen 5 5.44e-03 8.67e-04 NA
2. P Q96A19 Coiled-coil domain-containing protein 102A 3.81e-06 9.76e-04 NA
2. P Q95JS9 Coiled-coil domain-containing protein 110 5.58e-03 2.83e-04 NA
2. P Q8K2J4 Coiled-coil domain-containing protein 14 4.77e-03 1.41e-05 NA
2. P Q6ZQ06 Centrosomal protein of 162 kDa 1.48e-02 1.29e-09 NA
2. P Q5JLY8 Golgin-84 9.45e-05 1.97e-03 NA
2. P B1MTG4 Cingulin 1.80e-04 1.60e-03 NA
2. P Q62868 Rho-associated protein kinase 2 8.84e-02 5.96e-03 NA
2. P Q3UYG1 Coiled-coil domain-containing protein 160 2.42e-01 2.29e-02 NA
2. P Q10030 Uncharacterized protein C27D6.1 1.86e-04 1.02e-02 NA
2. P Q80UF4 Serologically defined colon cancer antigen 8 homolog 2.99e-06 1.04e-03 NA
2. P Q3ZU82 Golgin subfamily A member 5 5.44e-06 3.23e-03 NA
2. P Q49A88 Coiled-coil domain-containing protein 14 3.64e-02 5.72e-04 NA
2. P Q9WUU8 TNFAIP3-interacting protein 1 8.49e-04 6.79e-03 NA
2. P Q66HB6 Cancer-associated gene 1 protein homolog 2.09e-05 2.99e-05 NA
2. P A9X1A5 Cingulin 5.60e-02 1.19e-04 NA
2. P P90970 Golgin-84 8.37e-04 6.58e-04 NA
3. B Q8NF67 Putative ankyrin repeat domain-containing protein 20A12 pseudogene 2.93e-05 NA 1.22e-24
3. B A5A3E0 POTE ankyrin domain family member F 4.33e-01 NA 1.20e-27
3. B A6NC57 Ankyrin repeat domain-containing protein 62 2.07e-04 NA 5.40e-76
3. B Q6S5H5 POTE ankyrin domain family member G 7.90e-01 NA 1.59e-05
3. B Q3MJ40 Coiled-coil domain-containing protein 144B 1.15e-02 NA 0.0
3. B Q5VUR7 Putative ankyrin repeat domain-containing protein 20A3 2.78e-01 NA 5.88e-73
3. B A6NI47 Putative POTE ankyrin domain family member M 6.82e-01 NA 1.70e-05
3. B Q6S8J3 POTE ankyrin domain family member E 4.05e-01 NA 5.54e-27
3. B Q9BXX3 Ankyrin repeat domain-containing protein 30A 3.85e-03 NA 2.96e-64
3. B Q5TYW2 Ankyrin repeat domain-containing protein 20A1 3.27e-04 NA 1.97e-74
3. B A6QL64 Ankyrin repeat domain-containing protein 36A 5.36e-03 NA 5.62e-66
3. B H3BUK9 POTE ankyrin domain family member B2 1.52e-01 NA 1.53e-29
3. B Q4UJ75 Putative ankyrin repeat domain-containing protein 20A4 2.01e-04 NA 1.32e-71
3. B A0A0A6YYL3 POTE ankyrin domain family member B 3.37e-01 NA 1.53e-29
3. B Q6NUI1 Putative coiled-coil domain-containing protein 144 N-terminal-like 7.01e-01 NA 1.13e-75
3. B Q6S8J7 POTE ankyrin domain family member A 6.52e-01 NA 6.09e-10
3. B Q5CZ79 Ankyrin repeat domain-containing protein 20B 8.92e-04 NA 3.27e-71
3. B Q96IX9 Putative ankyrin repeat domain-containing protein 26-like 1 4.89e-03 NA 7.46e-26
3. B Q9BXX2 Ankyrin repeat domain-containing protein 30B 8.76e-03 NA 9.86e-63
3. B Q6S545 POTE ankyrin domain family member H 8.54e-01 NA 3.81e-06
3. B Q5SQ80 Putative ankyrin repeat domain-containing protein 20A2 5.29e-03 NA 2.50e-73
3. B Q5JPF3 Ankyrin repeat domain-containing protein 36C 9.94e-04 NA 1.82e-69
3. B P0CG39 POTE ankyrin domain family member J 4.61e-01 NA 5.21e-27
3. B B2RU33 POTE ankyrin domain family member C 7.83e-01 NA 5.79e-19
3. B Q8N2N9 Ankyrin repeat domain-containing protein 36B 4.39e-03 NA 1.52e-66
3. B P75310 Uncharacterized protein MG328 homolog 3.46e-05 NA 0.016
3. B Q6NSI1 Putative ankyrin repeat domain-containing protein 26-like protein 7.23e-01 NA 0.037
3. B P0CG38 POTE ankyrin domain family member I 5.67e-01 NA 1.60e-26
3. B A0JP26 POTE ankyrin domain family member B3 6.84e-01 NA 1.12e-29
3. B Q86YR6 POTE ankyrin domain family member D 2.64e-01 NA 3.84e-31
3. B Q8IVF6 Ankyrin repeat domain-containing protein 18A 1.12e-04 NA 1.07e-56