Summary

Q8IZM0

Homolog: P38343.
Function: Protein SLM6.

Statistics

Total GO Annotation: 3
Unique PROST Go: 3
Unique BLAST Go: 0

Total Homologs: 5
Unique PROST Homologs: 4
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P38343 (Protein SLM6) with a FATCAT P-Value: 0.0132 and RMSD of 1.48 angstrom. The sequence alignment identity is 18.8%.
Structural alignment shown in left. Query protein Q8IZM0 colored as red in alignment, homolog P38343 colored as blue. Query protein Q8IZM0 is also shown in right top, homolog P38343 showed in right bottom. They are colored based on secondary structures. 

  Q8IZM0 ----------------------------MDSYS----AKIRANLVCRRST--DPSIRV--TFSSR-SL---GSLPA--FAMFRS------SRPSFI---- 48
  P38343 MCSRFSSTSLKCLLCSQNRHCSSGISTLLRTFSCITLSAISSSVNCSGSSFLGSSFSLFSSFSCKESLLRSGVFPSWLFCMFSSILALAISN-SFFFFSS 99

  Q8IZM0 KICFP--FSSSIVLASGYSVRASM------RSSFERQNRSE------------- 81
  P38343 NACFSLLFNS--FLVTGFSFSADLLVLAAAADTLE-SNVSNDIGGNCATRLFKL 150

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0033644 host cell membrane
2. P GO:0006897 endocytosis
2. P GO:0016021 integral component of membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8IZM0 Putative CNGA1-overlapping antisense gene protein 0 2.25e-146 1.13e-50
2. P P19287 Uncharacterized 9.4 kDa protein NA 4.66e-02 NA
2. P A0A023PXD5 Putative uncharacterized membrane protein YER147C-A 5.61e-02 4.75e-02 NA
2. P Q914M0 Putative transmembrane protein 10 NA 6.80e-03 NA
2. P P38343 Protein SLM6 1.32e-02 3.97e-03 NA