Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q9ZU34
(Actin-interacting protein 1-1) with a FATCAT P-Value: 0.0 and RMSD of 3.43 angstrom. The sequence alignment identity is 13.0%.
Structural alignment shown in left. Query protein Q8IZU2 colored as red in alignment, homolog Q9ZU34 colored as blue.
Query protein Q8IZU2 is also shown in right top, homolog Q9ZU34 showed in right bottom. They are colored based on secondary structures.
Q8IZU2 MAWMTYISNWFEQDDWYEGLQRANMSQV-----------RQVGLLAAGCQPWNKDVCAASGDRFAYCATLAIYIYQLDHRYNEFKLHAIMSEHKKTITAI 89 Q9ZU34 ------------------------MAKLLETFPCVPSTERGRGILISG------D---SKSDTILYCNGRSVFIRSL-RQLQDVQVY---GEHGYAVTVA 63 Q8IZU2 SWCPH-----NPDLFASGS-----TDNLVIIWNVAEQKVIA-KLDSTKGIPASLSWCWNAEDVVAFVSHRGPLFIWTISGPDSGVIVHKDAHSFLSDICM 178 Q9ZU34 RYSPNGEWIASADV--SGTVRVWGTHNGFVLKN--EFRVLAGRVD-------DLQWSF---D--------G-LRI-VASG-D-G----K-GKSLVRS--- 129 Q8IZU2 FRWHTHQKGKVVFGHIDGSLSIFHPGNKNQKHVL----RPESLEGTDEEDPVTALEWDPLST---DYLLVVNLHYG--IRLVDSESLSCITTFNLPSAAA 269 Q9ZU34 FAWDS---GN-TMGDFDG-----H-----SRRVLSCAFKP-----T---RPFR------IATCGEDFL--VNFYDGPPFKFHSSHREH--SNF------- 190 Q8IZU2 SVQCLAWVPSAPGM-FIT--GDSQVGVLRIWNVSRTTPIDNL-KL-KKTGFH--CLHVLN-SPPRKK-FSVQSPTKNHYTSSTSEAVPPPTLTQNQAFSL 360 Q9ZU34 -VNCIRYSPD--GTKFITVSSDKK-GM--IYD-GKTG--DKVGELASEDG-HKGSIYAVSWSPDSKRVLTV-SADK---SAKVWEVAEDGTI-------- 268 Q8IZU2 PPGHAV--CCFLDGGVGLYDM--GAKKW--DFL--RDLGHVETIFDCKFKPDD---PNLLATASFDGTIK-VWDI-----N--T-LTAVYTSPGNEGVIY 440 Q9ZU34 --GSVIKTLSFMESG-GAEDMLVGC-LWQNDHLITVSLGGTMSLFSA----DDMDKPPLL----LSGHIKNVTSLAVLGENQKTILSCSY-----DGLI- 350 Q8IZU2 SLSWAPG-GLNC-----------IAGGT-SR---NG--AFIWNV---QKGKIIQRFNEH---GTNGI-FCIAWSHKDSKRIATC--SSD-GFCIIRTIDG 512 Q9ZU34 -VKWLKGVGYSCKLQMKDTKIKRLA-ATESSIFISGYDNMVWRIPLTDNG---YGAAEHVDIGHQPLDISIA---VDSPE-ATALVSFDSGVVL---LNG 438 Q8IZU2 -KVLHK----YKHPAAVFGCDWSQNNKDMIATGCEDTNVRVYYVATSSDQPLK---VFSGHTAKVFHVKWSP-LREGILCSGSDDGTVR---IWD-YTQD 599 Q9ZU34 LNILSKIDLGFAVAASVISPD----GKEAIVGG-QDGKLHIYSV--SGDNNLKEEAVLEKHRGALTVIRYSPDLT--MFASG--DAN-REAVVWDRETKQ 526 Q8IZU2 ACI-NILNGHTAPVRGLMWNTEIP--YLLISGSWDYTIKVWDTREGTCVDTVY--D---------HGADVYGLT-------CHPSRPFTMASCSRDSTVR 678 Q9ZU34 VKLNNMLF-HTARINSLAWS---PNNKMVATGSID-----------TCV-IVYEVDKPASSRITARNAHLGGVNAVAFIDDC------TVASSGEDASVR 604 Q8IZU2 LWSLTALVTPVQINILADRSWEEIIGNTDYAIEPGTPPLLCGKVSRDIRQEIEKLTANSQVKKLRWFSECLSPPGGSDNLWNLVAVIKGQDDSLLPQNYC 778 Q9ZU34 LWH----IEP-Q---------------------------------------------------------------------------------------- 611 Q8IZU2 KGIMHLKHLIKFRTSEAQELTTVKMSKFGGGIGVPAKEERLKEAAEIHLRLGQIQRYCELMVELGEWDKALSIAPGVSVKYWKKLMQRRADQLIQEDKDD 878 Q9ZU34 ---------------------------------------------------------------------------------------------------- 611 Q8IZU2 VIPYCIAIGDVKKLVHFFMSRGQLKEALLVAQAACEGNMQPLHVSVPKGASYSDDIYKEDFNELLHKVSKELAEWYFQDGRAVLAACCHLAIDNIELAMA 978 Q9ZU34 ---------------------------------------------------------------------------------------------------- 611 Q8IZU2 YLIRGNELELAVCVGTVLGESAAPATHYALELLARKCMMISVCFPCVGYSVPFCYVNRNLAADLLLMIPDNELHLIKLCAFYPGCTEEINDLHDKCKLPT 1078 Q9ZU34 ---------------------------------------------------------------------------------------------------- 611 Q8IZU2 VEECMQLAETARADDNIFETVKYYLLSQEPEKALPIGISFVKEYISSSDWTLDTIYPVLDLLSYIRTEKLLLHTCTEARNELLILCGYIGALLAIRRQYQ 1178 Q9ZU34 ---------------------------------------------------------------------------------------------------- 611 Q8IZU2 SIVPALYEYTSQLLKRREVSVPLKIEYLSEELDAWRACTQSTNRSLEDSPYTPPSDSQRMIYATLLKRLKEESLKGIIGPDYVTGSNLPSHSDIHISCLT 1278 Q9ZU34 ---------------------------------------------------------------------------------------------------- 611 Q8IZU2 GLKIQGPVFFLEDGKSAISLNDALMWAKVNPFSPLGTGIRLNPF 1322 Q9ZU34 -------------------------------------------- 611
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005737 | cytoplasm |
| 1. PB | GO:0005765 | lysosomal membrane |
| 1. PB | GO:0061630 | ubiquitin protein ligase activity |
| 1. PB | GO:0005524 | ATP binding |
| 1. PB | GO:0097730 | non-motile cilium |
| 1. PB | GO:0030622 | U4atac snRNA binding |
| 1. PB | GO:0005884 | actin filament |
| 1. PB | GO:0030126 | COPI vesicle coat |
| 1. PB | GO:0035859 | Seh1-associated complex |
| 1. PB | GO:0005643 | nuclear pore |
| 1. PB | GO:0006886 | intracellular protein transport |
| 1. PB | GO:0061512 | protein localization to cilium |
| 1. PB | GO:0034719 | SMN-Sm protein complex |
| 1. PB | GO:0005080 | protein kinase C binding |
| 1. PB | GO:0007634 | optokinetic behavior |
| 1. PB | GO:0034718 | SMN-Gemin2 complex |
| 1. PB | GO:0032880 | regulation of protein localization |
| 1. PB | GO:0006406 | mRNA export from nucleus |
| 1. PB | GO:0007219 | Notch signaling pathway |
| 1. PB | GO:0035721 | intraciliary retrograde transport |
| 1. PB | GO:0016021 | integral component of membrane |
| 1. PB | GO:0060271 | cilium assembly |
| 1. PB | GO:0031965 | nuclear membrane |
| 1. PB | GO:0030991 | intraciliary transport particle A |
| 1. PB | GO:0061700 | GATOR2 complex |
| 1. PB | GO:2000114 | regulation of establishment of cell polarity |
| 1. PB | GO:0097504 | Gemini of coiled bodies |
| 1. PB | GO:0005198 | structural molecule activity |
| 1. PB | GO:0032008 | positive regulation of TOR signaling |
| 1. PB | GO:0005886 | plasma membrane |
| 1. PB | GO:0035845 | photoreceptor cell outer segment organization |
| 1. PB | GO:0045879 | negative regulation of smoothened signaling pathway |
| 1. PB | GO:0032991 | protein-containing complex |
| 1. PB | GO:0042073 | intraciliary transport |
| 1. PB | GO:0007368 | determination of left/right symmetry |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0070986 | left/right axis specification |
| 1. PB | GO:1904263 | positive regulation of TORC1 signaling |
| 1. PB | GO:0006890 | retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum |
| 1. PB | GO:0015630 | microtubule cytoskeleton |
| 1. PB | GO:0006606 | protein import into nucleus |
| 1. PB | GO:0030621 | U4 snRNA binding |
| 1. PB | GO:0003779 | actin binding |
| 1. PB | GO:0032797 | SMN complex |
| 1. PB | GO:0051664 | nuclear pore localization |
| 1. PB | GO:0000972 | transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery |
| 1. PB | GO:0036064 | ciliary basal body |
| 1. PB | GO:0043547 | positive regulation of GTPase activity |
| 1. PB | GO:1905515 | non-motile cilium assembly |
| 1. PB | GO:0034198 | cellular response to amino acid starvation |
| 1. PB | GO:0005929 | cilium |
| 1. PB | GO:0005930 | axoneme |
| 1. PB | GO:0006888 | endoplasmic reticulum to Golgi vesicle-mediated transport |
| 1. PB | GO:0006895 | Golgi to endosome transport |
| 1. PB | GO:0000139 | Golgi membrane |
| 1. PB | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 1. PB | GO:0006891 | intra-Golgi vesicle-mediated transport |
| 1. PB | GO:0006412 | translation |
| 1. PB | GO:2000024 | regulation of leaf development |
| 1. PB | GO:0035264 | multicellular organism growth |
| 1. PB | GO:0007227 | signal transduction downstream of smoothened |
| 1. PB | GO:0030674 | protein-macromolecule adaptor activity |
| 1. PB | GO:0031080 | nuclear pore outer ring |
| 2. P | GO:0034058 | endosomal vesicle fusion |
| 2. P | GO:0060021 | roof of mouth development |
| 2. P | GO:0030326 | embryonic limb morphogenesis |
| 2. P | GO:0005770 | late endosome |
| 2. P | GO:0030716 | oocyte fate determination |
| 2. P | GO:0006727 | ommochrome biosynthetic process |
| 2. P | GO:0030992 | intraciliary transport particle B |
| 2. P | GO:0032456 | endocytic recycling |
| 2. P | GO:0035720 | intraciliary anterograde transport |
| 2. P | GO:0034398 | telomere tethering at nuclear periphery |
| 2. P | GO:0007507 | heart development |
| 2. P | GO:0009047 | dosage compensation by hyperactivation of X chromosome |
| 2. P | GO:0031122 | cytoplasmic microtubule organization |
| 2. P | GO:0031902 | late endosome membrane |
| 2. P | GO:0010172 | embryonic body morphogenesis |
| 2. P | GO:0007293 | germarium-derived egg chamber formation |
| 2. P | GO:0048339 | paraxial mesoderm development |
| 2. P | GO:0072006 | nephron development |
| 2. P | GO:0048193 | Golgi vesicle transport |
| 2. P | GO:0006996 | organelle organization |
| 2. P | GO:0008406 | gonad development |
| 2. P | GO:0021915 | neural tube development |
| 2. P | GO:0031990 | mRNA export from nucleus in response to heat stress |
| 2. P | GO:0007032 | endosome organization |
| 2. P | GO:0060831 | smoothened signaling pathway involved in dorsal/ventral neural tube patterning |
| 2. P | GO:0031084 | BLOC-2 complex |
| 2. P | GO:0045019 | negative regulation of nitric oxide biosynthetic process |
| 2. P | GO:0045055 | regulated exocytosis |
| 2. P | GO:0036372 | opsin transport |
| 2. P | GO:0001674 | female germ cell nucleus |
| 2. P | GO:0030897 | HOPS complex |
| 2. P | GO:0050896 | response to stimulus |
| 2. P | GO:0007033 | vacuole organization |
| 2. P | GO:0030318 | melanocyte differentiation |
| 2. P | GO:0097421 | liver regeneration |
| 2. P | GO:0042471 | ear morphogenesis |
| 2. P | GO:0042144 | vacuole fusion, non-autophagic |
| 2. P | GO:0045907 | positive regulation of vasoconstriction |
| 2. P | GO:0060348 | bone development |
| 2. P | GO:0030742 | GTP-dependent protein binding |
| 2. P | GO:0097541 | axonemal basal plate |
| 2. P | GO:0097576 | vacuole fusion |
| 2. P | GO:0001841 | neural tube formation |
| 2. P | GO:0008333 | endosome to lysosome transport |
| 2. P | GO:1902501 | lysosomal HOPS complex |
| 2. P | GO:0097500 | receptor localization to non-motile cilium |
| 2. P | GO:0021914 | negative regulation of smoothened signaling pathway involved in ventral spinal cord patterning |
| 2. P | GO:0000973 | posttranscriptional tethering of RNA polymerase II gene DNA at nuclear periphery |
| 2. P | GO:0097352 | autophagosome maturation |
| 2. P | GO:2000300 | regulation of synaptic vesicle exocytosis |
| 2. P | GO:0048593 | camera-type eye morphogenesis |
| 2. P | GO:0006624 | vacuolar protein processing |
| 2. P | GO:0008057 | eye pigment granule organization |
| 2. P | GO:0043587 | tongue morphogenesis |
| 2. P | GO:0009630 | gravitropism |
| 2. P | GO:0031409 | pigment binding |
| 2. P | GO:0017069 | snRNA binding |
| 2. P | GO:0048072 | compound eye pigmentation |
| 2. P | GO:0060036 | notochord cell vacuolation |
| 2. P | GO:0072657 | protein localization to membrane |
| 2. P | GO:0005764 | lysosome |
| 2. P | GO:0043291 | RAVE complex |
| 2. P | GO:0044611 | nuclear pore inner ring |
| 2. P | GO:0031538 | negative regulation of anthocyanin metabolic process |
| 2. P | GO:0006728 | pteridine biosynthetic process |
| 2. P | GO:0036228 | protein localization to nuclear inner membrane |
| 2. P | GO:0016197 | endosomal transport |
| 2. P | GO:0140018 | regulation of cytoplasmic translational fidelity |
| 2. P | GO:0001947 | heart looping |
| 2. P | GO:0009636 | response to toxic substance |
| 2. P | GO:0001843 | neural tube closure |
| 2. P | GO:0002926 | tRNA wobble base 5-methoxycarbonylmethyl-2-thiouridinylation |
| 2. P | GO:0030123 | AP-3 adaptor complex |
| 2. P | GO:0000340 | RNA 7-methylguanosine cap binding |
| 2. P | GO:0003330 | regulation of extracellular matrix constituent secretion |
| 2. P | GO:0043053 | dauer entry |
| 2. P | GO:0022008 | neurogenesis |
| 2. P | GO:0045494 | photoreceptor cell maintenance |
| 2. P | GO:0043010 | camera-type eye development |
| 2. P | GO:0097225 | sperm midpiece |
| 2. P | GO:0048530 | fruit morphogenesis |
| 2. P | GO:0043473 | pigmentation |
| 2. P | GO:0060322 | head development |
| 2. P | GO:0060971 | embryonic heart tube left/right pattern formation |
| 2. P | GO:0005769 | early endosome |
| 2. P | GO:0071356 | cellular response to tumor necrosis factor |
| 2. P | GO:0005776 | autophagosome |
| 2. P | GO:0008589 | regulation of smoothened signaling pathway |
| 2. P | GO:0046332 | SMAD binding |
| 2. P | GO:0032391 | photoreceptor connecting cilium |
| 2. P | GO:0060541 | respiratory system development |
| 2. P | GO:0048757 | pigment granule maturation |
| 2. P | GO:0035542 | regulation of SNARE complex assembly |
| 2. P | GO:0097598 | sperm cytoplasmic droplet |
| 2. P | GO:0097228 | sperm principal piece |
| 2. P | GO:0006623 | protein targeting to vacuole |
| 2. P | GO:0006726 | eye pigment biosynthetic process |
| 2. P | GO:2000643 | positive regulation of early endosome to late endosome transport |
| 2. P | GO:0090521 | glomerular visceral epithelial cell migration |
| 2. P | GO:0097542 | ciliary tip |
| 2. P | GO:0007596 | blood coagulation |
| 2. P | GO:0044782 | cilium organization |
| 2. P | GO:0017056 | structural constituent of nuclear pore |
| 2. P | GO:0045880 | positive regulation of smoothened signaling pathway |
| 2. P | GO:0006914 | autophagy |
| 2. P | GO:0031509 | subtelomeric heterochromatin assembly |
| 2. P | GO:0071333 | cellular response to glucose stimulus |
| 2. P | GO:0099041 | vesicle tethering to Golgi |
| 2. P | GO:0060830 | ciliary receptor clustering involved in smoothened signaling pathway |
| 2. P | GO:0005768 | endosome |
| 2. P | GO:0050680 | negative regulation of epithelial cell proliferation |
| 2. P | GO:0016973 | poly(A)+ mRNA export from nucleus |
| 2. P | GO:0061065 | regulation of dauer larval development |
| 2. P | GO:0010928 | regulation of auxin mediated signaling pathway |
| 2. P | GO:0042733 | embryonic digit morphogenesis |
| 2. P | GO:0010008 | endosome membrane |
| 2. P | GO:0033263 | CORVET complex |
| 2. P | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 2. P | GO:0048568 | embryonic organ development |
| 2. P | GO:1902115 | regulation of organelle assembly |
| 2. P | GO:0099022 | vesicle tethering |
| 2. P | GO:0030619 | U1 snRNA binding |
| 2. P | GO:0021522 | spinal cord motor neuron differentiation |
| 2. P | GO:0006904 | vesicle docking involved in exocytosis |
| 2. P | GO:1900027 | regulation of ruffle assembly |
| 2. P | GO:0031901 | early endosome membrane |
| 2. P | GO:0055123 | digestive system development |
| 2. P | GO:1905705 | cellular response to paclitaxel |
| 2. P | GO:0048596 | embryonic camera-type eye morphogenesis |
| 2. P | GO:0045324 | late endosome to vacuole transport |
| 2. P | GO:0016476 | regulation of embryonic cell shape |
| 2. P | GO:0051893 | regulation of focal adhesion assembly |
| 2. P | GO:0006622 | protein targeting to lysosome |
| 2. P | GO:0048701 | embryonic cranial skeleton morphogenesis |
| 2. P | GO:0080178 | 5-carbamoylmethyl uridine residue modification |
| 2. P | GO:0070647 | protein modification by small protein conjugation or removal |
| 2. P | GO:0045184 | establishment of protein localization |
| 2. P | GO:0016020 | membrane |
| 2. P | GO:0001750 | photoreceptor outer segment |
| 2. P | GO:0061909 | autophagosome-lysosome fusion |
| 2. P | GO:0001822 | kidney development |
| 2. P | GO:0021532 | neural tube patterning |
| 2. P | GO:0005802 | trans-Golgi network |
| 2. P | GO:1990816 | vacuole-mitochondrion membrane contact site |
| 2. P | GO:0061525 | hindgut development |
| 2. P | GO:0005160 | transforming growth factor beta receptor binding |
| 2. P | GO:1902500 | vacuolar HOPS complex |
| 2. P | GO:0045992 | negative regulation of embryonic development |
| 2. P | GO:1901998 | toxin transport |
| 2. P | GO:1903364 | positive regulation of cellular protein catabolic process |
| 2. P | GO:1901555 | response to paclitaxel |
| 2. P | GO:0060173 | limb development |
| 2. P | GO:0006999 | nuclear pore organization |
| 2. P | GO:1904888 | cranial skeletal system development |
| 2. P | GO:0016485 | protein processing |
| 2. P | GO:0048284 | organelle fusion |
| 2. P | GO:0060031 | mediolateral intercalation |
| 2. P | GO:1990830 | cellular response to leukemia inhibitory factor |
| 2. P | GO:0016236 | macroautophagy |
| 2. P | GO:0009953 | dorsal/ventral pattern formation |
| 2. P | GO:1990403 | embryonic brain development |
| 2. P | GO:0045022 | early endosome to late endosome transport |
| 2. P | GO:0030136 | clathrin-coated vesicle |
| 2. P | GO:0061066 | positive regulation of dauer larval development |
| 2. P | GO:0005085 | guanyl-nucleotide exchange factor activity |
| 2. P | GO:0051469 | vesicle fusion with vacuole |
| 2. P | GO:0007035 | vacuolar acidification |
| 2. P | GO:0060967 | negative regulation of gene silencing by RNA |
| 2. P | GO:0010762 | regulation of fibroblast migration |
| 2. P | GO:0032185 | septin cytoskeleton organization |
| 2. P | GO:0090200 | positive regulation of release of cytochrome c from mitochondria |
| 2. P | GO:0009267 | cellular response to starvation |
| 2. P | GO:0048278 | vesicle docking |
| 2. P | GO:0061053 | somite development |
| 2. P | GO:0008544 | epidermis development |
| 2. P | GO:0042147 | retrograde transport, endosome to Golgi |
| 2. P | GO:1903441 | protein localization to ciliary membrane |
| 2. P | GO:0009994 | oocyte differentiation |
| 2. P | GO:0072359 | circulatory system development |
| 2. P | GO:0061357 | positive regulation of Wnt protein secretion |
| 2. P | GO:0007040 | lysosome organization |
| 2. P | GO:0009705 | plant-type vacuole membrane |
| 2. P | GO:0009787 | regulation of abscisic acid-activated signaling pathway |
| 2. P | GO:0010015 | root morphogenesis |
| 2. P | GO:0034066 | Ric1-Rgp1 guanyl-nucleotide exchange factor complex |
| 2. P | GO:0002093 | auditory receptor cell morphogenesis |
| 2. P | GO:0005798 | Golgi-associated vesicle |
| 2. P | GO:0005794 | Golgi apparatus |
| 2. P | GO:1902774 | late endosome to lysosome transport |
| 2. P | GO:0043485 | endosome to pigment granule transport |
| 2. P | GO:0031267 | small GTPase binding |
| 2. P | GO:1903363 | negative regulation of cellular protein catabolic process |
| 2. P | GO:0007034 | vacuolar transport |
| 2. P | GO:0007252 | I-kappaB phosphorylation |
| 2. P | GO:0061055 | myotome development |
| 2. P | GO:0031514 | motile cilium |
| 2. P | GO:0140057 | vacuole-mitochondria membrane tethering |
| 2. P | GO:0030663 | COPI-coated vesicle membrane |
| 2. P | GO:0032418 | lysosome localization |
| 2. P | GO:0034629 | |
| 2. P | GO:0048069 | eye pigmentation |
| 2. P | GO:0030990 | intraciliary transport particle |
| 2. P | GO:0035050 | embryonic heart tube development |
| 2. P | GO:0007224 | smoothened signaling pathway |
| 2. P | GO:0045467 | R7 cell development |
| 2. P | GO:0030117 | membrane coat |
| 2. P | GO:0033588 | elongator holoenzyme complex |
| 2. P | GO:1902017 | regulation of cilium assembly |
| 2. P | GO:0019905 | syntaxin binding |
| 2. P | GO:0031076 | embryonic camera-type eye development |
| 3. B | GO:0006336 | DNA replication-independent chromatin assembly |
| 3. B | GO:0021540 | corpus callosum morphogenesis |
| 3. B | GO:0140496 | gamma-tubulin complex binding |
| 3. B | GO:1902510 | regulation of apoptotic DNA fragmentation |
| 3. B | GO:0036120 | cellular response to platelet-derived growth factor stimulus |
| 3. B | GO:1990147 | talin binding |
| 3. B | GO:0090141 | positive regulation of mitochondrial fission |
| 3. B | GO:0019226 | transmission of nerve impulse |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0000244 | spliceosomal tri-snRNP complex assembly |
| 3. B | GO:0005874 | microtubule |
| 3. B | GO:0008283 | cell population proliferation |
| 3. B | GO:0006368 | transcription elongation from RNA polymerase II promoter |
| 3. B | GO:1902610 | response to N-phenylthiourea |
| 3. B | GO:1901800 | positive regulation of proteasomal protein catabolic process |
| 3. B | GO:0006338 | chromatin remodeling |
| 3. B | GO:2000543 | positive regulation of gastrulation |
| 3. B | GO:0006325 | chromatin organization |
| 3. B | GO:0071353 | cellular response to interleukin-4 |
| 3. B | GO:1905861 | intranuclear rod assembly |
| 3. B | GO:0032796 | uropod organization |
| 3. B | GO:0010970 | transport along microtubule |
| 3. B | GO:0060307 | regulation of ventricular cardiac muscle cell membrane repolarization |
| 3. B | GO:1903673 | mitotic cleavage furrow formation |
| 3. B | GO:1905786 | positive regulation of anaphase-promoting complex-dependent catabolic process |
| 3. B | GO:2000234 | positive regulation of rRNA processing |
| 3. B | GO:0008017 | microtubule binding |
| 3. B | GO:0009553 | embryo sac development |
| 3. B | GO:0008344 | adult locomotory behavior |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0120293 | dynein axonemal particle |
| 3. B | GO:0005615 | extracellular space |
| 3. B | GO:0032956 | regulation of actin cytoskeleton organization |
| 3. B | GO:0032420 | stereocilium |
| 3. B | GO:0050885 | neuromuscular process controlling balance |
| 3. B | GO:0045722 | positive regulation of gluconeogenesis |
| 3. B | GO:0005677 | chromatin silencing complex |
| 3. B | GO:0005869 | dynactin complex |
| 3. B | GO:0006283 | transcription-coupled nucleotide-excision repair |
| 3. B | GO:0043224 | nuclear SCF ubiquitin ligase complex |
| 3. B | GO:0110136 | protein-RNA complex remodeling |
| 3. B | GO:0006342 | |
| 3. B | GO:0051301 | cell division |
| 3. B | GO:0033140 | negative regulation of peptidyl-serine phosphorylation of STAT protein |
| 3. B | GO:0006337 | nucleosome disassembly |
| 3. B | GO:0016571 | histone methylation |
| 3. B | GO:0006335 | DNA replication-dependent chromatin assembly |
| 3. B | GO:0005782 | peroxisomal matrix |
| 3. B | GO:0016579 | protein deubiquitination |
| 3. B | GO:0090148 | membrane fission |
| 3. B | GO:0071217 | cellular response to external biotic stimulus |
| 3. B | GO:0003735 | structural constituent of ribosome |
| 3. B | GO:0017053 | transcription repressor complex |
| 3. B | GO:0043025 | neuronal cell body |
| 3. B | GO:0010997 | anaphase-promoting complex binding |
| 3. B | GO:0000109 | nucleotide-excision repair complex |
| 3. B | GO:0061883 | clathrin-dependent endocytosis involved in vitellogenesis |
| 3. B | GO:0070840 | dynein complex binding |
| 3. B | GO:2001162 | positive regulation of histone H3-K79 methylation |
| 3. B | GO:0097428 | protein maturation by iron-sulfur cluster transfer |
| 3. B | GO:0019985 | translesion synthesis |
| 3. B | GO:1905168 | positive regulation of double-strand break repair via homologous recombination |
| 3. B | GO:0039023 | pronephric duct morphogenesis |
| 3. B | GO:0005826 | actomyosin contractile ring |
| 3. B | GO:0072520 | seminiferous tubule development |
| 3. B | GO:0006348 | |
| 3. B | GO:0009555 | pollen development |
| 3. B | GO:0040011 | locomotion |
| 3. B | GO:0090594 | inflammatory response to wounding |
| 3. B | GO:0090181 | regulation of cholesterol metabolic process |
| 3. B | GO:0005671 | obsolete Ada2/Gcn5/Ada3 transcription activator complex |
| 3. B | GO:2000393 | negative regulation of lamellipodium morphogenesis |
| 3. B | GO:0090114 | COPII-coated vesicle budding |
| 3. B | GO:0030836 | positive regulation of actin filament depolymerization |
| 3. B | GO:0045138 | nematode male tail tip morphogenesis |
| 3. B | GO:0008656 | cysteine-type endopeptidase activator activity involved in apoptotic process |
| 3. B | GO:0050765 | negative regulation of phagocytosis |
| 3. B | GO:0051539 | 4 iron, 4 sulfur cluster binding |
| 3. B | GO:0007015 | actin filament organization |
| 3. B | GO:0006367 | transcription initiation from RNA polymerase II promoter |
| 3. B | GO:2001137 | positive regulation of endocytic recycling |
| 3. B | GO:0006334 | nucleosome assembly |
| 3. B | GO:0016477 | cell migration |
| 3. B | GO:0061003 | positive regulation of dendritic spine morphogenesis |
| 3. B | GO:0010632 | regulation of epithelial cell migration |
| 3. B | GO:0017145 | stem cell division |
| 3. B | GO:0043521 | regulation of myosin II filament disassembly |
| 3. B | GO:0000349 | generation of catalytic spliceosome for first transesterification step |
| 3. B | GO:0005819 | spindle |
| 3. B | GO:0008611 | ether lipid biosynthetic process |
| 3. B | GO:0005053 | peroxisome matrix targeting signal-2 binding |
| 3. B | GO:0043130 | ubiquitin binding |
| 3. B | GO:0001667 | ameboidal-type cell migration |
| 3. B | GO:0031529 | ruffle organization |
| 3. B | GO:0010154 | fruit development |
| 3. B | GO:0048511 | rhythmic process |
| 3. B | GO:0048814 | regulation of dendrite morphogenesis |
| 3. B | GO:0071215 | cellular response to abscisic acid stimulus |
| 3. B | GO:0031589 | cell-substrate adhesion |
| 3. B | GO:0031037 | myosin II filament disassembly |
| 3. B | GO:0045638 | negative regulation of myeloid cell differentiation |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:0005834 | heterotrimeric G-protein complex |
| 3. B | GO:1900024 | regulation of substrate adhesion-dependent cell spreading |
| 3. B | GO:0030425 | dendrite |
| 3. B | GO:0036170 | filamentous growth of a population of unicellular organisms in response to starvation |
| 3. B | GO:0000472 | endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 3. B | GO:0000375 | RNA splicing, via transesterification reactions |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0009968 | negative regulation of signal transduction |
| 3. B | GO:0014909 | smooth muscle cell migration |
| 3. B | GO:0000123 | histone acetyltransferase complex |
| 3. B | GO:2000217 | regulation of invasive growth in response to glucose limitation |
| 3. B | GO:0031682 | G-protein gamma-subunit binding |
| 3. B | GO:0048527 | lateral root development |
| 3. B | GO:0000118 | histone deacetylase complex |
| 3. B | GO:0030515 | snoRNA binding |
| 3. B | GO:0005789 | endoplasmic reticulum membrane |
| 3. B | GO:0035064 | methylated histone binding |
| 3. B | GO:0099139 | cheating during chimeric sorocarp development |
| 3. B | GO:0009933 | meristem structural organization |
| 3. B | GO:0005681 | spliceosomal complex |
| 3. B | GO:0043297 | apical junction assembly |
| 3. B | GO:0051012 | microtubule sliding |
| 3. B | GO:0034388 | Pwp2p-containing subcomplex of 90S preribosome |
| 3. B | GO:1903013 | response to differentiation-inducing factor 1 |
| 3. B | GO:0030971 | receptor tyrosine kinase binding |
| 3. B | GO:0001764 | neuron migration |
| 3. B | GO:0030157 | pancreatic juice secretion |
| 3. B | GO:0016905 | myosin heavy chain kinase activity |
| 3. B | GO:2000394 | positive regulation of lamellipodium morphogenesis |
| 3. B | GO:0030178 | negative regulation of Wnt signaling pathway |
| 3. B | GO:0030127 | COPII vesicle coat |
| 3. B | GO:0071339 | MLL1 complex |
| 3. B | GO:0097750 | endosome membrane tubulation |
| 3. B | GO:0007312 | oocyte nucleus migration involved in oocyte dorsal/ventral axis specification |
| 3. B | GO:0032350 | regulation of hormone metabolic process |
| 3. B | GO:0034452 | dynactin binding |
| 3. B | GO:0005840 | ribosome |
| 3. B | GO:0098792 | xenophagy |
| 3. B | GO:0005525 | GTP binding |
| 3. B | GO:0010992 | ubiquitin recycling |
| 3. B | GO:1990266 | neutrophil migration |
| 3. B | GO:0007294 | germarium-derived oocyte fate determination |
| 3. B | GO:0030043 | actin filament fragmentation |
| 3. B | GO:0071007 | U2-type catalytic step 2 spliceosome |
| 3. B | GO:1903146 | regulation of autophagy of mitochondrion |
| 3. B | GO:0030834 | regulation of actin filament depolymerization |
| 3. B | GO:0016575 | histone deacetylation |
| 3. B | GO:0008352 | katanin complex |
| 3. B | GO:0070121 | Kupffer's vesicle development |
| 3. B | GO:0051299 | centrosome separation |
| 3. B | GO:0030120 | vesicle coat |
| 3. B | GO:0035844 | cloaca development |
| 3. B | GO:1903033 | positive regulation of microtubule plus-end binding |
| 3. B | GO:0000974 | Prp19 complex |
| 3. B | GO:0047391 | alkylglycerophosphoethanolamine phosphodiesterase activity |
| 3. B | GO:0071817 | MMXD complex |
| 3. B | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 3. B | GO:0042304 | regulation of fatty acid biosynthetic process |
| 3. B | GO:0010697 | negative regulation of mitotic spindle pole body separation |
| 3. B | GO:0005662 | DNA replication factor A complex |
| 3. B | GO:0008013 | beta-catenin binding |
| 3. B | GO:0005635 | nuclear envelope |
| 3. B | GO:1990949 | metaphase/anaphase transition of meiosis I |
| 3. B | GO:0043982 | histone H4-K8 acetylation |
| 3. B | GO:0040013 | negative regulation of locomotion |
| 3. B | GO:0050772 | positive regulation of axonogenesis |
| 3. B | GO:0016055 | Wnt signaling pathway |
| 3. B | GO:0051434 | BH3 domain binding |
| 3. B | GO:0051081 | nuclear membrane disassembly |
| 3. B | GO:0048873 | homeostasis of number of cells within a tissue |
| 3. B | GO:0051028 | mRNA transport |
| 3. B | GO:0031465 | Cul4B-RING E3 ubiquitin ligase complex |
| 3. B | GO:0071539 | protein localization to centrosome |
| 3. B | GO:0000245 | spliceosomal complex assembly |
| 3. B | GO:0001738 | morphogenesis of a polarized epithelium |
| 3. B | GO:2000738 | positive regulation of stem cell differentiation |
| 3. B | GO:0038202 | TORC1 signaling |
| 3. B | GO:0140285 | endosome fission |
| 3. B | GO:0010026 | trichome differentiation |
| 3. B | GO:0070734 | histone H3-K27 methylation |
| 3. B | GO:0071870 | cellular response to catecholamine stimulus |
| 3. B | GO:0051510 | regulation of unidimensional cell growth |
| 3. B | GO:0043966 | histone H3 acetylation |
| 3. B | GO:0007029 | endoplasmic reticulum organization |
| 3. B | GO:0048872 | homeostasis of number of cells |
| 3. B | GO:1990716 | axonemal central apparatus |
| 3. B | GO:0001675 | acrosome assembly |
| 3. B | GO:0061502 | early endosome to recycling endosome transport |
| 3. B | GO:1901386 | negative regulation of voltage-gated calcium channel activity |
| 3. B | GO:0003714 | transcription corepressor activity |
| 3. B | GO:0048545 | response to steroid hormone |
| 3. B | GO:0030687 | preribosome, large subunit precursor |
| 3. B | GO:0030723 | ovarian fusome organization |
| 3. B | GO:0007298 | border follicle cell migration |
| 3. B | GO:0045741 | positive regulation of epidermal growth factor-activated receptor activity |
| 3. B | GO:0005911 | cell-cell junction |
| 3. B | GO:0055087 | Ski complex |
| 3. B | GO:0045542 | positive regulation of cholesterol biosynthetic process |
| 3. B | GO:0039008 | pronephric nephron tubule morphogenesis |
| 3. B | GO:0010272 | response to silver ion |
| 3. B | GO:0048713 | regulation of oligodendrocyte differentiation |
| 3. B | GO:0001826 | inner cell mass cell differentiation |
| 3. B | GO:0055082 | cellular chemical homeostasis |
| 3. B | GO:0034399 | nuclear periphery |
| 3. B | GO:0034396 | negative regulation of transcription from RNA polymerase II promoter in response to iron |
| 3. B | GO:0000480 | endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 3. B | GO:1902525 | regulation of protein monoubiquitination |
| 3. B | GO:0050795 | regulation of behavior |
| 3. B | GO:0006310 | DNA recombination |
| 3. B | GO:0010044 | response to aluminum ion |
| 3. B | GO:0007097 | nuclear migration |
| 3. B | GO:0033276 | transcription factor TFTC complex |
| 3. B | GO:0007019 | microtubule depolymerization |
| 3. B | GO:2001224 | positive regulation of neuron migration |
| 3. B | GO:0007281 | germ cell development |
| 3. B | GO:0005815 | microtubule organizing center |
| 3. B | GO:1904672 | regulation of somatic stem cell population maintenance |
| 3. B | GO:0070534 | protein K63-linked ubiquitination |
| 3. B | GO:2001244 | positive regulation of intrinsic apoptotic signaling pathway |
| 3. B | GO:0051642 | centrosome localization |
| 3. B | GO:0005847 | mRNA cleavage and polyadenylation specificity factor complex |
| 3. B | GO:0032040 | small-subunit processome |
| 3. B | GO:0009585 | red, far-red light phototransduction |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0031616 | spindle pole centrosome |
| 3. B | GO:0030595 | leukocyte chemotaxis |
| 3. B | GO:0000417 | HIR complex |
| 3. B | GO:0000387 | spliceosomal snRNP assembly |
| 3. B | GO:0030308 | negative regulation of cell growth |
| 3. B | GO:0097635 | extrinsic component of autophagosome membrane |
| 3. B | GO:0031023 | microtubule organizing center organization |
| 3. B | GO:0060041 | retina development in camera-type eye |
| 3. B | GO:0009507 | chloroplast |
| 3. B | GO:0000463 | maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 3. B | GO:0000922 | spindle pole |
| 3. B | GO:0000421 | autophagosome membrane |
| 3. B | GO:0010073 | meristem maintenance |
| 3. B | GO:0005848 | mRNA cleavage stimulating factor complex |
| 3. B | GO:0032933 | SREBP signaling pathway |
| 3. B | GO:0009663 | plasmodesma organization |
| 3. B | GO:0007212 | dopamine receptor signaling pathway |
| 3. B | GO:0031139 | positive regulation of conjugation with cellular fusion |
| 3. B | GO:0060770 | negative regulation of epithelial cell proliferation involved in prostate gland development |
| 3. B | GO:2001205 | negative regulation of osteoclast development |
| 3. B | GO:0060590 | ATPase regulator activity |
| 3. B | GO:0048573 | photoperiodism, flowering |
| 3. B | GO:0045159 | myosin II binding |
| 3. B | GO:0000380 | alternative mRNA splicing, via spliceosome |
| 3. B | GO:0031339 | negative regulation of vesicle fusion |
| 3. B | GO:0007095 | mitotic G2 DNA damage checkpoint signaling |
| 3. B | GO:0034315 | regulation of Arp2/3 complex-mediated actin nucleation |
| 3. B | GO:0005741 | mitochondrial outer membrane |
| 3. B | GO:1902183 | regulation of shoot apical meristem development |
| 3. B | GO:0051219 | phosphoprotein binding |
| 3. B | GO:0048026 | positive regulation of mRNA splicing, via spliceosome |
| 3. B | GO:0051225 | spindle assembly |
| 3. B | GO:0051983 | regulation of chromosome segregation |
| 3. B | GO:0043984 | histone H4-K16 acetylation |
| 3. B | GO:0050918 | positive chemotaxis |
| 3. B | GO:0051901 | positive regulation of mitochondrial depolarization |
| 3. B | GO:0032430 | positive regulation of phospholipase A2 activity |
| 3. B | GO:0002446 | neutrophil mediated immunity |
| 3. B | GO:0034501 | protein localization to kinetochore |
| 3. B | GO:0015629 | actin cytoskeleton |
| 3. B | GO:0009967 | positive regulation of signal transduction |
| 3. B | GO:0046662 | regulation of oviposition |
| 3. B | GO:0006378 | mRNA polyadenylation |
| 3. B | GO:0009909 | regulation of flower development |
| 3. B | GO:0035973 | aggrephagy |
| 3. B | GO:0090660 | cerebrospinal fluid circulation |
| 3. B | GO:0045292 | mRNA cis splicing, via spliceosome |
| 3. B | GO:1903003 | positive regulation of protein deubiquitination |
| 3. B | GO:0033137 | negative regulation of peptidyl-serine phosphorylation |
| 3. B | GO:0030134 | COPII-coated ER to Golgi transport vesicle |
| 3. B | GO:0033365 | protein localization to organelle |
| 3. B | GO:0065001 | specification of axis polarity |
| 3. B | GO:1990630 | IRE1-RACK1-PP2A complex |
| 3. B | GO:0003700 | DNA-binding transcription factor activity |
| 3. B | GO:0000462 | maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 3. B | GO:0031507 | heterochromatin assembly |
| 3. B | GO:1990447 | U2 snRNP binding |
| 3. B | GO:0051126 | negative regulation of actin nucleation |
| 3. B | GO:0045309 | protein phosphorylated amino acid binding |
| 3. B | GO:0010393 | galacturonan metabolic process |
| 3. B | GO:0000266 | mitochondrial fission |
| 3. B | GO:0007099 | centriole replication |
| 3. B | GO:0046329 | negative regulation of JNK cascade |
| 3. B | GO:0080008 | Cul4-RING E3 ubiquitin ligase complex |
| 3. B | GO:0043122 | regulation of I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0007049 | cell cycle |
| 3. B | GO:0000045 | autophagosome assembly |
| 3. B | GO:0071363 | cellular response to growth factor stimulus |
| 3. B | GO:0043548 | phosphatidylinositol 3-kinase binding |
| 3. B | GO:0006909 | phagocytosis |
| 3. B | GO:0030332 | cyclin binding |
| 3. B | GO:0034613 | cellular protein localization |
| 3. B | GO:0090176 | microtubule cytoskeleton organization involved in establishment of planar polarity |
| 3. B | GO:0016593 | Cdc73/Paf1 complex |
| 3. B | GO:0005828 | kinetochore microtubule |
| 3. B | GO:0009908 | flower development |
| 3. B | GO:0001961 | positive regulation of cytokine-mediated signaling pathway |
| 3. B | GO:0009411 | response to UV |
| 3. B | GO:0071599 | otic vesicle development |
| 3. B | GO:1905281 | positive regulation of retrograde transport, endosome to Golgi |
| 3. B | GO:0040020 | regulation of meiotic nuclear division |
| 3. B | GO:0038180 | nerve growth factor signaling pathway |
| 3. B | GO:0031334 | positive regulation of protein-containing complex assembly |
| 3. B | GO:0016581 | NuRD complex |
| 3. B | GO:0045739 | positive regulation of DNA repair |
| 3. B | GO:0000781 | chromosome, telomeric region |
| 3. B | GO:0005875 | microtubule associated complex |
| 3. B | GO:0051276 | chromosome organization |
| 3. B | GO:0031929 | TOR signaling |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:0005813 | centrosome |
| 3. B | GO:1904951 | positive regulation of establishment of protein localization |
| 3. B | GO:0007186 | G protein-coupled receptor signaling pathway |
| 3. B | GO:0097525 | spliceosomal snRNP complex |
| 3. B | GO:0090207 | regulation of triglyceride metabolic process |
| 3. B | GO:0070507 | regulation of microtubule cytoskeleton organization |
| 3. B | GO:0031124 | mRNA 3'-end processing |
| 3. B | GO:0012507 | ER to Golgi transport vesicle membrane |
| 3. B | GO:0002102 | podosome |
| 3. B | GO:2000060 | positive regulation of ubiquitin-dependent protein catabolic process |
| 3. B | GO:0031648 | protein destabilization |
| 3. B | GO:0090135 | actin filament branching |
| 3. B | GO:2000653 | regulation of genetic imprinting |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0005938 | cell cortex |
| 3. B | GO:0005654 | nucleoplasm |
| 3. B | GO:0031932 | TORC2 complex |
| 3. B | GO:0043029 | T cell homeostasis |
| 3. B | GO:0034450 | ubiquitin-ubiquitin ligase activity |
| 3. B | GO:0045862 | positive regulation of proteolysis |
| 3. B | GO:1905191 | positive regulation of metaphase/anaphase transition of meiosis II |
| 3. B | GO:0031497 | chromatin assembly |
| 3. B | GO:0035327 | |
| 3. B | GO:0047496 | vesicle transport along microtubule |
| 3. B | GO:0033186 | CAF-1 complex |
| 3. B | GO:0051013 | microtubule severing |
| 3. B | GO:0005656 | nuclear pre-replicative complex |
| 3. B | GO:0046843 | dorsal appendage formation |
| 3. B | GO:0016567 | protein ubiquitination |
| 3. B | GO:0043162 | ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway |
| 3. B | GO:0008047 | enzyme activator activity |
| 3. B | GO:0046469 | platelet activating factor metabolic process |
| 3. B | GO:0006693 | prostaglandin metabolic process |
| 3. B | GO:0051321 | meiotic cell cycle |
| 3. B | GO:0030426 | growth cone |
| 3. B | GO:0044877 | protein-containing complex binding |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0071672 | negative regulation of smooth muscle cell chemotaxis |
| 3. B | GO:0048359 | mucilage metabolic process involved in seed coat development |
| 3. B | GO:0120095 | vacuole-isolation membrane contact site |
| 3. B | GO:0005700 | polytene chromosome |
| 3. B | GO:0051279 | regulation of release of sequestered calcium ion into cytosol |
| 3. B | GO:0051343 | positive regulation of cyclic-nucleotide phosphodiesterase activity |
| 3. B | GO:0016319 | mushroom body development |
| 3. B | GO:1900045 | negative regulation of protein K63-linked ubiquitination |
| 3. B | GO:0007405 | neuroblast proliferation |
| 3. B | GO:1990757 | ubiquitin ligase activator activity |
| 3. B | GO:0097431 | mitotic spindle pole |
| 3. B | GO:0045504 | dynein heavy chain binding |
| 3. B | GO:1904668 | positive regulation of ubiquitin protein ligase activity |
| 3. B | GO:0000012 | single strand break repair |
| 3. B | GO:0022618 | ribonucleoprotein complex assembly |
| 3. B | GO:0008247 | 1-alkyl-2-acetylglycerophosphocholine esterase complex |
| 3. B | GO:0034455 | t-UTP complex |
| 3. B | GO:0007303 | cytoplasmic transport, nurse cell to oocyte |
| 3. B | GO:0034316 | negative regulation of Arp2/3 complex-mediated actin nucleation |
| 3. B | GO:1901838 | positive regulation of transcription of nucleolar large rRNA by RNA polymerase I |
| 3. B | GO:0034511 | U3 snoRNA binding |
| 3. B | GO:0030036 | actin cytoskeleton organization |
| 3. B | GO:0019005 | SCF ubiquitin ligase complex |
| 3. B | GO:0001650 | fibrillar center |
| 3. B | GO:0030041 | actin filament polymerization |
| 3. B | GO:1990889 | H4K20me3 modified histone binding |
| 3. B | GO:0042826 | histone deacetylase binding |
| 3. B | GO:0046540 | U4/U6 x U5 tri-snRNP complex |
| 3. B | GO:0040035 | hermaphrodite genitalia development |
| 3. B | GO:0071005 | U2-type precatalytic spliceosome |
| 3. B | GO:0009792 | embryo development ending in birth or egg hatching |
| 3. B | GO:0061739 | protein lipidation involved in autophagosome assembly |
| 3. B | GO:0031931 | TORC1 complex |
| 3. B | GO:0015031 | protein transport |
| 3. B | GO:2001235 | positive regulation of apoptotic signaling pathway |
| 3. B | GO:2001268 | negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway |
| 3. B | GO:0031145 | anaphase-promoting complex-dependent catabolic process |
| 3. B | GO:0090129 | positive regulation of synapse maturation |
| 3. B | GO:0039689 | negative stranded viral RNA replication |
| 3. B | GO:0030864 | cortical actin cytoskeleton |
| 3. B | GO:0001222 | transcription corepressor binding |
| 3. B | GO:0051571 | positive regulation of histone H3-K4 methylation |
| 3. B | GO:0005730 | nucleolus |
| 3. B | GO:0035097 | histone methyltransferase complex |
| 3. B | GO:0075296 | positive regulation of ascospore formation |
| 3. B | GO:1990298 | bub1-bub3 complex |
| 3. B | GO:0016589 | NURF complex |
| 3. B | GO:0042753 | positive regulation of circadian rhythm |
| 3. B | GO:2000280 | regulation of root development |
| 3. B | GO:0098789 | pre-mRNA cleavage required for polyadenylation |
| 3. B | GO:0008298 | intracellular mRNA localization |
| 3. B | GO:0016005 | phospholipase A2 activator activity |
| 3. B | GO:0097361 | CIA complex |
| 3. B | GO:0048711 | positive regulation of astrocyte differentiation |
| 3. B | GO:0051130 | positive regulation of cellular component organization |
| 3. B | GO:0036158 | outer dynein arm assembly |
| 3. B | GO:0051383 | kinetochore organization |
| 3. B | GO:0008022 | protein C-terminus binding |
| 3. B | GO:0048142 | germarium-derived cystoblast division |
| 3. B | GO:0005078 | MAP-kinase scaffold activity |
| 3. B | GO:0019827 | stem cell population maintenance |
| 3. B | GO:0051661 | maintenance of centrosome location |
| 3. B | GO:0032036 | myosin heavy chain binding |
| 3. B | GO:0072686 | mitotic spindle |
| 3. B | GO:0090326 | positive regulation of locomotion involved in locomotory behavior |
| 3. B | GO:0045540 | regulation of cholesterol biosynthetic process |
| 3. B | GO:0042273 | ribosomal large subunit biogenesis |
| 3. B | GO:1904811 | positive regulation of dense core granule transport |
| 3. B | GO:0072432 | response to G1 DNA damage checkpoint signaling |
| 3. B | GO:0032934 | sterol binding |
| 3. B | GO:0003720 | telomerase activity |
| 3. B | GO:0030473 | nuclear migration along microtubule |
| 3. B | GO:0042052 | rhabdomere development |
| 3. B | GO:0071011 | precatalytic spliceosome |
| 3. B | GO:0043143 | regulation of translation by machinery localization |
| 3. B | GO:0070971 | endoplasmic reticulum exit site |
| 3. B | GO:0001891 | phagocytic cup |
| 3. B | GO:0051660 | establishment of centrosome localization |
| 3. B | GO:1903026 | negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding |
| 3. B | GO:0045014 | carbon catabolite repression of transcription by glucose |
| 3. B | GO:0070912 | Ddb1-Ckn1 complex |
| 3. B | GO:0080135 | regulation of cellular response to stress |
| 3. B | GO:0000381 | regulation of alternative mRNA splicing, via spliceosome |
| 3. B | GO:0003677 | DNA binding |
| 3. B | GO:0007018 | microtubule-based movement |
| 3. B | GO:0031101 | fin regeneration |
| 3. B | GO:0048471 | perinuclear region of cytoplasm |
| 3. B | GO:0051015 | actin filament binding |
| 3. B | GO:0046784 | viral mRNA export from host cell nucleus |
| 3. B | GO:0090724 | central region of growth cone |
| 3. B | GO:0120197 | mucociliary clearance |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0097027 | ubiquitin-protein transferase activator activity |
| 3. B | GO:0030507 | spectrin binding |
| 3. B | GO:0000398 | mRNA splicing, via spliceosome |
| 3. B | GO:1900091 | regulation of raffinose biosynthetic process |
| 3. B | GO:0030042 | actin filament depolymerization |
| 3. B | GO:0005814 | centriole |
| 3. B | GO:0045943 | positive regulation of transcription by RNA polymerase I |
| 3. B | GO:0000235 | astral microtubule |
| 3. B | GO:0060528 | secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development |
| 3. B | GO:2000574 | obsolete regulation of microtubule motor activity |
| 3. B | GO:0090049 | regulation of cell migration involved in sprouting angiogenesis |
| 3. B | GO:0010826 | negative regulation of centrosome duplication |
| 3. B | GO:0046716 | muscle cell cellular homeostasis |
| 3. B | GO:0038026 | reelin-mediated signaling pathway |
| 3. B | GO:1903378 | positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway |
| 3. B | GO:1904115 | axon cytoplasm |
| 3. B | GO:0021987 | cerebral cortex development |
| 3. B | GO:1903955 | positive regulation of protein targeting to mitochondrion |
| 3. B | GO:1900087 | positive regulation of G1/S transition of mitotic cell cycle |
| 3. B | GO:0070370 | cellular heat acclimation |
| 3. B | GO:0010118 | stomatal movement |
| 3. B | GO:0006364 | rRNA processing |
| 3. B | GO:0005680 | anaphase-promoting complex |
| 3. B | GO:0040019 | positive regulation of embryonic development |
| 3. B | GO:0097344 | Rix1 complex |
| 3. B | GO:0016607 | nuclear speck |
| 3. B | GO:0051726 | regulation of cell cycle |
| 3. B | GO:0001845 | phagolysosome assembly |
| 3. B | GO:0036180 | filamentous growth of a population of unicellular organisms in response to biotic stimulus |
| 3. B | GO:0045827 | negative regulation of isoprenoid metabolic process |
| 3. B | GO:0071407 | cellular response to organic cyclic compound |
| 3. B | GO:0090110 | COPII-coated vesicle cargo loading |
| 3. B | GO:0000776 | kinetochore |
| 3. B | GO:0070176 | DRM complex |
| 3. B | GO:0030862 | positive regulation of polarized epithelial cell differentiation |
| 3. B | GO:0007315 | pole plasm assembly |
| 3. B | GO:0005858 | axonemal dynein complex |
| 3. B | GO:0021819 | layer formation in cerebral cortex |
| 3. B | GO:0035591 | signaling adaptor activity |
| 3. B | GO:0008090 | retrograde axonal transport |
| 3. B | GO:0007369 | gastrulation |
| 3. B | GO:0071555 | cell wall organization |
| 3. B | GO:0005881 | cytoplasmic microtubule |
| 3. B | GO:0035266 | meristem growth |
| 3. B | GO:0045503 | dynein light chain binding |
| 3. B | GO:0001934 | positive regulation of protein phosphorylation |
| 3. B | GO:0030220 | platelet formation |
| 3. B | GO:0051898 | negative regulation of protein kinase B signaling |
| 3. B | GO:0070545 | PeBoW complex |
| 3. B | GO:1902463 | protein localization to cell leading edge |
| 3. B | GO:0048705 | skeletal system morphogenesis |
| 3. B | GO:0007399 | nervous system development |
| 3. B | GO:0003093 | regulation of glomerular filtration |
| 3. B | GO:0000132 | establishment of mitotic spindle orientation |
| 3. B | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 3. B | GO:1903861 | positive regulation of dendrite extension |
| 3. B | GO:0044666 | MLL3/4 complex |
| 3. B | GO:0042998 | positive regulation of Golgi to plasma membrane protein transport |
| 3. B | GO:0009991 | response to extracellular stimulus |
| 3. B | GO:0042247 | establishment of planar polarity of follicular epithelium |
| 3. B | GO:0031915 | positive regulation of synaptic plasticity |
| 3. B | GO:0006974 | cellular response to DNA damage stimulus |
| 3. B | GO:0031117 | positive regulation of microtubule depolymerization |
| 3. B | GO:0016559 | peroxisome fission |
| 3. B | GO:0045214 | sarcomere organization |
| 3. B | GO:0034709 | methylosome |
| 3. B | GO:0072593 | reactive oxygen species metabolic process |
| 3. B | GO:0016558 | protein import into peroxisome matrix |
| 3. B | GO:0016226 | iron-sulfur cluster assembly |
| 3. B | GO:0009867 | jasmonic acid mediated signaling pathway |
| 3. B | GO:0005669 | transcription factor TFIID complex |
| 3. B | GO:0006513 | protein monoubiquitination |
| 3. B | GO:0007059 | chromosome segregation |
| 3. B | GO:0001895 | retina homeostasis |
| 3. B | GO:0043622 | cortical microtubule organization |
| 3. B | GO:0043981 | histone H4-K5 acetylation |
| 3. B | GO:0120151 | positive regulation of mitotic actomyosin contractile ring disassembly |
| 3. B | GO:0006405 | RNA export from nucleus |
| 3. B | GO:0006333 | chromatin assembly or disassembly |
| 3. B | GO:0048854 | brain morphogenesis |
| 3. B | GO:0043320 | natural killer cell degranulation |
| 3. B | GO:0030277 | maintenance of gastrointestinal epithelium |
| 3. B | GO:0072499 | photoreceptor cell axon guidance |
| 3. B | GO:1903423 | positive regulation of synaptic vesicle recycling |
| 3. B | GO:0033597 | mitotic checkpoint complex |
| 3. B | GO:0031252 | cell leading edge |
| 3. B | GO:1905392 | plant organ morphogenesis |
| 3. B | GO:0030030 | cell projection organization |
| 3. B | GO:0035098 | ESC/E(Z) complex |
| 3. B | GO:0048813 | dendrite morphogenesis |
| 3. B | GO:0071013 | catalytic step 2 spliceosome |
| 3. B | GO:0009845 | seed germination |
| 3. B | GO:0031154 | culmination involved in sorocarp development |
| 3. B | GO:0060236 | regulation of mitotic spindle organization |
| 3. B | GO:0048188 | Set1C/COMPASS complex |
| 3. B | GO:0044297 | cell body |
| 3. B | GO:0034773 | histone H4-K20 trimethylation |
| 3. B | GO:0008635 | activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c |
| 3. B | GO:0071006 | U2-type catalytic step 1 spliceosome |
| 3. B | GO:2000582 | obsolete positive regulation of microtubule motor activity, plus-end-directed |
| 3. B | GO:0045199 | maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:1902773 | GTPase activator complex |
| 3. B | GO:0140582 | adenylate cyclase-activating G protein-coupled cAMP receptor signaling pathway |
| 3. B | GO:0051010 | microtubule plus-end binding |
| 3. B | GO:0043021 | ribonucleoprotein complex binding |
| 3. B | GO:0021895 | cerebral cortex neuron differentiation |
| 3. B | GO:0005868 | cytoplasmic dynein complex |
| 3. B | GO:0051020 | GTPase binding |
| 3. B | GO:0036035 | osteoclast development |
| 3. B | GO:0071541 | eukaryotic translation initiation factor 3 complex, eIF3m |
| 3. B | GO:0000437 | carbon catabolite repression of transcription from RNA polymerase II promoter |
| 3. B | GO:0090696 | post-embryonic plant organ development |
| 3. B | GO:0060117 | auditory receptor cell development |
| 3. B | GO:0032527 | protein exit from endoplasmic reticulum |
| 3. B | GO:0051721 | protein phosphatase 2A binding |
| 3. B | GO:0002098 | tRNA wobble uridine modification |
| 3. B | GO:0051568 | histone H3-K4 methylation |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0050773 | regulation of dendrite development |
| 3. B | GO:0098532 | histone H3-K27 trimethylation |
| 3. B | GO:0000466 | maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| 3. B | GO:0031146 | SCF-dependent proteasomal ubiquitin-dependent protein catabolic process |
| 3. B | GO:0017070 | U6 snRNA binding |
| 3. B | GO:0048135 | female germ-line cyst formation |
| 3. B | GO:0030686 | 90S preribosome |
| 3. B | GO:0008092 | cytoskeletal protein binding |
| 3. B | GO:0000445 | THO complex part of transcription export complex |
| 3. B | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
| 3. B | GO:0035767 | endothelial cell chemotaxis |
| 3. B | GO:0031464 | Cul4A-RING E3 ubiquitin ligase complex |
| 3. B | GO:0042393 | histone binding |
| 3. B | GO:0030286 | dynein complex |
| 3. B | GO:0036038 | MKS complex |
| 3. B | GO:0071001 | U4/U6 snRNP |
| 3. B | GO:1903725 | regulation of phospholipid metabolic process |
| 3. B | GO:0045598 | regulation of fat cell differentiation |
| 3. B | GO:0080001 | mucilage extrusion from seed coat |
| 3. B | GO:0042054 | histone methyltransferase activity |
| 3. B | GO:0006919 | activation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0097680 | double-strand break repair via classical nonhomologous end joining |
| 3. B | GO:0009723 | response to ethylene |
| 3. B | GO:0005871 | kinesin complex |
| 3. B | GO:0080182 | histone H3-K4 trimethylation |
| 3. B | GO:0008380 | RNA splicing |
| 3. B | GO:0003711 | transcription elongation regulator activity |
| 3. B | GO:0010659 | cardiac muscle cell apoptotic process |
| 3. B | GO:0051302 | regulation of cell division |
| 3. B | GO:1990452 | Parkin-FBXW7-Cul1 ubiquitin ligase complex |
| 3. B | GO:0097014 | ciliary plasm |
| 3. B | GO:0043293 | apoptosome |
| 3. B | GO:0030381 | chorion-containing eggshell pattern formation |
| 3. B | GO:0003777 | microtubule motor activity |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0050816 | phosphothreonine residue binding |
| 3. B | GO:0045842 | positive regulation of mitotic metaphase/anaphase transition |
| 3. B | GO:0090102 | cochlea development |
| 3. B | GO:0009640 | photomorphogenesis |
| 3. B | GO:0010224 | response to UV-B |
| 3. B | GO:0031570 | DNA integrity checkpoint signaling |
| 3. B | GO:0071933 | Arp2/3 complex binding |
| 3. B | GO:0042249 | establishment of planar polarity of embryonic epithelium |
| 3. B | GO:0042169 | SH2 domain binding |
| 3. B | GO:1903208 | negative regulation of hydrogen peroxide-induced neuron death |
| 3. B | GO:0030292 | protein tyrosine kinase inhibitor activity |
| 3. B | GO:0090443 | FAR/SIN/STRIPAK complex |
| 3. B | GO:0051572 | negative regulation of histone H3-K4 methylation |
| 3. B | GO:0006349 | regulation of gene expression by genomic imprinting |
| 3. B | GO:0120206 | photoreceptor distal connecting cilium |
| 3. B | GO:0048366 | leaf development |
| 3. B | GO:0010842 | retina layer formation |
| 3. B | GO:0072344 | rescue of stalled ribosome |
| 3. B | GO:1904950 | negative regulation of establishment of protein localization |
| 3. B | GO:1901796 | regulation of signal transduction by p53 class mediator |
| 3. B | GO:1900088 | regulation of inositol biosynthetic process |
| 3. B | GO:0000433 | carbon catabolite repression of transcription from RNA polymerase II promoter by glucose |
| 3. B | GO:0070016 | armadillo repeat domain binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q20168 | Probable coatomer subunit beta' | 2.16e-09 | 1.76e-07 | 4.55e-13 |
| 1. PB | Q6H8D6 | Putative coatomer subunit beta'-3 | 3.05e-09 | 1.69e-08 | 1.81e-12 |
| 1. PB | Q9VKK2 | GATOR complex protein Wdr59 | 6.41e-04 | 4.94e-02 | 9.60e-07 |
| 1. PB | Q54YD8 | Coatomer subunit beta' | 2.46e-08 | 1.88e-08 | 1.15e-12 |
| 1. PB | Q5R664 | Coatomer subunit beta' | 2.55e-08 | 6.01e-08 | 9.96e-12 |
| 1. PB | Q96WV5 | Putative coatomer subunit alpha | 1.01e-07 | 1.08e-04 | 2.66e-09 |
| 1. PB | F4ICD9 | Protein transport protein SEC31 homolog A | 3.51e-05 | 1.71e-03 | 5.42e-05 |
| 1. PB | Q9AUR7 | Coatomer subunit alpha-2 | 2.28e-08 | 3.22e-02 | 9.59e-11 |
| 1. PB | Q8BX17 | Gem-associated protein 5 | 3.72e-10 | 1.57e-20 | 2.90e-12 |
| 1. PB | A5DTX3 | Protein transport protein SEC31 | 1.76e-04 | 9.70e-04 | 3.82e-07 |
| 1. PB | Q8TEQ6 | Gem-associated protein 5 | 1.05e-10 | 1.14e-20 | 2.91e-13 |
| 1. PB | P41811 | Coatomer subunit beta' | 2.72e-08 | 6.59e-06 | 3.71e-09 |
| 1. PB | Q9CAA0 | Coatomer subunit beta'-1 | 6.89e-09 | 4.33e-08 | 3.44e-12 |
| 1. PB | O62621 | Coatomer subunit beta' | 8.78e-09 | 5.68e-09 | 3.40e-12 |
| 1. PB | Q4R4I8 | Coatomer subunit beta' | 1.13e-09 | 4.51e-08 | 9.54e-12 |
| 1. PB | A8WGF4 | Intraflagellar transport protein 122 homolog | 2.22e-09 | 2.69e-12 | 2.11e-05 |
| 1. PB | Q9C827 | Coatomer subunit beta'-2 | 3.69e-09 | 3.80e-08 | 6.53e-12 |
| 1. PB | O35142 | Coatomer subunit beta' | 9.47e-10 | 4.22e-08 | 1.09e-11 |
| 1. PB | Q6NWV3 | Intraflagellar transport protein 122 homolog | 2.73e-05 | 1.10e-13 | 1.66e-04 |
| 1. PB | Q6NYH1 | Intraflagellar transport protein 122 homolog | 1.67e-06 | 4.37e-12 | 2.82e-06 |
| 1. PB | Q5VQ78 | Coatomer subunit beta'-1 | 4.60e-09 | 4.11e-08 | 2.37e-11 |
| 1. PB | P35606 | Coatomer subunit beta' | 2.54e-08 | 8.32e-08 | 1.06e-11 |
| 1. PB | Q8L828 | Coatomer subunit beta'-3 | 1.32e-08 | 3.29e-08 | 1.22e-11 |
| 1. PB | P35605 | Coatomer subunit beta' | 3.49e-09 | 1.57e-07 | 9.15e-12 |
| 1. PB | O55029 | Coatomer subunit beta' | 1.23e-09 | 1.21e-07 | 1.03e-11 |
| 1. PB | Q8IZU2 | WD repeat-containing protein 17 | 0 | 1.54e-149 | 0.0 |
| 1. PB | G5EFW7 | Intraflagellar transport protein 122 homolog | 2.31e-08 | 5.76e-14 | 2.17e-06 |
| 1. PB | Q6H8D5 | Coatomer subunit beta'-2 | 5.96e-09 | 4.21e-09 | 4.01e-13 |
| 2. P | Q920Q4 | Vacuolar protein sorting-associated protein 16 homolog | 5.79e-05 | 1.87e-04 | NA |
| 2. P | P93043 | Vacuolar protein sorting-associated protein 41 homolog | 2.51e-03 | 7.78e-03 | NA |
| 2. P | Q9UT38 | Probable vacuolar protein sorting-associated protein 16 homolog | 8.88e-05 | 3.64e-03 | NA |
| 2. P | Q69ZJ7 | Guanine nucleotide exchange factor subunit RIC1 | 6.32e-05 | 2.27e-07 | NA |
| 2. P | Q19954 | Vacuolar protein sorting-associated protein 41 homolog | 4.05e-03 | 2.62e-03 | NA |
| 2. P | A4QNS7 | GATOR complex protein MIOS-B | 1.46e-04 | 1.47e-07 | NA |
| 2. P | O95163 | Elongator complex protein 1 | 7.64e-06 | 1.08e-06 | NA |
| 2. P | Q551B5 | GATOR complex protein MIOS | 1.10e-01 | 8.95e-07 | NA |
| 2. P | P36161 | Nucleoporin NUP133 | 1.47e-03 | 3.13e-04 | NA |
| 2. P | F1QEB7 | WD repeat-containing protein 11 | 5.26e-08 | 1.10e-08 | NA |
| 2. P | Q9JKU3 | Intraflagellar transport protein 172 homolog | 9.16e-06 | 1.06e-09 | NA |
| 2. P | Q22830 | Intraflagellar transport protein osm-1 | 2.14e-06 | 1.03e-10 | NA |
| 2. P | Q9P6N4 | E3 ubiquitin-protein ligase pep5 | 1.71e-05 | 1.53e-02 | NA |
| 2. P | Q7M733 | Hermansky-Pudlak syndrome 6 protein homolog | 4.23e-03 | 8.27e-04 | NA |
| 2. P | Q618H8 | Vacuolar protein sorting-associated protein 41 homolog | 4.84e-03 | 8.54e-04 | NA |
| 2. P | Q8WUM0 | Nuclear pore complex protein Nup133 | 5.61e-03 | 9.88e-03 | NA |
| 2. P | Q8C456 | WD repeat-containing and planar cell polarity effector protein fritz homolog | 1.44e-03 | 6.67e-08 | NA |
| 2. P | Q9NXC5 | GATOR complex protein MIOS | 4.77e-04 | 1.26e-07 | NA |
| 2. P | Q5RCA2 | GATOR complex protein MIOS | 1.69e-04 | 6.09e-08 | NA |
| 2. P | P49754 | Vacuolar protein sorting-associated protein 41 homolog | 1.73e-03 | 1.41e-05 | NA |
| 2. P | A7MB11 | Transforming growth factor-beta receptor-associated protein 1 | 2.46e-05 | 1.45e-04 | NA |
| 2. P | Q9VQ89 | GATOR complex protein MIOS | 5.02e-04 | 6.36e-06 | NA |
| 2. P | O59704 | Elongator complex protein 1 | 3.14e-05 | 1.26e-10 | NA |
| 2. P | Q9P253 | Vacuolar protein sorting-associated protein 18 homolog | 5.77e-03 | 3.94e-04 | NA |
| 2. P | Q8K1X1 | WD repeat-containing protein 11 | 1.01e-07 | 9.98e-08 | NA |
| 2. P | Q9P7N3 | Vacuolar protein sorting-associated protein 41 | 6.29e-03 | 3.83e-03 | NA |
| 2. P | Q96JC1 | Vam6/Vps39-like protein | 1.12e-05 | 3.22e-03 | NA |
| 2. P | Q5RHH4 | Intraflagellar transport protein 172 homolog | 7.99e-06 | 5.00e-08 | NA |
| 2. P | Q1ZXS5 | Vacuolar protein sorting-associated protein 39 homolog | 9.97e-06 | 5.94e-04 | NA |
| 2. P | Q8BND3 | WD repeat-containing protein 35 | 8.07e-09 | 1.53e-07 | NA |
| 2. P | P38164 | SEH-associated protein 4 | 1.00e-02 | 1.33e-03 | NA |
| 2. P | Q4ADV7 | Guanine nucleotide exchange factor subunit RIC1 | 9.04e-05 | 8.41e-07 | NA |
| 2. P | F4I312 | Vacuolar sorting protein 3 | 2.97e-03 | 7.63e-03 | NA |
| 2. P | Q9D180 | Cilia- and flagella-associated protein 57 | 1.31e-05 | 1.03e-02 | NA |
| 2. P | Q9Y817 | Regulator of V-ATPase in vacuolar membrane protein 1 | 8.80e-07 | 8.09e-09 | NA |
| 2. P | Q54YB3 | TSET complex member tstE | 6.27e-06 | 3.41e-02 | NA |
| 2. P | Q9V3C5 | Guanine nucleotide exchange factor subunit Rich | 1.09e-04 | 2.54e-06 | NA |
| 2. P | Q9BZH6 | WD repeat-containing protein 11 | 3.39e-06 | 5.43e-07 | NA |
| 2. P | Q8L5Y0 | Vacuolar sorting protein 39 | 4.38e-04 | 6.24e-03 | NA |
| 2. P | Q5KU39 | Vacuolar protein sorting-associated protein 41 homolog | 1.76e-03 | 1.07e-05 | NA |
| 2. P | Q8BLY7 | Hermansky-Pudlak syndrome 6 protein homolog | 2.11e-02 | 8.18e-05 | NA |
| 2. P | Q9HBG6 | Intraflagellar transport protein 122 homolog | 1.36e-06 | 8.58e-14 | NA |
| 2. P | Q9P2L0 | WD repeat-containing protein 35 | 1.36e-08 | 1.42e-05 | NA |
| 2. P | Q5DM57 | Intraflagellar transport protein 172 | 1.18e-05 | 2.01e-08 | NA |
| 2. P | Q96RY7 | Intraflagellar transport protein 140 homolog | 1.98e-07 | 1.55e-07 | NA |
| 2. P | Q54YP4 | Vacuolar protein sorting-associated protein 11 homolog | 1.08e-04 | 5.75e-03 | NA |
| 2. P | A0A2R8QPS5 | Guanine nucleotide exchange factor subunit RIC1 | 1.14e-04 | 7.12e-04 | NA |
| 2. P | Q177G4 | Hermansky-Pudlak syndrome 5 protein homolog | 6.40e-03 | 1.77e-03 | NA |
| 2. P | P93231 | Vacuolar protein sorting-associated protein 41 homolog | 3.46e-03 | 2.20e-03 | NA |
| 2. P | Q3UGF1 | WD repeat-containing protein 19 | 3.13e-06 | 1.43e-11 | NA |
| 2. P | Q5U5D4 | GATOR complex protein MIOS-A | 5.00e-04 | 5.78e-08 | NA |
| 2. P | Q09417 | Guanine nucleotide exchange factor subunit R06F6.8 | 1.41e-04 | 3.95e-03 | NA |
| 2. P | P47104 | Regulator of V-ATPase in vacuolar membrane protein 1 | 1.20e-06 | 1.08e-11 | NA |
| 2. P | B1WC10 | WD repeat-containing and planar cell polarity effector protein fritz homolog | 1.64e-03 | 2.52e-08 | NA |
| 2. P | Q8R5L3 | Vam6/Vps39-like protein | 1.76e-05 | 1.38e-02 | NA |
| 2. P | Q24314 | Vacuolar protein sorting-associated protein 18 homolog | 3.35e-03 | 8.68e-03 | NA |
| 2. P | F1QNV4 | Nuclear pore complex protein Nup133 | 3.53e-03 | 1.90e-03 | NA |
| 2. P | E9PY46 | Intraflagellar transport protein 140 homolog | 6.88e-07 | 8.09e-09 | NA |
| 2. P | Q297N8 | Hermansky-Pudlak syndrome 5 protein homolog | 1.44e-03 | 8.95e-03 | NA |
| 2. P | P40064 | Nucleoporin NUP157 | 2.73e-02 | 6.24e-03 | NA |
| 2. P | Q9VGK7 | Putative elongator complex protein 1 | 4.98e-06 | 6.60e-09 | NA |
| 2. P | O13955 | Vacuolar morphogenesis protein 6 | 1.26e-02 | 1.42e-02 | NA |
| 2. P | Q9FNA4 | Elongator complex protein 1 | 4.75e-07 | 1.99e-12 | NA |
| 2. P | Q9W040 | Intraflagellar transport protein 172 homolog | 7.38e-06 | 3.27e-13 | NA |
| 2. P | Q8N3P4 | Vacuolar protein sorting-associated protein 8 homolog | 1.61e-02 | 7.04e-03 | NA |
| 2. P | Q9SJ40 | Vacuolar protein-sorting-associated protein 11 homolog | 2.88e-05 | 7.99e-05 | NA |
| 2. P | Q9H269 | Vacuolar protein sorting-associated protein 16 homolog | 7.44e-05 | 2.07e-03 | NA |
| 2. P | Q6VH22 | Intraflagellar transport protein 172 homolog | 2.61e-05 | 1.12e-09 | NA |
| 2. P | Q60V75 | Vacuolar protein sorting-associated protein 16 homolog | 1.91e-04 | 3.34e-02 | NA |
| 2. P | Q32NR9 | WD repeat-containing and planar cell polarity effector protein fritz homolog | 2.46e-03 | 1.05e-06 | NA |
| 2. P | Q9H270 | Vacuolar protein sorting-associated protein 11 homolog | 2.59e-05 | 4.09e-05 | NA |
| 2. P | Q802U2 | GATOR complex protein MIOS | 1.56e-04 | 3.89e-06 | NA |
| 2. P | Q93VQ0 | Protein VACUOLELESS1 | 4.11e-04 | 4.44e-06 | NA |
| 2. P | A6N6J5 | WD repeat-containing protein 35 | 1.03e-08 | 5.10e-07 | NA |
| 2. P | Q8R307 | Vacuolar protein sorting-associated protein 18 homolog | 2.46e-03 | 5.39e-04 | NA |
| 2. P | Q8VE19 | GATOR complex protein MIOS | 5.37e-04 | 3.12e-07 | NA |
| 2. P | O74925 | Vacuolar membrane protein pep3 | 4.77e-03 | 1.82e-03 | NA |
| 2. P | Q24118 | Protein pigeon | 5.50e-03 | 1.95e-02 | NA |
| 2. P | Q3UR70 | Transforming growth factor-beta receptor-associated protein 1 | 2.55e-05 | 2.18e-04 | NA |
| 2. P | Q8R0G9 | Nuclear pore complex protein Nup133 | 5.24e-03 | 2.87e-02 | NA |
| 2. P | Q86YV9 | Hermansky-Pudlak syndrome 6 protein | 7.12e-03 | 3.03e-04 | NA |
| 2. P | Q91W86 | Vacuolar protein sorting-associated protein 11 homolog | 7.14e-05 | 3.28e-05 | NA |
| 2. P | Q9VHN9 | Hermansky-Pudlak syndrome 5 protein homolog | 5.83e-04 | 2.62e-03 | NA |
| 2. P | Q9UG01 | Intraflagellar transport protein 172 homolog | 1.08e-05 | 2.40e-09 | NA |
| 2. P | Q0P5W1 | Vacuolar protein sorting-associated protein 8 homolog | 1.40e-02 | 6.56e-03 | NA |
| 2. P | Q09866 | Uncharacterized WD repeat-containing protein C12G12.01c | 1.66e-03 | 7.94e-03 | NA |
| 2. P | Q11182 | Vacuolar protein sorting-associated protein 16 homolog | 7.11e-05 | 3.71e-02 | NA |
| 2. P | Q9VCW3 | Nuclear pore complex protein Nup133 | 1.06e-02 | 1.20e-02 | NA |
| 2. P | Q8NEZ3 | WD repeat-containing protein 19 | 3.49e-06 | 1.95e-11 | NA |
| 2. P | Q8VHU4 | Elongator complex protein 1 | 4.96e-06 | 6.13e-06 | NA |
| 2. P | G5ECZ4 | WD repeat-containing protein dyf-2 | 6.67e-07 | 1.78e-10 | NA |
| 2. P | G0S9A7 | Nucleoporin NUP133 | 1.64e-02 | 1.79e-04 | NA |
| 2. P | Q7TT37 | Elongator complex protein 1 | 5.42e-06 | 2.17e-06 | NA |
| 2. P | O95876 | WD repeat-containing and planar cell polarity effector protein fritz homolog | 3.10e-03 | 1.97e-07 | NA |
| 2. P | Q8WUH2 | Transforming growth factor-beta receptor-associated protein 1 | 5.65e-04 | 9.20e-04 | NA |
| 2. P | A4IG72 | Transforming growth factor-beta receptor-associated protein 1 homolog | 1.27e-05 | 2.75e-04 | NA |
| 2. P | Q06706 | Elongator complex protein 1 | 1.04e-04 | 8.71e-10 | NA |
| 2. P | Q5E9L7 | Vacuolar protein sorting-associated protein 16 homolog | NA | 1.08e-03 | NA |
| 2. P | Q8WND5 | Elongator complex protein 1 | 3.28e-06 | 8.66e-06 | NA |
| 2. P | P59015 | Vacuolar protein sorting-associated protein 18 homolog | 3.31e-04 | 6.98e-05 | NA |
| 2. P | O13756 | Vacuolar protein sorting-associated protein 8 | 1.94e-02 | 1.41e-02 | NA |
| 2. P | Q2TAQ1 | Putative elongator complex protein 1 | 1.55e-05 | 1.16e-08 | NA |
| 3. B | Q9D994 | WD repeat-containing protein 38 | 1.18e-09 | NA | 7.79e-14 |
| 3. B | Q09406 | Autophagic-related protein 16.2 | 3.76e-05 | NA | 1.08e-04 |
| 3. B | Q8YRI1 | Uncharacterized WD repeat-containing protein alr3466 | 1.03e-07 | NA | 1.73e-28 |
| 3. B | Q8AVS9 | DDB1- and CUL4-associated factor 10 | 1.11e-02 | NA | 0.046 |
| 3. B | B4JWA1 | Lissencephaly-1 homolog | 8.23e-13 | NA | 6.06e-18 |
| 3. B | A2R3Z3 | Mitochondrial division protein 1 | 5.40e-03 | NA | 9.15e-07 |
| 3. B | Q05048 | Cleavage stimulation factor subunit 1 | 4.22e-09 | NA | 3.06e-04 |
| 3. B | A1L271 | Guanine nucleotide-binding protein subunit beta-5a | 9.88e-12 | NA | 1.38e-10 |
| 3. B | Q8SRK1 | Histone acetyltransferase type B subunit 2 | 2.20e-08 | NA | 3.65e-14 |
| 3. B | O43172 | U4/U6 small nuclear ribonucleoprotein Prp4 | 3.15e-11 | NA | 1.57e-14 |
| 3. B | P87177 | Uncharacterized WD repeat-containing protein C3D6.12 | 1.86e-06 | NA | 0.005 |
| 3. B | P0C7V8 | DDB1- and CUL4-associated factor 8-like protein 2 | 7.08e-04 | NA | 0.001 |
| 3. B | P53197 | APC/C activator protein CDH1 | 4.65e-04 | NA | 3.13e-08 |
| 3. B | O94244 | Histone acetyltransferase type B subunit 2 | 3.50e-08 | NA | 8.92e-08 |
| 3. B | B3NPW0 | Lissencephaly-1 homolog | 2.67e-09 | NA | 1.47e-17 |
| 3. B | Q6P0D9 | Probable cytosolic iron-sulfur protein assembly protein ciao1 | 1.99e-11 | NA | 1.07e-05 |
| 3. B | Q1DIW7 | Mitochondrial division protein 1 | 4.41e-02 | NA | 3.83e-05 |
| 3. B | Q04305 | U3 small nucleolar RNA-associated protein 15 | 6.64e-05 | NA | 0.006 |
| 3. B | Q9NYS7 | WD repeat and SOCS box-containing protein 2 | 1.35e-04 | NA | 2.62e-07 |
| 3. B | Q15061 | WD repeat-containing protein 43 | 2.54e-03 | NA | 4.22e-04 |
| 3. B | B4MY77 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 4.76e-12 | NA | 7.48e-08 |
| 3. B | P62881 | Guanine nucleotide-binding protein subunit beta-5 | 1.18e-05 | NA | 7.37e-11 |
| 3. B | Q92636 | Protein FAN | 8.00e-02 | NA | 0.002 |
| 3. B | Q2GVT8 | Protein transport protein SEC31 | 3.52e-03 | NA | 7.63e-10 |
| 3. B | Q6CEW7 | Ribosome biogenesis protein YTM1 | 9.17e-04 | NA | 0.006 |
| 3. B | Q12788 | Transducin beta-like protein 3 | 7.26e-07 | NA | 3.34e-13 |
| 3. B | C5FP68 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 2.04e-03 | NA | 8.48e-15 |
| 3. B | Q8IZQ1 | WD repeat and FYVE domain-containing protein 3 | NA | NA | 0.018 |
| 3. B | B8PD53 | Nuclear distribution protein PAC1-2 | NA | NA | 2.10e-12 |
| 3. B | F4K5R6 | Cell division cycle 20.6, cofactor of APC complex | 1.15e-04 | NA | 3.34e-09 |
| 3. B | Q86HX1 | Protein HIRA | 4.16e-04 | NA | 1.79e-05 |
| 3. B | Q8MYE8 | Probable proteasomal ATPase-associated factor 1 | 2.27e-05 | NA | 6.09e-08 |
| 3. B | Q7SYD5 | Protein transport protein Sec31A | 4.36e-03 | NA | 1.43e-04 |
| 3. B | Q32LN7 | WD repeat-containing protein 61 | 7.00e-11 | NA | 8.90e-05 |
| 3. B | P41318 | Target of rapamycin complex subunit LST8 | 1.60e-08 | NA | 5.45e-05 |
| 3. B | Q6BZX5 | Protein transport protein SEC13 | 9.29e-08 | NA | 1.86e-04 |
| 3. B | Q149M9 | NACHT domain- and WD repeat-containing protein 1 | 1.39e-05 | NA | 0.002 |
| 3. B | P38968 | Protein transport protein SEC31 | 2.64e-04 | NA | 3.38e-05 |
| 3. B | Q6NZH4 | Lissencephaly-1 homolog | 7.70e-09 | NA | 2.67e-17 |
| 3. B | C7Z6H2 | Nuclear distribution protein PAC1 | 4.01e-11 | NA | 2.94e-10 |
| 3. B | Q59RH5 | Histone acetyltransferase type B subunit 2 | 9.08e-08 | NA | 6.93e-07 |
| 3. B | B0LSW3 | Platelet-activating factor acetylhydrolase IB subunit beta | 5.93e-13 | NA | 3.03e-16 |
| 3. B | P49846 | Transcription initiation factor TFIID subunit 5 | 1.98e-03 | NA | 2.96e-11 |
| 3. B | Q8SQS4 | Transcription initiation factor TFIID subunit 5 | 3.45e-08 | NA | 1.57e-06 |
| 3. B | Q5FW06 | DDB1- and CUL4-associated factor 10 | 7.88e-05 | NA | 0.003 |
| 3. B | Q9R1K5 | Fizzy-related protein homolog | 1.80e-03 | NA | 3.50e-05 |
| 3. B | A2QP30 | Nuclear distribution protein nudF | 1.65e-11 | NA | 2.51e-08 |
| 3. B | Q4I7X1 | Polyadenylation factor subunit 2 | 1.15e-03 | NA | 1.92e-08 |
| 3. B | Q8YV57 | Uncharacterized WD repeat-containing protein all2124 | 5.49e-08 | NA | 1.26e-23 |
| 3. B | Q8HXX0 | Platelet-activating factor acetylhydrolase IB subunit alpha | 5.41e-13 | NA | 9.40e-16 |
| 3. B | Q9P775 | Uncharacterized WD repeat-containing protein C17D11.16 | 1.43e-09 | NA | 4.39e-05 |
| 3. B | B3H5K9 | Protein NEDD1 | 5.01e-05 | NA | 0.013 |
| 3. B | Q80T85 | DDB1- and CUL4-associated factor 5 | 1.67e-03 | NA | 0.001 |
| 3. B | Q944S2 | WD repeat-containing protein GTS1 | 1.22e-04 | NA | 0.001 |
| 3. B | Q4X0M4 | Protein transport protein sec31 | 2.45e-03 | NA | 2.72e-06 |
| 3. B | Q499N3 | WD repeat-containing protein 18 | 1.28e-03 | NA | 0.033 |
| 3. B | A3LNI7 | Nuclear distribution protein PAC1 | 1.31e-06 | NA | 3.58e-05 |
| 3. B | O43071 | Pre-mRNA-processing factor 17 | 5.25e-06 | NA | 1.07e-06 |
| 3. B | Q0VC24 | Ribosome biogenesis protein WDR12 | 4.00e-05 | NA | 2.94e-05 |
| 3. B | Q05583 | Cytosolic iron-sulfur protein assembly protein 1 | 4.69e-07 | NA | 5.28e-11 |
| 3. B | O59894 | Peroxisomal targeting signal 2 receptor | 6.19e-11 | NA | 3.51e-09 |
| 3. B | Q9D0I6 | WD repeat, SAM and U-box domain-containing protein 1 | 9.11e-04 | NA | 1.90e-06 |
| 3. B | Q86TI4 | WD repeat-containing protein 86 | 1.05e-07 | NA | 1.85e-11 |
| 3. B | Q5ACL4 | Restriction of telomere capping protein 1 | 5.44e-02 | NA | 0.009 |
| 3. B | Q9FKT5 | THO complex subunit 3 | 2.41e-10 | NA | 2.78e-06 |
| 3. B | Q0U1B1 | Nuclear distribution protein PAC1 | 3.21e-11 | NA | 1.31e-09 |
| 3. B | Q4WVS4 | Mitochondrial division protein 1 | 7.50e-03 | NA | 1.68e-05 |
| 3. B | Q5QP82 | DDB1- and CUL4-associated factor 10 | 6.38e-03 | NA | 0.004 |
| 3. B | Q54MZ3 | Anaphase-promoting complex subunit cdc20 | 2.22e-04 | NA | 2.36e-11 |
| 3. B | Q8NFH4 | Nucleoporin Nup37 | 1.83e-07 | NA | 7.31e-04 |
| 3. B | Q90ZL4 | Lissencephaly-1 homolog | 6.47e-13 | NA | 4.24e-17 |
| 3. B | P63245 | Receptor of activated protein C kinase 1 | 1.95e-10 | NA | 2.25e-06 |
| 3. B | Q28DT7 | Polycomb protein eed | 4.84e-05 | NA | 0.028 |
| 3. B | A8QB65 | Ribosome biogenesis protein WDR12 homolog | 5.00e-04 | NA | 0.001 |
| 3. B | Q9C270 | Periodic tryptophan protein 2 homolog | 5.48e-06 | NA | 3.96e-06 |
| 3. B | Q54N86 | F-box/WD repeat-containing protein A-like protein | 1.02e-03 | NA | 2.00e-05 |
| 3. B | Q5R1S9 | Chromatin assembly factor 1 subunit B | 1.94e-05 | NA | 9.28e-05 |
| 3. B | Q94AD8 | F-box/WD-40 repeat-containing protein At5g21040 | 2.02e-03 | NA | 0.014 |
| 3. B | O17468 | Protein HIRA homolog | 2.98e-04 | NA | 0.001 |
| 3. B | P61480 | Ribosome biogenesis protein WDR12 | 1.97e-05 | NA | 4.11e-07 |
| 3. B | P0CS54 | Ribosome biogenesis protein YTM1 | 2.48e-04 | NA | 2.90e-09 |
| 3. B | Q6P1W0 | Denticleless protein homolog | 1.40e-04 | NA | 1.03e-05 |
| 3. B | Q3SWS8 | mRNA export factor | 1.11e-05 | NA | 8.31e-07 |
| 3. B | Q99973 | Telomerase protein component 1 | 3.78e-06 | NA | 0.009 |
| 3. B | O75037 | Kinesin-like protein KIF21B | 1.33e-02 | NA | 0.037 |
| 3. B | Q54LT8 | Serine-threonine kinase receptor-associated protein | 3.40e-07 | NA | 6.78e-05 |
| 3. B | Q94A40 | Coatomer subunit alpha-1 | 1.65e-05 | NA | 3.30e-10 |
| 3. B | Q9HAV0 | Guanine nucleotide-binding protein subunit beta-4 | 2.30e-12 | NA | 6.40e-08 |
| 3. B | B3MC74 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 4.64e-12 | NA | 4.21e-07 |
| 3. B | O13286 | WD repeat-containing protein srw1 | 2.15e-04 | NA | 5.34e-07 |
| 3. B | Q0J3D9 | Coatomer subunit alpha-3 | 2.61e-08 | NA | 1.50e-10 |
| 3. B | Q6DH44 | WD repeat domain-containing protein 83 | 9.37e-08 | NA | 1.43e-05 |
| 3. B | Q8TAF3 | WD repeat-containing protein 48 | 2.02e-03 | NA | 0.001 |
| 3. B | O93277 | WD repeat-containing protein 1 | 2.00e-13 | NA | 8.49e-04 |
| 3. B | P54313 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 | 2.49e-12 | NA | 3.47e-07 |
| 3. B | Q8AVH1 | Histone-binding protein RBBP7 | 7.84e-07 | NA | 2.79e-10 |
| 3. B | Q6FJZ9 | Pre-mRNA-splicing factor PRP46 | 6.69e-06 | NA | 1.95e-07 |
| 3. B | Q7Z4S6 | Kinesin-like protein KIF21A | 3.03e-02 | NA | 0.030 |
| 3. B | Q5ZKU8 | p21-activated protein kinase-interacting protein 1-like | 1.52e-05 | NA | 0.002 |
| 3. B | Q6NLV4 | Flowering time control protein FY | 2.04e-05 | NA | 4.63e-10 |
| 3. B | Q2TBS9 | WD40 repeat-containing protein SMU1 | 3.95e-06 | NA | 1.71e-07 |
| 3. B | A7ETB3 | Mitochondrial division protein 1 | 1.29e-02 | NA | 3.37e-05 |
| 3. B | Q8VE80 | THO complex subunit 3 | 2.83e-05 | NA | 6.94e-08 |
| 3. B | Q29RH4 | THO complex subunit 3 | 4.02e-05 | NA | 7.93e-08 |
| 3. B | Q01277 | Probable E3 ubiquitin ligase complex SCF subunit scon-2 | 3.19e-04 | NA | 6.65e-11 |
| 3. B | Q9VU68 | Actin-interacting protein 1 | 0.00e+00 | NA | 7.11e-06 |
| 3. B | Q86A97 | EARP-interacting protein homolog | 6.48e-05 | NA | 4.15e-05 |
| 3. B | Q3TZ89 | Protein transport protein Sec31B | 6.77e-05 | NA | 2.33e-07 |
| 3. B | O88879 | Apoptotic protease-activating factor 1 | 2.24e-08 | NA | 2.36e-08 |
| 3. B | Q28I85 | POC1 centriolar protein homolog A | 2.67e-04 | NA | 1.38e-10 |
| 3. B | Q4R304 | Histone-binding protein RBBP7 | 8.19e-07 | NA | 8.97e-11 |
| 3. B | Q5RE10 | EARP and GARP complex-interacting protein 1 | 4.62e-10 | NA | 0.005 |
| 3. B | Q29KQ0 | Ribosome biogenesis protein WDR12 homolog | 2.44e-05 | NA | 5.58e-05 |
| 3. B | P25382 | Ribosome assembly protein 4 | 4.12e-05 | NA | 6.91e-16 |
| 3. B | Q5I0B9 | Autophagy-related protein 16 | 6.45e-03 | NA | 1.44e-04 |
| 3. B | Q921C3 | Bromodomain and WD repeat-containing protein 1 | 4.59e-02 | NA | 1.13e-09 |
| 3. B | O94979 | Protein transport protein Sec31A | 3.92e-04 | NA | 1.54e-05 |
| 3. B | Q7RY68 | Polyadenylation factor subunit 2 | 6.95e-03 | NA | 1.29e-06 |
| 3. B | F1MNN4 | F-box/WD repeat-containing protein 7 | 2.78e-05 | NA | 4.92e-21 |
| 3. B | A0DB19 | Lissencephaly-1 homolog 1 | 4.27e-13 | NA | 5.38e-13 |
| 3. B | Q54Y96 | WD40 repeat-containing protein smu1 | 8.15e-05 | NA | 9.04e-09 |
| 3. B | Q66HC9 | Dynein axonemal intermediate chain 2 | 2.00e-04 | NA | 0.031 |
| 3. B | Q9SY00 | COMPASS-like H3K4 histone methylase component WDR5B | 1.36e-07 | NA | 2.42e-15 |
| 3. B | O54929 | WD repeat and SOCS box-containing protein 2 | 3.86e-04 | NA | 9.70e-07 |
| 3. B | Q6BIR1 | Protein transport protein SEC13 | 9.95e-08 | NA | 3.47e-04 |
| 3. B | Q6NNP0 | Autophagy-related protein 16 | 4.75e-07 | NA | 1.16e-06 |
| 3. B | Q9GZL7 | Ribosome biogenesis protein WDR12 | 7.83e-05 | NA | 9.29e-06 |
| 3. B | D4DG66 | Nuclear distribution protein PAC1 | 2.86e-11 | NA | 4.33e-07 |
| 3. B | Q8VZY6 | Polycomb group protein FIE2 | 2.08e-06 | NA | 1.45e-05 |
| 3. B | Q55AR8 | U5 small nuclear ribonucleoprotein 40 kDa protein | 5.61e-07 | NA | 4.85e-10 |
| 3. B | Q55DA2 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 7.51e-11 | NA | 6.62e-06 |
| 3. B | Q873A1 | Protein transport protein sec31 | 7.89e-04 | NA | 2.92e-08 |
| 3. B | O60336 | Mitogen-activated protein kinase-binding protein 1 | 1.55e-07 | NA | 2.16e-07 |
| 3. B | P56094 | General transcriptional corepressor TUP1 | 1.25e-04 | NA | 1.39e-09 |
| 3. B | Q91ZN1 | Coronin-1A | 4.97e-03 | NA | 7.93e-07 |
| 3. B | A2CEH0 | POC1 centriolar protein homolog B | 2.44e-04 | NA | 6.28e-14 |
| 3. B | Q58D00 | F-box/WD repeat-containing protein 2 | 3.76e-06 | NA | 1.20e-07 |
| 3. B | P53962 | Uncharacterized WD repeat-containing protein YNL035C | 3.20e-05 | NA | 0.013 |
| 3. B | O54927 | WD repeat and SOCS box-containing protein 1 | 2.32e-04 | NA | 1.02e-07 |
| 3. B | Q9Y0T2 | F-box/WD repeat-containing protein A | 2.02e-03 | NA | 1.31e-05 |
| 3. B | Q75C99 | Histone acetyltransferase type B subunit 2 | 8.88e-06 | NA | 3.59e-16 |
| 3. B | Q5A7Q6 | Nuclear distribution protein PAC1 | 5.19e-10 | NA | 2.09e-06 |
| 3. B | Q8VBV4 | F-box/WD repeat-containing protein 7 | 2.69e-05 | NA | 7.26e-21 |
| 3. B | Q4X1Y0 | Polyadenylation factor subunit 2 | 1.91e-03 | NA | 4.97e-08 |
| 3. B | P69104 | Guanine nucleotide-binding protein subunit beta-like protein | 5.70e-11 | NA | 1.10e-07 |
| 3. B | P53622 | Coatomer subunit alpha | 5.14e-08 | NA | 6.04e-09 |
| 3. B | Q9FNZ2 | Zinc finger CCCH domain-containing protein 48 | 4.18e-04 | NA | 4.64e-06 |
| 3. B | O14301 | Uncharacterized WD repeat-containing protein C9G1.05 | 0.00e+00 | NA | 4.14e-04 |
| 3. B | Q08E38 | Pre-mRNA-processing factor 19 | 2.10e-08 | NA | 1.52e-11 |
| 3. B | Q9NSI6 | Bromodomain and WD repeat-containing protein 1 | 1.73e-01 | NA | 1.20e-09 |
| 3. B | P0CS45 | Mitochondrial division protein 1 | 3.53e-02 | NA | 5.46e-06 |
| 3. B | Q9D7H2 | WD repeat-containing protein 5B | 1.32e-07 | NA | 7.01e-13 |
| 3. B | O60508 | Pre-mRNA-processing factor 17 | 8.13e-06 | NA | 1.93e-09 |
| 3. B | Q5BDU4 | Protein hir1 | 5.66e-03 | NA | 1.34e-04 |
| 3. B | Q54RP0 | UDP-galactose:fucoside alpha-3-galactosyltransferase | 2.83e-03 | NA | 1.94e-04 |
| 3. B | Q54KM3 | Anaphase-promoting complex subunit cdh1 | 6.79e-04 | NA | 6.24e-06 |
| 3. B | O75529 | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L | 4.75e-04 | NA | 5.98e-14 |
| 3. B | A5DHD9 | Protein transport protein SEC13 | 2.40e-08 | NA | 0.001 |
| 3. B | Q8WWQ0 | PH-interacting protein | 3.08e-02 | NA | 4.72e-09 |
| 3. B | Q75C26 | Probable cytosolic iron-sulfur protein assembly protein 1 | 4.67e-11 | NA | 1.39e-07 |
| 3. B | Q94BM7 | Protein SPA1-RELATED 4 | 2.68e-04 | NA | 7.88e-05 |
| 3. B | Q6ZQL4 | WD repeat-containing protein 43 | 3.33e-03 | NA | 5.37e-05 |
| 3. B | Q4WEI5 | Histone acetyltransferase type B subunit 2 | 1.73e-07 | NA | 3.97e-14 |
| 3. B | B8P4B0 | Nuclear distribution protein PAC1-1 | 8.50e-12 | NA | 1.09e-11 |
| 3. B | Q5IS43 | Platelet-activating factor acetylhydrolase IB subunit alpha | 1.52e-08 | NA | 1.84e-15 |
| 3. B | B6K1G6 | Probable cytosolic Fe-S cluster assembly factor SJAG_02895 | 5.71e-04 | NA | 4.32e-10 |
| 3. B | Q5FVA9 | mRNA export factor | 7.38e-06 | NA | 8.50e-06 |
| 3. B | Q8H594 | Ribosome biogenesis protein WDR12 homolog | 1.36e-04 | NA | 0.003 |
| 3. B | Q26458 | Polycomb protein esc | 7.21e-04 | NA | 8.82e-04 |
| 3. B | A7RHG8 | Ribosome biogenesis protein WDR12 homolog (Fragment) | 2.76e-04 | NA | 2.19e-05 |
| 3. B | C3XVT5 | Lissencephaly-1 homolog | 5.81e-13 | NA | 3.68e-19 |
| 3. B | Q8HXL3 | WD repeat-containing protein 62 | 1.79e-06 | NA | 3.19e-04 |
| 3. B | Q96DI7 | U5 small nuclear ribonucleoprotein 40 kDa protein | 1.21e-06 | NA | 7.64e-11 |
| 3. B | B8M7Q5 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 6.64e-03 | NA | 1.57e-12 |
| 3. B | Q2UA71 | Histone acetyltransferase type B subunit 2 | 1.99e-07 | NA | 2.47e-12 |
| 3. B | O22467 | Histone-binding protein MSI1 | 3.21e-07 | NA | 4.62e-10 |
| 3. B | Q9DCE5 | p21-activated protein kinase-interacting protein 1 | 1.20e-08 | NA | 2.03e-04 |
| 3. B | Q8BHD1 | POC1 centriolar protein homolog B | 2.93e-04 | NA | 6.81e-10 |
| 3. B | Q6CSI1 | Histone acetyltransferase type B subunit 2 | 1.30e-06 | NA | 1.11e-11 |
| 3. B | C5GVJ9 | Nuclear distribution protein PAC1 | 3.63e-10 | NA | 1.60e-07 |
| 3. B | P90916 | Probable histone-binding protein lin-53 | 2.89e-06 | NA | 1.09e-11 |
| 3. B | A1CBP8 | Mitochondrial division protein 1 | 7.27e-03 | NA | 2.62e-08 |
| 3. B | Q6CGP9 | Polyadenylation factor subunit 2 | 8.22e-05 | NA | 2.08e-07 |
| 3. B | F4IIK6 | Non-functional target of rapamycin complex subunit LST8-2 | 3.91e-08 | NA | 0.031 |
| 3. B | Q8VZS9 | Protein FIZZY-RELATED 1 | 2.36e-04 | NA | 7.59e-11 |
| 3. B | A1CGS0 | Protein transport protein sec13 | 7.61e-08 | NA | 9.35e-06 |
| 3. B | Q9VKQ3 | Ribosome biogenesis protein WDR12 homolog | 2.71e-05 | NA | 4.23e-04 |
| 3. B | Q0P593 | Dynein assembly factor with WDR repeat domains 1 | 2.20e-05 | NA | 2.40e-17 |
| 3. B | Q54DS8 | Protein SEC13 homolog | 6.51e-08 | NA | 0.009 |
| 3. B | Q71UF4 | Histone-binding protein RBBP7 | 8.09e-07 | NA | 8.97e-11 |
| 3. B | Q0CLJ4 | Ribosome biogenesis protein ytm1 | 1.70e-04 | NA | 0.020 |
| 3. B | Q8VYZ5 | Periodic tryptophan protein 2 | 4.10e-07 | NA | 6.33e-11 |
| 3. B | P54686 | Actin-interacting protein 1 | 1.38e-13 | NA | 0.007 |
| 3. B | A8NEG8 | Nuclear distribution protein PAC1 | 5.85e-12 | NA | 4.60e-13 |
| 3. B | P58404 | Striatin-4 | 2.44e-03 | NA | 0.006 |
| 3. B | Q8C6G8 | WD repeat-containing protein 26 | 7.94e-07 | NA | 5.31e-11 |
| 3. B | A8Q2R5 | WD repeat-containing protein 48 homolog | 4.51e-04 | NA | 0.008 |
| 3. B | P58405 | Striatin-3 | 1.98e-03 | NA | 4.45e-07 |
| 3. B | Q5BJ90 | Ribosome biogenesis protein wdr12 | 2.61e-05 | NA | 1.46e-06 |
| 3. B | Q4R6D2 | mRNA export factor | 1.16e-05 | NA | 1.75e-06 |
| 3. B | A2QI22 | Ribosome biogenesis protein ytm1 | 1.74e-04 | NA | 0.017 |
| 3. B | Q6AZS2 | Polycomb protein eed-B | 4.82e-04 | NA | 0.028 |
| 3. B | O82266 | Protein SLOW WALKER 1 | 3.39e-05 | NA | 2.32e-06 |
| 3. B | Q68EI0 | WD repeat-containing protein 18 | 1.32e-03 | NA | 2.20e-04 |
| 3. B | Q6BU94 | Pre-mRNA-splicing factor PRP46 | 3.51e-05 | NA | 7.08e-10 |
| 3. B | Q09028 | Histone-binding protein RBBP4 | 1.84e-06 | NA | 1.39e-09 |
| 3. B | Q5M786 | WD repeat-containing protein 5 | 4.82e-08 | NA | 4.61e-13 |
| 3. B | O89046 | Coronin-1B | 3.76e-03 | NA | 2.10e-07 |
| 3. B | Q5XX13 | F-box/WD repeat-containing protein 10 | 7.29e-03 | NA | 9.84e-05 |
| 3. B | B6QC06 | Nuclear distribution protein nudF 2 | 3.39e-11 | NA | 1.16e-08 |
| 3. B | Q2UFN8 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 7.69e-03 | NA | 8.51e-12 |
| 3. B | Q4WNK7 | Protein transport protein sec13 | 1.08e-07 | NA | 5.92e-06 |
| 3. B | Q8LPL5 | Protein FIZZY-RELATED 3 | 2.48e-04 | NA | 0.001 |
| 3. B | Q6BK34 | Histone acetyltransferase type B subunit 2 | 8.69e-07 | NA | 7.87e-08 |
| 3. B | A4RD35 | Protein transport protein SEC31 | 2.61e-03 | NA | 1.99e-06 |
| 3. B | Q61Y48 | Probable histone-binding protein lin-53 | 2.78e-06 | NA | 6.88e-12 |
| 3. B | O24467 | LEC14B homolog | 7.16e-08 | NA | 0.001 |
| 3. B | P62872 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 1.52e-12 | NA | 3.79e-06 |
| 3. B | P39108 | Peroxisomal targeting signal 2 receptor | 1.12e-12 | NA | 0.003 |
| 3. B | Q03897 | Maintenance of telomere capping protein 5 | 5.33e-03 | NA | 0.001 |
| 3. B | Q9ERG2 | Striatin-3 | 5.88e-03 | NA | 4.13e-07 |
| 3. B | Q6P3H7 | Histone-binding protein RBBP4 | 1.73e-06 | NA | 3.49e-10 |
| 3. B | O13686 | Uncharacterized RWD, RING finger and WD repeat-containing protein C11E3.05 | 1.57e-02 | NA | 0.041 |
| 3. B | Q2HBX6 | Nuclear distribution protein PAC1-1 | 4.47e-08 | NA | 5.34e-16 |
| 3. B | Q148I1 | Proteasomal ATPase-associated factor 1 | 2.95e-05 | NA | 2.37e-04 |
| 3. B | Q6CL75 | Protein transport protein SEC31 | 2.84e-03 | NA | 0.002 |
| 3. B | Q10282 | Guanine nucleotide-binding protein subunit beta | 2.83e-12 | NA | 3.06e-07 |
| 3. B | Q5E959 | Serine-threonine kinase receptor-associated protein | 8.57e-06 | NA | 0.007 |
| 3. B | A2RRU3 | U3 small nucleolar RNA-associated protein 15 homolog | 1.59e-04 | NA | 9.25e-10 |
| 3. B | Q6BIR9 | Probable cytosolic iron-sulfur protein assembly protein 1 | 5.81e-10 | NA | 1.38e-05 |
| 3. B | O22785 | Pre-mRNA-processing factor 19 homolog 2 | 2.57e-05 | NA | 0.021 |
| 3. B | P53699 | Cell division control protein 4 | 1.62e-05 | NA | 1.48e-08 |
| 3. B | Q19124 | Autophagic-related protein 16.1 | 1.57e-06 | NA | 5.30e-04 |
| 3. B | Q54W52 | Ribosome biogenesis protein WDR12 homolog | 3.01e-04 | NA | 0.007 |
| 3. B | A6ZPA9 | Ribosome biogenesis protein YTM1 | 7.43e-05 | NA | 0.041 |
| 3. B | Q5EA99 | p21-activated protein kinase-interacting protein 1 | 1.25e-03 | NA | 1.07e-04 |
| 3. B | F4HTH8 | Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 | 1.36e-04 | NA | 2.23e-10 |
| 3. B | Q13610 | Periodic tryptophan protein 1 homolog | 7.49e-05 | NA | 1.13e-05 |
| 3. B | Q0CHM0 | Protein transport protein sec13 | 8.80e-08 | NA | 1.27e-05 |
| 3. B | Q9JMJ4 | Pre-mRNA-processing factor 19 | 2.89e-05 | NA | 2.72e-11 |
| 3. B | P93339 | Guanine nucleotide-binding protein subunit beta | NA | NA | 3.20e-09 |
| 3. B | Q8BH44 | Coronin-2B | 2.85e-03 | NA | 1.67e-07 |
| 3. B | O76734 | General transcriptional corepressor tupA | 8.34e-04 | NA | 2.46e-14 |
| 3. B | P59235 | Nucleoporin Nup43 | 5.76e-09 | NA | 1.29e-04 |
| 3. B | Q93847 | WD repeat-containing protein wdr-5.2 | 1.16e-04 | NA | 1.57e-11 |
| 3. B | Q2TAY7 | WD40 repeat-containing protein SMU1 | 1.15e-05 | NA | 1.71e-07 |
| 3. B | P0CS44 | Mitochondrial division protein 1 | 2.21e-02 | NA | 5.46e-06 |
| 3. B | P26308 | Guanine nucleotide-binding protein subunit beta-1 | 2.51e-12 | NA | 1.15e-08 |
| 3. B | O94620 | Pre-mRNA-splicing factor cwf17 | 9.10e-07 | NA | 0.003 |
| 3. B | Q6BRR2 | Protein transport protein SEC31 | 8.02e-04 | NA | 5.53e-06 |
| 3. B | Q1LZ08 | WD repeat-containing protein 48 homolog | 3.66e-03 | NA | 2.43e-04 |
| 3. B | Q4V7A0 | WD repeat-containing protein 61 | 8.42e-11 | NA | 1.94e-04 |
| 3. B | Q5AG86 | Probable cytosolic iron-sulfur protein assembly protein 1 | 5.07e-10 | NA | 1.19e-05 |
| 3. B | P33215 | Protein NEDD1 | 8.64e-06 | NA | 2.30e-04 |
| 3. B | Q9T014 | Protein SPA1-RELATED 2 | 3.09e-06 | NA | 0.001 |
| 3. B | O43379 | WD repeat-containing protein 62 | 5.81e-06 | NA | 0.001 |
| 3. B | A7TNS8 | CCR4-associated factor 4 homolog | 1.88e-03 | NA | 2.61e-08 |
| 3. B | Q61011 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 | 3.07e-12 | NA | 1.18e-08 |
| 3. B | A3LNW3 | Protein transport protein SEC13 | 2.59e-08 | NA | 0.044 |
| 3. B | Q6DDF0 | WD repeat-containing protein 37 | 2.07e-06 | NA | 6.86e-09 |
| 3. B | Q8QFR2 | Protein HIRA | 6.92e-04 | NA | 2.37e-05 |
| 3. B | Q7K1Y4 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 4.24e-12 | NA | 3.35e-06 |
| 3. B | Q8K3E5 | Jouberin | 1.13e-02 | NA | 1.11e-07 |
| 3. B | Q4R8H1 | F-box-like/WD repeat-containing protein TBL1X | 6.38e-07 | NA | 1.24e-26 |
| 3. B | B5X3Z6 | Lissencephaly-1 homolog A | 5.94e-13 | NA | 1.14e-15 |
| 3. B | Q39836 | Guanine nucleotide-binding protein subunit beta-like protein | 1.36e-11 | NA | 1.37e-07 |
| 3. B | Q7RY30 | Nuclear distribution protein nudF-2 | 1.17e-08 | NA | 2.11e-13 |
| 3. B | A5E2R6 | Probable cytosolic iron-sulfur protein assembly protein 1 | 9.49e-10 | NA | 7.17e-04 |
| 3. B | D4AM37 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 6.14e-08 | NA | 8.28e-13 |
| 3. B | Q5REG7 | Platelet-activating factor acetylhydrolase IB subunit alpha | 5.92e-09 | NA | 2.33e-16 |
| 3. B | P62874 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 1.37e-12 | NA | 3.79e-06 |
| 3. B | A2QPW4 | Probable cytosolic iron-sulfur protein assembly protein 1 | 2.61e-04 | NA | 0.003 |
| 3. B | Q5U4F6 | Cytoplasmic dynein 2 intermediate chain 2 | 5.32e-05 | NA | 3.43e-04 |
| 3. B | Q06078 | U3 small nucleolar RNA-associated protein 21 | 3.15e-06 | NA | 0.047 |
| 3. B | Q759U7 | Nuclear distribution protein PAC1 | 2.61e-07 | NA | 0.008 |
| 3. B | Q9UT57 | Probable cytosolic Fe-S cluster assembly factor SPAC806.02c | 8.51e-04 | NA | 2.64e-06 |
| 3. B | Q5B563 | Protein transport protein sec13 | 4.22e-08 | NA | 8.31e-06 |
| 3. B | Q5NVK4 | Coronin-1B | 3.01e-03 | NA | 2.87e-08 |
| 3. B | Q9C1X0 | Uncharacterized WD repeat-containing protein C713.05 | 2.58e-11 | NA | 0.013 |
| 3. B | Q62623 | Cell division cycle protein 20 homolog | 8.75e-04 | NA | 4.81e-13 |
| 3. B | Q8VDD9 | PH-interacting protein | 7.19e-02 | NA | 6.50e-09 |
| 3. B | Q92176 | Coronin-1A | 1.67e-03 | NA | 4.36e-07 |
| 3. B | C4JZS6 | Nuclear distribution protein PAC1-1 | 2.67e-12 | NA | 1.89e-06 |
| 3. B | Q6BLS5 | Ribosome biogenesis protein YTM1 | 1.43e-03 | NA | 0.018 |
| 3. B | B4GAJ1 | Lissencephaly-1 homolog | 6.81e-13 | NA | 1.64e-18 |
| 3. B | Q6C414 | Protein transport protein SEC31 | 1.81e-04 | NA | 1.46e-05 |
| 3. B | P0CS39 | Protein HIR1 | 1.31e-04 | NA | 0.002 |
| 3. B | P42527 | Myosin heavy chain kinase A | 1.96e-02 | NA | 4.54e-07 |
| 3. B | P0CS55 | Ribosome biogenesis protein YTM1 | 3.06e-04 | NA | 2.90e-09 |
| 3. B | Q5REE6 | Ribosome biogenesis protein WDR12 | 3.35e-05 | NA | 1.13e-05 |
| 3. B | Q54JS5 | GATOR complex protein WDR24 | 1.43e-04 | NA | 7.90e-10 |
| 3. B | Q9SYX2 | Protein SUPPRESSOR OF PHYA-105 1 | 1.27e-05 | NA | 0.023 |
| 3. B | P0CS36 | Histone acetyltransferase type B subunit 2 | 2.76e-08 | NA | 2.50e-18 |
| 3. B | Q969H0 | F-box/WD repeat-containing protein 7 | 2.74e-05 | NA | 7.65e-21 |
| 3. B | Q4P5F5 | Probable cytosolic iron-sulfur protein assembly protein 1 | 6.17e-07 | NA | 0.001 |
| 3. B | A7S338 | Lissencephaly-1 homolog | 6.34e-13 | NA | 1.69e-15 |
| 3. B | P78972 | WD repeat-containing protein slp1 | 4.58e-04 | NA | 0.029 |
| 3. B | Q676U5 | Autophagy-related protein 16-1 | 7.67e-04 | NA | 7.44e-05 |
| 3. B | Q652L2 | Protein HIRA | 3.52e-03 | NA | 6.12e-08 |
| 3. B | B8NGT5 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 9.31e-04 | NA | 8.30e-12 |
| 3. B | A5DHD2 | Probable cytosolic iron-sulfur protein assembly protein 1 | 4.83e-10 | NA | 0.001 |
| 3. B | Q40687 | Guanine nucleotide-binding protein subunit beta | 3.19e-11 | NA | 2.08e-07 |
| 3. B | Q6P315 | Histone-binding protein RBBP7 | 4.92e-07 | NA | 4.17e-10 |
| 3. B | P36130 | CCR4-associated factor 4 | 2.59e-07 | NA | 2.17e-09 |
| 3. B | Q6DFF9 | Mitogen-activated protein kinase-binding protein 1 | 3.93e-05 | NA | 1.78e-07 |
| 3. B | Q6PFM9 | WD repeat-containing protein 48 | 1.62e-03 | NA | 4.22e-04 |
| 3. B | Q9WUM3 | Coronin-1B | 3.28e-03 | NA | 9.34e-08 |
| 3. B | D1ZEM6 | Nuclear distribution protein PAC1-2 | 7.30e-06 | NA | 5.00e-11 |
| 3. B | Q1DX43 | Protein transport protein SEC31 | 2.67e-03 | NA | 0.006 |
| 3. B | Q9UTN4 | Polyadenylation factor subunit 2 | 6.12e-04 | NA | 3.46e-11 |
| 3. B | Q5BK30 | Dynein assembly factor with WDR repeat domains 1 | 2.29e-05 | NA | 2.56e-17 |
| 3. B | O94423 | Meiotic fizzy-related protein 1 | 2.85e-09 | NA | 8.12e-06 |
| 3. B | Q9I9H8 | Apoptotic protease-activating factor 1 | 5.98e-06 | NA | 1.43e-10 |
| 3. B | B4LJT7 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 3.62e-12 | NA | 3.20e-09 |
| 3. B | O22469 | WD-40 repeat-containing protein MSI3 | 3.62e-09 | NA | 9.42e-11 |
| 3. B | P23232 | Guanine nucleotide-binding protein subunit beta | 2.41e-12 | NA | 4.88e-07 |
| 3. B | Q11176 | Actin-interacting protein 1 | 0.00e+00 | NA | 0.002 |
| 3. B | Q8W117 | Suppressor of mec-8 and unc-52 protein homolog 1 | 1.29e-06 | NA | 9.10e-08 |
| 3. B | Q6DUZ9 | EARP-interacting protein homolog | 4.27e-10 | NA | 0.040 |
| 3. B | Q5DFU0 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 2.21e-11 | NA | 2.55e-05 |
| 3. B | Q8K0G5 | EARP and GARP complex-interacting protein 1 | 4.38e-10 | NA | 0.003 |
| 3. B | Q810D6 | Glutamate-rich WD repeat-containing protein 1 | 1.39e-05 | NA | 2.98e-12 |
| 3. B | Q9SXY1 | Chromatin assembly factor 1 subunit FAS2 | 1.73e-07 | NA | 0.004 |
| 3. B | O14170 | WD repeat-containing protein pop2 | 6.24e-03 | NA | 2.29e-11 |
| 3. B | Q54R82 | Mitogen-activated protein kinase kinase kinase A | 1.42e-07 | NA | 1.23e-05 |
| 3. B | Q5A7Q3 | Pre-mRNA-splicing factor PRP46 | 1.46e-05 | NA | 9.65e-07 |
| 3. B | B6H7A3 | Probable cytosolic iron-sulfur protein assembly protein 1 | 2.09e-04 | NA | 1.69e-07 |
| 3. B | B7QKS1 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 1.21e-11 | NA | 2.01e-06 |
| 3. B | O16023 | Polycomb protein esc | 1.06e-03 | NA | 0.001 |
| 3. B | Q9QXE7 | F-box-like/WD repeat-containing protein TBL1X | 5.91e-07 | NA | 2.78e-25 |
| 3. B | P0CS47 | Polyadenylation factor subunit 2 | 8.62e-04 | NA | 2.04e-08 |
| 3. B | Q9BZK7 | F-box-like/WD repeat-containing protein TBL1XR1 | 6.52e-05 | NA | 6.84e-25 |
| 3. B | Q7ZXZ2 | U3 small nucleolar RNA-associated protein 15 homolog | 1.35e-04 | NA | 1.83e-10 |
| 3. B | P91341 | Periodic tryptophan protein 2 homolog | 7.52e-06 | NA | 0.002 |
| 3. B | P90648 | Myosin heavy chain kinase B | 1.71e-03 | NA | 3.18e-13 |
| 3. B | G0SC29 | Ribosome assembly protein 4 | 1.99e-05 | NA | 2.11e-19 |
| 3. B | Q6TMK6 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | NA | NA | 2.66e-06 |
| 3. B | Q54ZP5 | WD repeat-containing protein 48 homolog | 1.65e-01 | NA | 0.025 |
| 3. B | Q4R7Y4 | Guanine nucleotide-binding protein subunit beta-2-like 1 | 2.12e-10 | NA | 2.25e-06 |
| 3. B | Q91WQ5 | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L | 3.47e-04 | NA | 1.17e-13 |
| 3. B | P97260 | Sterol regulatory element-binding protein cleavage-activating protein | 2.14e-02 | NA | 1.44e-04 |
| 3. B | Q0CYG9 | Protein transport protein sec31 | 3.72e-04 | NA | 5.14e-05 |
| 3. B | S8ASK6 | WD40 repeat protein poxJ | NA | NA | 4.49e-04 |
| 3. B | A5D7H2 | Striatin-3 | 4.18e-03 | NA | 1.31e-07 |
| 3. B | B4J8H6 | WD repeat-containing protein 48 homolog | 6.93e-04 | NA | 2.28e-05 |
| 3. B | A7THX0 | Mitochondrial division protein 1 | 7.53e-07 | NA | 2.62e-10 |
| 3. B | P0CS50 | Protein transport protein SEC13 | 1.77e-07 | NA | 0.028 |
| 3. B | B3RQN1 | Ribosome biogenesis protein WDR12 homolog | 8.03e-05 | NA | 1.76e-06 |
| 3. B | Q26544 | WD repeat-containing protein SL1-17 | NA | NA | 0.032 |
| 3. B | O14186 | Uncharacterized WD repeat-containing protein C4F8.11 | 6.12e-04 | NA | 1.33e-04 |
| 3. B | Q28D01 | WD repeat-containing protein 26 | 3.36e-07 | NA | 2.73e-12 |
| 3. B | O13923 | Coronin-like protein crn1 | 1.42e-02 | NA | 8.26e-09 |
| 3. B | Q9C1X1 | Periodic tryptophan protein 2 homolog | 2.68e-06 | NA | 4.04e-04 |
| 3. B | Q9VLN1 | WD repeat-containing protein 82 | 5.06e-09 | NA | 0.001 |
| 3. B | Q4P8R5 | Mitochondrial division protein 1 | 4.58e-02 | NA | 4.69e-08 |
| 3. B | F1DLK1 | Protein DECREASED SIZE EXCLUSION LIMIT 1 | 3.72e-09 | NA | 0.023 |
| 3. B | B0R0D7 | Coronin-1C-A | 3.41e-03 | NA | 2.43e-08 |
| 3. B | A6ZQL5 | Mitochondrial division protein 1 | 2.18e-04 | NA | 8.65e-06 |
| 3. B | O64740 | Protein transport protein SEC13 homolog B | 7.56e-08 | NA | 0.012 |
| 3. B | P54703 | Cytoplasmic dynein 1 intermediate chain | 2.95e-03 | NA | 0.034 |
| 3. B | P49695 | Probable serine/threonine-protein kinase PkwA | 7.62e-05 | NA | 8.87e-19 |
| 3. B | Q9NQW1 | Protein transport protein Sec31B | 4.10e-05 | NA | 1.20e-07 |
| 3. B | Q95RJ9 | F-box-like/WD repeat-containing protein ebi | 4.54e-06 | NA | 1.91e-22 |
| 3. B | O74319 | Transcription initiation factor TFIID subunit taf73 | 1.84e-08 | NA | 1.01e-11 |
| 3. B | Q6BUA6 | Nuclear distribution protein PAC1 | 1.61e-06 | NA | 3.18e-06 |
| 3. B | Q3ULA2 | F-box/WD repeat-containing protein 1A | 4.67e-05 | NA | 1.21e-15 |
| 3. B | Q05B17 | WD repeat-containing protein 48 | 2.38e-03 | NA | 2.83e-04 |
| 3. B | Q39190 | Protein pleiotropic regulator PRL2 | 6.32e-06 | NA | 4.73e-10 |
| 3. B | B8MWR8 | Probable cytosolic iron-sulfur protein assembly protein 1 | 8.71e-10 | NA | 5.10e-04 |
| 3. B | Q93134 | Guanine nucleotide-binding protein subunit beta-2-like 1 | 7.92e-11 | NA | 1.42e-04 |
| 3. B | P61965 | WD repeat-containing protein 5 | 4.69e-08 | NA | 2.95e-14 |
| 3. B | Q9XS70 | Coronin-1B | 3.48e-03 | NA | 4.03e-07 |
| 3. B | B4KRQ4 | WD repeat-containing protein 48 homolog | 4.20e-04 | NA | 3.31e-05 |
| 3. B | Q8I0F4 | Lissencephaly-1 homolog | 4.64e-13 | NA | 1.13e-13 |
| 3. B | B0XM00 | Nuclear distribution protein nudF | 5.35e-11 | NA | 6.77e-08 |
| 3. B | Q96J01 | THO complex subunit 3 | 3.20e-05 | NA | 1.26e-08 |
| 3. B | P29829 | Guanine nucleotide-binding protein subunit beta-2 | 2.21e-12 | NA | 1.17e-09 |
| 3. B | P49178 | Guanine nucleotide-binding protein subunit beta | 1.64e-11 | NA | 3.62e-09 |
| 3. B | Q5U2W5 | Transducin beta-like protein 3 | 2.43e-09 | NA | 3.80e-13 |
| 3. B | Q32PG3 | WD repeat-containing protein 48 | 1.07e-03 | NA | 0.001 |
| 3. B | P43033 | Platelet-activating factor acetylhydrolase IB subunit beta | 5.47e-09 | NA | 3.14e-16 |
| 3. B | Q6FJS0 | Polyadenylation factor subunit 2 | 1.32e-05 | NA | 3.49e-09 |
| 3. B | Q6CSZ5 | Protein transport protein SEC13 | 1.01e-07 | NA | 8.84e-05 |
| 3. B | Q5RF99 | mRNA export factor | 1.23e-05 | NA | 6.79e-07 |
| 3. B | Q5ZJH5 | WD repeat-containing protein 61 | 9.93e-12 | NA | 2.61e-06 |
| 3. B | Q00808 | Vegetative incompatibility protein HET-E-1 | 2.90e-07 | NA | 2.24e-29 |
| 3. B | P63246 | Receptor of activated protein C kinase 1 | 1.98e-10 | NA | 2.25e-06 |
| 3. B | A0AUS0 | WD repeat, SAM and U-box domain-containing protein 1 | 4.41e-04 | NA | 9.27e-09 |
| 3. B | A8IR43 | Ribosome biogenesis protein WDR12 homolog | 4.33e-04 | NA | 6.23e-05 |
| 3. B | C0S902 | Nuclear distribution protein PAC1 | 2.12e-10 | NA | 8.69e-09 |
| 3. B | P78406 | mRNA export factor | 1.15e-05 | NA | 6.79e-07 |
| 3. B | Q8N136 | Dynein assembly factor with WDR repeat domains 1 | 2.59e-05 | NA | 4.08e-18 |
| 3. B | Q6NS57 | Mitogen-activated protein kinase-binding protein 1 | 6.65e-06 | NA | 1.04e-06 |
| 3. B | P20484 | Protein MAK11 | 5.55e-04 | NA | 4.81e-05 |
| 3. B | A5GFN6 | mRNA export factor | 1.16e-05 | NA | 1.09e-06 |
| 3. B | Q5RBW3 | Coronin-7 | 9.76e-07 | NA | 4.01e-05 |
| 3. B | Q0UXP3 | Ribosome biogenesis protein YTM1 | 1.17e-04 | NA | 1.17e-05 |
| 3. B | Q0U2T3 | Mitochondrial division protein 1 | 5.88e-03 | NA | 1.81e-05 |
| 3. B | O75083 | WD repeat-containing protein 1 | 2.73e-13 | NA | 7.96e-05 |
| 3. B | P87060 | WD repeat-containing protein pop1 | 4.48e-05 | NA | 2.69e-07 |
| 3. B | P0CS43 | Nuclear distribution protein PAC1 | 4.72e-12 | NA | 1.18e-14 |
| 3. B | B9WHJ2 | Probable cytosolic iron-sulfur protein assembly protein 1 | 4.92e-10 | NA | 1.22e-06 |
| 3. B | B6GZD3 | Nuclear distribution protein nudF 2 | 4.70e-09 | NA | 3.90e-10 |
| 3. B | A8XEN7 | DDB1- and CUL4-associated factor 11 homolog | 3.57e-07 | NA | 0.015 |
| 3. B | Q3SZ25 | Polycomb protein EED | 6.21e-05 | NA | 0.031 |
| 3. B | Q4P4R3 | Protein HIR1 | 1.47e-03 | NA | 2.31e-04 |
| 3. B | Q8N0X2 | Sperm-associated antigen 16 protein | 2.14e-06 | NA | 2.79e-10 |
| 3. B | P54319 | Phospholipase A-2-activating protein | 3.91e-04 | NA | 7.91e-11 |
| 3. B | P38262 | SIR4-interacting protein SIF2 | 4.72e-04 | NA | 9.71e-07 |
| 3. B | P55735 | Protein SEC13 homolog | 2.87e-08 | NA | 0.017 |
| 3. B | A8IZG4 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 1.07e-11 | NA | 5.19e-10 |
| 3. B | Q6GMD2 | WD repeat-containing protein 61 | 9.47e-12 | NA | 2.46e-07 |
| 3. B | Q61ZF6 | Guanine nucleotide-binding protein subunit beta-1 | 2.32e-12 | NA | 4.21e-06 |
| 3. B | B3NQR5 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 5.36e-12 | NA | 1.32e-06 |
| 3. B | Q7ZVA0 | WD40 repeat-containing protein SMU1 | 6.34e-07 | NA | 8.93e-07 |
| 3. B | P57737 | Coronin-7 | 2.79e-08 | NA | 1.42e-06 |
| 3. B | Q8K450 | Sperm-associated antigen 16 protein | 1.19e-04 | NA | 4.28e-10 |
| 3. B | O60137 | Set1 complex component swd2 | 2.06e-07 | NA | 1.45e-04 |
| 3. B | B2RZ17 | F-box/WD repeat-containing protein 2 | 4.16e-06 | NA | 2.15e-06 |
| 3. B | A2AKB9 | DDB1- and CUL4-associated factor 10 | 1.73e-04 | NA | 0.005 |
| 3. B | Q54SA5 | WD repeat-containing protein 55 homolog | 5.97e-05 | NA | 9.24e-07 |
| 3. B | B0XFT7 | Eukaryotic translation initiation factor 3 subunit I | 1.10e-08 | NA | 0.008 |
| 3. B | A7EKM8 | Nuclear distribution protein PAC1 | 1.05e-07 | NA | 3.22e-08 |
| 3. B | Q5F3K4 | WD repeat-containing protein 48 | 6.11e-04 | NA | 0.002 |
| 3. B | Q3U821 | WD repeat-containing protein 75 | 6.25e-06 | NA | 0.001 |
| 3. B | Q4V7Z1 | POC1 centriolar protein homolog B | 1.07e-04 | NA | 7.16e-11 |
| 3. B | B4HWV6 | Ribosome biogenesis protein WDR12 homolog | 2.92e-05 | NA | 6.03e-04 |
| 3. B | Q5SQM0 | Echinoderm microtubule-associated protein-like 6 | 2.14e-04 | NA | 0.010 |
| 3. B | Q38960 | WD repeat-containing protein LWD2 | 6.25e-07 | NA | 0.016 |
| 3. B | Q15542 | Transcription initiation factor TFIID subunit 5 | 1.94e-04 | NA | 2.04e-13 |
| 3. B | Q5S580 | Protein transport protein SEC31 | 7.08e-04 | NA | 0.017 |
| 3. B | Q01369 | Guanine nucleotide-binding protein subunit beta-like protein | 1.15e-10 | NA | 4.88e-05 |
| 3. B | Q09373 | WD repeat-containing protein fzy-1 | 7.96e-04 | NA | 0.003 |
| 3. B | Q8N9V3 | WD repeat, SAM and U-box domain-containing protein 1 | 8.20e-05 | NA | 1.52e-06 |
| 3. B | Q86Y33 | Cell division cycle protein 20 homolog B | 6.04e-04 | NA | 1.38e-04 |
| 3. B | Q5RFF8 | Notchless protein homolog 1 | 2.13e-05 | NA | 4.77e-14 |
| 3. B | P46800 | Guanine nucleotide-binding protein subunit beta-like protein | 3.37e-12 | NA | 3.05e-08 |
| 3. B | O22607 | WD-40 repeat-containing protein MSI4 | 8.87e-05 | NA | 1.21e-09 |
| 3. B | Q5ZMC3 | WD repeat, SAM and U-box domain-containing protein 1 | 1.54e-04 | NA | 3.54e-07 |
| 3. B | Q6LA54 | Uncharacterized WD repeat-containing protein C3H5.08c | 1.45e-02 | NA | 4.70e-04 |
| 3. B | B3N534 | Ribosome biogenesis protein WDR12 homolog | 1.97e-04 | NA | 3.21e-04 |
| 3. B | Q9UKB1 | F-box/WD repeat-containing protein 11 | 3.37e-05 | NA | 3.28e-16 |
| 3. B | Q6INH0 | Histone-binding protein RBBP4-B | 2.57e-06 | NA | 3.36e-09 |
| 3. B | O14775 | Guanine nucleotide-binding protein subunit beta-5 | 9.57e-06 | NA | 1.04e-10 |
| 3. B | Q2UGK1 | Ribosome biogenesis protein ytm1 | 3.39e-04 | NA | 0.043 |
| 3. B | Q54J37 | Striatin homolog | 1.38e-04 | NA | 5.60e-07 |
| 3. B | P87314 | Protein hir1 | 1.13e-03 | NA | 0.004 |
| 3. B | Q9YGY3 | Mitotic checkpoint protein BUB3 | 2.90e-09 | NA | 0.040 |
| 3. B | Q60973 | Histone-binding protein RBBP7 | 2.50e-07 | NA | 8.82e-11 |
| 3. B | Q8BH57 | WD repeat-containing protein 48 | 6.74e-03 | NA | 0.001 |
| 3. B | Q8C0P5 | Coronin-2A | 1.57e-03 | NA | 1.83e-04 |
| 3. B | Q8SRB0 | Guanine nucleotide-binding protein subunit beta-like protein | 3.16e-10 | NA | 0.002 |
| 3. B | B9WD30 | Nuclear distribution protein PAC1 | 6.62e-10 | NA | 2.14e-06 |
| 3. B | B8AP31 | Guanine nucleotide-binding protein subunit beta | 3.73e-08 | NA | 2.08e-07 |
| 3. B | Q6PNB6 | Guanine nucleotide-binding protein subunit beta-5 | 1.06e-11 | NA | 1.72e-10 |
| 3. B | Q12220 | U3 small nucleolar RNA-associated protein 12 | 1.75e-06 | NA | 1.03e-08 |
| 3. B | Q5AXW3 | Mitochondrial division protein 1 | 4.10e-03 | NA | 4.20e-07 |
| 3. B | A5DJX5 | Nuclear distribution protein PAC1 | 1.16e-07 | NA | 1.49e-10 |
| 3. B | O74184 | Target of rapamycin complex subunit wat1 | 5.06e-08 | NA | 1.17e-04 |
| 3. B | Q8N157 | Jouberin | 1.22e-02 | NA | 8.91e-05 |
| 3. B | A1C7E4 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 3.96e-03 | NA | 5.86e-12 |
| 3. B | Q0V8F1 | Coronin-7 | 9.84e-09 | NA | 4.32e-07 |
| 3. B | Q9W2E7 | Protein Rae1 | 1.25e-07 | NA | 0.002 |
| 3. B | Q5APF0 | Ribosome biogenesis protein YTM1 | 3.11e-04 | NA | 4.08e-04 |
| 3. B | Q09990 | F-box/WD repeat-containing protein lin-23 | 1.02e-03 | NA | 3.94e-13 |
| 3. B | Q54UI3 | tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 | 3.24e-04 | NA | 0.002 |
| 3. B | O43017 | Set1 complex component swd3 | 4.23e-08 | NA | 7.85e-14 |
| 3. B | Q3UKJ7 | WD40 repeat-containing protein SMU1 | 8.04e-06 | NA | 1.71e-07 |
| 3. B | A3LX18 | Eukaryotic translation initiation factor 3 subunit I | 1.05e-08 | NA | 0.039 |
| 3. B | B6Q4Z5 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 6.75e-04 | NA | 7.13e-13 |
| 3. B | D4D8P3 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 3.05e-04 | NA | 1.14e-12 |
| 3. B | Q75BS2 | Protein transport protein SEC13 | 1.03e-07 | NA | 2.86e-06 |
| 3. B | Q9Y297 | F-box/WD repeat-containing protein 1A | 4.87e-05 | NA | 2.88e-16 |
| 3. B | B4GT01 | Ribosome biogenesis protein WDR12 homolog | 1.70e-04 | NA | 1.31e-04 |
| 3. B | Q9NRL3 | Striatin-4 | 4.03e-03 | NA | 0.026 |
| 3. B | P57775 | F-box/WD repeat-containing protein 4 | 2.00e-05 | NA | 0.026 |
| 3. B | Q9D1M0 | Protein SEC13 homolog | 2.86e-08 | NA | 0.006 |
| 3. B | Q5ZMV9 | GATOR complex protein WDR24 | 6.41e-03 | NA | 6.04e-07 |
| 3. B | Q1DHE1 | Protein HIR1 | 1.36e-03 | NA | 0.006 |
| 3. B | Q25189 | Guanine nucleotide-binding protein subunit beta-like protein | 2.07e-10 | NA | 1.38e-05 |
| 3. B | A2QCU8 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 6.32e-03 | NA | 6.59e-12 |
| 3. B | Q9C4Z6 | Receptor for activated C kinase 1B | 1.32e-10 | NA | 2.85e-05 |
| 3. B | Q60972 | Histone-binding protein RBBP4 | 2.28e-06 | NA | 1.39e-09 |
| 3. B | B4GDM7 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 4.58e-12 | NA | 5.17e-05 |
| 3. B | Q5R4F4 | Protein transport protein Sec31A | 1.26e-04 | NA | 1.20e-05 |
| 3. B | Q498F0 | WD repeat-containing protein 44 | 8.79e-03 | NA | 0.021 |
| 3. B | Q6TNS2 | p21-activated protein kinase-interacting protein 1-like | 4.87e-06 | NA | 9.58e-05 |
| 3. B | Q229Z6 | POC1 centriolar protein homolog | 4.49e-03 | NA | 6.75e-09 |
| 3. B | O13982 | Uncharacterized WD repeat-containing protein C25H1.08c | 4.41e-06 | NA | 5.42e-07 |
| 3. B | C1GB49 | Nuclear distribution protein PAC1 | 2.17e-10 | NA | 5.08e-09 |
| 3. B | P0DPA1 | WD repeat-containing protein DDB_G0349043 | 5.75e-09 | NA | 8.50e-10 |
| 3. B | Q54MP8 | Bromodomain and WD repeat-containing DDB_G0285837 | 6.54e-02 | NA | 2.45e-04 |
| 3. B | Q9SJT9 | Coatomer subunit alpha-2 | 6.96e-06 | NA | 6.60e-10 |
| 3. B | Q8BU03 | Periodic tryptophan protein 2 homolog | 2.88e-07 | NA | 3.87e-05 |
| 3. B | A1DHK2 | Protein transport protein sec31 | 7.41e-04 | NA | 7.96e-06 |
| 3. B | P36037 | Protein DOA1 | 1.80e-04 | NA | 0.005 |
| 3. B | Q80ZD0 | Guanine nucleotide-binding protein subunit beta-5 | 1.03e-11 | NA | 1.16e-10 |
| 3. B | O13282 | Transcription initiation factor TFIID subunit 5 | 2.02e-08 | NA | 3.53e-10 |
| 3. B | B4P6P9 | Lissencephaly-1 homolog | 8.71e-13 | NA | 1.47e-17 |
| 3. B | Q9XZ25 | GATOR complex protein WDR24 | 6.67e-04 | NA | 7.98e-10 |
| 3. B | O94289 | Ubiquitin homeostasis protein lub1 | 8.09e-05 | NA | 3.04e-09 |
| 3. B | P79147 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 | 2.62e-12 | NA | 1.26e-08 |
| 3. B | O94365 | U3 small nucleolar RNA-associated protein 15 | 1.99e-05 | NA | 1.42e-07 |
| 3. B | Q3SZK1 | Angio-associated migratory cell protein | 5.80e-05 | NA | 6.68e-04 |
| 3. B | B6GZA1 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 7.61e-04 | NA | 6.12e-11 |
| 3. B | Q8NA23 | WD repeat-containing protein 31 | 2.02e-05 | NA | 3.92e-04 |
| 3. B | B3MJV8 | Ribosome biogenesis protein WDR12 homolog | 1.28e-05 | NA | 6.52e-05 |
| 3. B | Q5RFQ3 | Periodic tryptophan protein 2 homolog | 1.46e-07 | NA | 1.44e-05 |
| 3. B | B4KKN1 | Ribosome biogenesis protein WDR12 homolog | 1.70e-04 | NA | 3.52e-04 |
| 3. B | Q20059 | WD repeat-containing protein 48 homolog | 9.92e-03 | NA | 0.006 |
| 3. B | A0JP70 | WD repeat-containing protein 90 | 4.34e-09 | NA | 0.011 |
| 3. B | Q2UGU1 | Nuclear distribution protein nudF | 3.72e-11 | NA | 5.73e-09 |
| 3. B | O13046 | WD repeat and HMG-box DNA-binding protein 1 | 7.29e-04 | NA | 4.24e-04 |
| 3. B | Q9UKT8 | F-box/WD repeat-containing protein 2 | 4.43e-06 | NA | 1.22e-07 |
| 3. B | A4R2Q6 | Ribosome biogenesis protein YTM1 | 1.15e-04 | NA | 2.99e-04 |
| 3. B | Q8NFH3 | Nucleoporin Nup43 | 3.34e-09 | NA | 2.29e-04 |
| 3. B | B3MET8 | WD repeat-containing protein 48 homolog | 1.81e-03 | NA | 1.51e-04 |
| 3. B | Q9LXN4 | Protein HIRA | 2.08e-03 | NA | 5.34e-08 |
| 3. B | Q7S7N3 | Histone acetyltransferase type B subunit 2 | 2.13e-07 | NA | 2.13e-10 |
| 3. B | Q3ZCC9 | Protein SEC13 homolog | 2.65e-08 | NA | 0.017 |
| 3. B | Q6PAX7 | WD repeat-containing protein 1-B | 0.00e+00 | NA | 0.002 |
| 3. B | Q8CFJ9 | GATOR complex protein WDR24 | 5.58e-03 | NA | 2.41e-07 |
| 3. B | Q9Y2I8 | WD repeat-containing protein 37 | 2.96e-03 | NA | 7.40e-10 |
| 3. B | O42937 | Probable coatomer subunit beta' | 8.85e-11 | NA | 5.46e-13 |
| 3. B | Q9M2Z2 | COMPASS-like H3K4 histone methylase component WDR5A | 3.54e-11 | NA | 6.17e-14 |
| 3. B | Q16MY0 | WD repeat-containing protein 48 homolog | 5.99e-04 | NA | 8.18e-04 |
| 3. B | A1C6X5 | Protein transport protein sec31 | 1.89e-03 | NA | 1.18e-05 |
| 3. B | P63005 | Platelet-activating factor acetylhydrolase IB subunit beta | 2.15e-09 | NA | 3.03e-16 |
| 3. B | Q292E8 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 4.47e-12 | NA | 5.27e-05 |
| 3. B | Q2UF60 | Protein transport protein sec31 | 4.74e-04 | NA | 2.19e-04 |
| 3. B | A5DB75 | Protein transport protein SEC31 | 9.71e-05 | NA | 9.11e-09 |
| 3. B | P93340 | Guanine nucleotide-binding protein subunit beta-like protein | 1.18e-10 | NA | 1.31e-05 |
| 3. B | Q5RF92 | Histone-binding protein RBBP4 | 1.85e-06 | NA | 1.42e-09 |
| 3. B | O60907 | F-box-like/WD repeat-containing protein TBL1X | 6.90e-07 | NA | 1.57e-25 |
| 3. B | A1Z8D0 | Periodic tryptophan protein 1 homolog | 9.21e-06 | NA | 6.44e-06 |
| 3. B | Q8CIE6 | Coatomer subunit alpha | 5.63e-09 | NA | 7.64e-10 |
| 3. B | D1ZEB4 | Nuclear distribution protein PAC1-1 | 1.65e-08 | NA | 2.28e-13 |
| 3. B | B8N9H4 | Nuclear distribution protein nudF | 3.55e-11 | NA | 5.73e-09 |
| 3. B | Q5JTN6 | WD repeat-containing protein 38 | 1.55e-10 | NA | 1.34e-11 |
| 3. B | Q5RD06 | POC1 centriolar protein homolog B | 3.12e-04 | NA | 4.92e-11 |
| 3. B | Q9Z1Z2 | Serine-threonine kinase receptor-associated protein | 6.82e-06 | NA | 0.004 |
| 3. B | P62879 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 | 2.53e-12 | NA | 3.47e-07 |
| 3. B | Q2GSM6 | Protein transport protein SEC13 | 1.34e-07 | NA | 4.91e-06 |
| 3. B | Q32PJ6 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 | 4.01e-08 | NA | 5.22e-09 |
| 3. B | O14021 | RbAp48-related WD40 repeat-containing protein prw1 | 8.59e-07 | NA | 6.49e-09 |
| 3. B | Q55563 | Uncharacterized WD repeat-containing protein sll0163 | 1.83e-05 | NA | 1.91e-14 |
| 3. B | Q6CP71 | Polyadenylation factor subunit 2 | 8.47e-06 | NA | 1.94e-07 |
| 3. B | B0XAF3 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 3.49e-12 | NA | 2.43e-08 |
| 3. B | Q2H139 | Mitochondrial division protein 1 | 3.94e-03 | NA | 1.75e-06 |
| 3. B | D3ZW91 | POC1 centriolar protein homolog B | 2.47e-04 | NA | 1.94e-10 |
| 3. B | Q9P5P0 | Probable cytosolic iron-sulfur protein assembly protein 1 | 1.46e-09 | NA | 0.014 |
| 3. B | O60161 | U3 small nucleolar RNA-associated protein 4 | 3.17e-07 | NA | 0.021 |
| 3. B | Q9H2Y7 | Zinc finger protein 106 | 1.16e-02 | NA | 0.006 |
| 3. B | O42858 | Set1 complex component swd1 | 5.33e-06 | NA | 7.30e-04 |
| 3. B | O62471 | Protein qui-1 | 1.45e-05 | NA | 1.88e-06 |
| 3. B | Q7K0L4 | WD repeat-containing protein 26 homolog | 2.91e-07 | NA | 6.91e-14 |
| 3. B | A6ZZZ8 | CCR4-associated factor 4 | 1.56e-04 | NA | 3.57e-09 |
| 3. B | P68040 | Receptor of activated protein C kinase 1 | 2.02e-10 | NA | 2.25e-06 |
| 3. B | Q0UYV9 | DNA damage-binding protein CMR1 | 2.14e-05 | NA | 0.012 |
| 3. B | Q9Y6I7 | WD repeat and SOCS box-containing protein 1 | 2.16e-04 | NA | 6.54e-09 |
| 3. B | Q9WUC8 | Pleiotropic regulator 1 | 4.44e-04 | NA | 5.11e-12 |
| 3. B | Q5RKI0 | WD repeat-containing protein 1 | 2.15e-13 | NA | 2.02e-04 |
| 3. B | O61585 | Katanin p80 WD40 repeat-containing subunit B1 | 8.42e-04 | NA | 1.35e-11 |
| 3. B | B2VZH2 | Ribosome biogenesis protein ytm1 | 7.87e-05 | NA | 2.95e-08 |
| 3. B | Q5ZME8 | WD40 repeat-containing protein SMU1 | 3.04e-06 | NA | 1.02e-07 |
| 3. B | Q8WQ85 | Villidin | 8.33e-02 | NA | 1.95e-04 |
| 3. B | Q5AI86 | Eukaryotic translation initiation factor 3 subunit I | 3.14e-07 | NA | 0.037 |
| 3. B | P93397 | Guanine nucleotide-binding protein subunit beta-1 | 1.42e-08 | NA | 6.61e-10 |
| 3. B | P74598 | Uncharacterized WD repeat-containing protein sll1491 | 8.84e-07 | NA | 3.90e-05 |
| 3. B | Q17BB0 | Ribosome biogenesis protein WDR12 homolog | 7.45e-05 | NA | 2.50e-08 |
| 3. B | B0W517 | Ribosome biogenesis protein WDR12 homolog | 1.97e-04 | NA | 9.74e-06 |
| 3. B | Q9LPV9 | WD repeat-containing protein LWD1 | 1.32e-09 | NA | 0.006 |
| 3. B | Q5RE95 | WD repeat-containing protein 5B | 1.31e-07 | NA | 6.36e-13 |
| 3. B | Q06440 | Coronin-like protein | 9.57e-03 | NA | 3.34e-08 |
| 3. B | O00628 | Peroxisomal targeting signal 2 receptor | 2.95e-12 | NA | 4.15e-20 |
| 3. B | Q5MNU5 | Sterol regulatory element-binding protein cleavage-activating protein | 3.89e-02 | NA | 1.45e-04 |
| 3. B | P97865 | Peroxisomal targeting signal 2 receptor | 2.12e-12 | NA | 3.04e-19 |
| 3. B | Q5RBZ2 | Methylosome protein 50 | 2.10e-07 | NA | 0.002 |
| 3. B | P33750 | Protein SOF1 | 1.07e-04 | NA | 1.04e-05 |
| 3. B | Q6PBD6 | WD repeat-containing protein 61 | 1.14e-11 | NA | 5.38e-08 |
| 3. B | Q17N69 | Lissencephaly-1 homolog | 7.79e-13 | NA | 3.94e-17 |
| 3. B | Q8N5D0 | WD and tetratricopeptide repeats protein 1 | 2.32e-03 | NA | 0.024 |
| 3. B | Q9XGN1 | Protein TRANSPARENT TESTA GLABRA 1 | 1.26e-09 | NA | 5.33e-04 |
| 3. B | Q54SD4 | Probable histone-binding protein rbbD | 3.12e-07 | NA | 1.42e-12 |
| 3. B | B4P7H8 | WD repeat-containing protein 48 homolog | 5.61e-04 | NA | 2.17e-04 |
| 3. B | Q6C709 | Pre-mRNA-splicing factor PRP46 | 4.45e-06 | NA | 8.34e-09 |
| 3. B | Q5BIM8 | DNA excision repair protein ERCC-8 | 2.39e-08 | NA | 5.82e-04 |
| 3. B | Q8C7V3 | U3 small nucleolar RNA-associated protein 15 homolog | 2.38e-04 | NA | 2.33e-09 |
| 3. B | Q758R7 | Mitochondrial division protein 1 | 5.36e-03 | NA | 1.31e-06 |
| 3. B | P43034 | Platelet-activating factor acetylhydrolase IB subunit beta | 5.96e-13 | NA | 2.95e-16 |
| 3. B | P27612 | Phospholipase A-2-activating protein | 9.89e-04 | NA | 6.39e-11 |
| 3. B | B4P7Q3 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 5.22e-12 | NA | 9.78e-07 |
| 3. B | Q9USR0 | DNA excision repair protein ckn1 | 2.50e-07 | NA | 3.95e-09 |
| 3. B | A1DDL6 | Mitochondrial division protein 1 | 6.82e-03 | NA | 2.92e-06 |
| 3. B | Q6FT96 | Mitochondrial division protein 1 | 3.24e-04 | NA | 1.13e-09 |
| 3. B | Q9UT85 | Uncharacterized WD repeat-containing protein C343.04c | 1.97e-09 | NA | 1.16e-07 |
| 3. B | Q9FE91 | Zinc finger CCCH domain-containing protein 62 | 1.17e-03 | NA | 1.36e-05 |
| 3. B | A8PTE4 | Mitochondrial division protein 1 | 4.13e-03 | NA | 3.03e-07 |
| 3. B | Q9VAT2 | DDB1- and CUL4-associated factor 10 homolog | 1.59e-02 | NA | 0.010 |
| 3. B | Q9UQ03 | Coronin-2B | 3.07e-03 | NA | 1.45e-07 |
| 3. B | O75717 | WD repeat and HMG-box DNA-binding protein 1 | 1.43e-04 | NA | 0.011 |
| 3. B | Q6NVS5 | DDB1- and CUL4-associated factor 13 | 4.37e-04 | NA | 0.004 |
| 3. B | B3MEY6 | Lissencephaly-1 homolog | 5.94e-09 | NA | 1.80e-18 |
| 3. B | A4REK3 | Protein transport protein SEC13 | 1.15e-07 | NA | 3.87e-08 |
| 3. B | A1DHW6 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 6.63e-04 | NA | 8.35e-12 |
| 3. B | O14727 | Apoptotic protease-activating factor 1 | 2.86e-08 | NA | 5.36e-08 |
| 3. B | Q2U5Z8 | Mitochondrial division protein 1 | 1.32e-02 | NA | 2.60e-04 |
| 3. B | Q7YR70 | Angio-associated migratory cell protein | 3.07e-04 | NA | 0.004 |
| 3. B | B2B766 | Nuclear distribution protein PAC1-2 | 8.99e-11 | NA | 5.76e-06 |
| 3. B | Q2KJH4 | WD repeat-containing protein 1 | 2.31e-13 | NA | 0.015 |
| 3. B | Q5BE22 | Pre-mRNA-splicing factor prp46 | 3.73e-06 | NA | 3.35e-10 |
| 3. B | G8SD34 | NAD(+) hydrolase ApTIR | 3.98e-08 | NA | 3.79e-10 |
| 3. B | Q7ZW33 | U3 small nucleolar RNA-associated protein 15 homolog | 7.38e-05 | NA | 8.91e-11 |
| 3. B | Q9U1Q0 | EARP-interacting protein 1 | 5.39e-10 | NA | 2.48e-06 |
| 3. B | Q756D0 | Ribosome biogenesis protein YTM1 | 6.24e-05 | NA | 5.34e-04 |
| 3. B | Q58E77 | WD repeat-containing protein 82-B | 4.49e-10 | NA | 0.017 |
| 3. B | Q10G81 | Histone-binding protein MSI1 homolog | 2.94e-07 | NA | 4.08e-10 |
| 3. B | G4MQX3 | MST50-interacting protein 11 | 1.25e-10 | NA | 3.50e-04 |
| 3. B | Q9W7F2 | WD repeat-containing protein 1-A | 2.01e-13 | NA | 0.001 |
| 3. B | D5GBI7 | Nuclear distribution protein PAC1 | 4.68e-11 | NA | 3.21e-07 |
| 3. B | Q9BQA1 | Methylosome protein 50 | 2.03e-07 | NA | 0.005 |
| 3. B | P0CS51 | Protein transport protein SEC13 | 3.41e-07 | NA | 0.028 |
| 3. B | Q13033 | Striatin-3 | 2.60e-03 | NA | 1.94e-05 |
| 3. B | Q9W1J3 | Gastrulation defective protein 1 homolog | 1.51e-03 | NA | 0.046 |
| 3. B | O89053 | Coronin-1A | 4.57e-03 | NA | 3.64e-07 |
| 3. B | P0CS49 | Pre-mRNA-splicing factor PRP46 | 3.71e-06 | NA | 2.63e-11 |
| 3. B | Q5RHI5 | Denticleless protein homolog | 4.79e-04 | NA | 2.63e-07 |
| 3. B | Q75AV4 | Polyadenylation factor subunit 2 | 6.24e-05 | NA | 4.67e-06 |
| 3. B | O74855 | Ribosome assembly protein 4 | 1.07e-05 | NA | 8.23e-17 |
| 3. B | P74442 | Uncharacterized WD repeat-containing protein slr0143 | 2.13e-06 | NA | 2.35e-13 |
| 3. B | P93563 | Guanine nucleotide-binding protein subunit beta | 2.23e-08 | NA | 1.50e-08 |
| 3. B | O75530 | Polycomb protein EED | 6.30e-05 | NA | 0.030 |
| 3. B | Q6C7Q4 | Histone acetyltransferase type B subunit 2 | 2.16e-06 | NA | 1.24e-07 |
| 3. B | Q2UBU2 | Protein HIR1 | 1.00e-03 | NA | 0.002 |
| 3. B | B4Q9T6 | Ribosome biogenesis protein WDR12 homolog | 1.78e-04 | NA | 0.002 |
| 3. B | Q7PP77 | Eukaryotic translation initiation factor 3 subunit I | 3.42e-10 | NA | 0.005 |
| 3. B | Q6FWT9 | Nuclear distribution protein PAC1 | 1.71e-09 | NA | 0.002 |
| 3. B | B4LS78 | Ribosome biogenesis protein WDR12 homolog | 6.94e-05 | NA | 5.83e-05 |
| 3. B | A6QM06 | Sterol regulatory element-binding protein cleavage-activating protein | 2.22e-02 | NA | 1.42e-04 |
| 3. B | Q4IBR4 | Protein HIR1 | 2.95e-04 | NA | 0.049 |
| 3. B | Q5ZK69 | Proteasomal ATPase-associated factor 1 | 1.82e-05 | NA | 4.08e-06 |
| 3. B | Q75BY3 | Pre-mRNA-splicing factor PRP46 | 1.29e-08 | NA | 8.97e-11 |
| 3. B | Q3MHE2 | U4/U6 small nuclear ribonucleoprotein Prp4 | 3.92e-11 | NA | 2.93e-14 |
| 3. B | Q6FJ73 | Probable cytosolic iron-sulfur protein assembly protein 1 | 1.22e-10 | NA | 3.16e-08 |
| 3. B | Q1DZQ0 | Protein transport protein SEC13 | 3.23e-08 | NA | 4.43e-06 |
| 3. B | A4R3M4 | Nuclear distribution protein PAC1 | 2.79e-11 | NA | 1.55e-08 |
| 3. B | Q6P2Y2 | Dynein assembly factor with WDR repeat domains 1 | 4.19e-06 | NA | 9.12e-16 |
| 3. B | Q6FNV4 | Protein transport protein SEC13-1 | 1.01e-07 | NA | 1.04e-06 |
| 3. B | Q7T0P4 | POC1 centriolar protein homolog A | 1.25e-04 | NA | 3.54e-10 |
| 3. B | Q5PPK9 | EARP and GARP complex-interacting protein 1 | 4.86e-10 | NA | 0.002 |
| 3. B | C0NRC6 | Nuclear distribution protein PAC1 | 3.80e-11 | NA | 3.93e-10 |
| 3. B | Q5XGE2 | U3 small nucleolar RNA-associated protein 15 homolog | 1.29e-04 | NA | 1.53e-11 |
| 3. B | Q59Y20 | Protein DSE1 | 1.14e-02 | NA | 0.001 |
| 3. B | A0CH87 | Lissencephaly-1 homolog 2 | 2.80e-13 | NA | 8.64e-11 |
| 3. B | Q5M7K4 | Histone-binding protein RBBP4 | 3.90e-07 | NA | 1.44e-09 |
| 3. B | Q9BVC4 | Target of rapamycin complex subunit LST8 | 2.56e-07 | NA | 0.029 |
| 3. B | P91343 | Ribosome biogenesis protein WDR12 homolog | 9.00e-05 | NA | 0.016 |
| 3. B | C5MJE8 | Nuclear distribution protein PAC1 | 6.34e-10 | NA | 1.04e-07 |
| 3. B | Q6ZMY6 | WD repeat-containing protein 88 | 3.18e-05 | NA | 7.67e-10 |
| 3. B | Q40507 | Guanine nucleotide-binding protein subunit beta | 6.13e-13 | NA | 9.16e-10 |
| 3. B | Q9C2I5 | Ribosome biogenesis protein ytm1 | 6.81e-05 | NA | 0.002 |
| 3. B | B0WYR6 | WD repeat-containing protein on Y chromosome | 5.21e-07 | NA | 1.33e-04 |
| 3. B | P47025 | Mitochondrial division protein 1 | 6.01e-07 | NA | 8.65e-06 |
| 3. B | P40217 | Eukaryotic translation initiation factor 3 subunit I | 8.58e-08 | NA | 0.001 |
| 3. B | Q9UTC7 | Uncharacterized WD repeat-containing protein C227.12 | 1.81e-11 | NA | 2.13e-09 |
| 3. B | A8X8C6 | WD repeat-containing protein tag-125 | 2.62e-06 | NA | 2.87e-15 |
| 3. B | C5DF48 | Nuclear distribution protein PAC1 | 6.93e-10 | NA | 1.57e-04 |
| 3. B | Q9NWT1 | p21-activated protein kinase-interacting protein 1 | 5.20e-04 | NA | 2.29e-04 |
| 3. B | Q61FW2 | F-box/WD repeat-containing protein sel-10 | 3.20e-06 | NA | 3.57e-20 |
| 3. B | P39014 | F-box protein MET30 | 9.86e-04 | NA | 1.57e-11 |
| 3. B | Q9P7I3 | Mitochondrial division protein 1 | 1.25e-02 | NA | 4.32e-08 |
| 3. B | P0CS48 | Pre-mRNA-splicing factor PRP46 | 3.14e-06 | NA | 2.60e-11 |
| 3. B | Q6CB13 | Mitochondrial division protein 1 | 4.01e-07 | NA | 6.35e-07 |
| 3. B | Q8NHY2 | E3 ubiquitin-protein ligase COP1 | 8.24e-04 | NA | 2.05e-05 |
| 3. B | F1LTR1 | WD repeat-containing protein 26 | 5.39e-08 | NA | 8.02e-12 |
| 3. B | Q5XFW8 | Protein SEC13 homolog | 7.30e-08 | NA | 0.006 |
| 3. B | Q498M4 | WD repeat-containing protein 5 | 1.15e-05 | NA | 2.95e-14 |
| 3. B | Q17GR9 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 4.87e-12 | NA | 3.09e-07 |
| 3. B | Q9UM11 | Fizzy-related protein homolog | 1.73e-03 | NA | 1.72e-05 |
| 3. B | Q24572 | Chromatin assembly factor 1 p55 subunit | 4.31e-07 | NA | 1.43e-11 |
| 3. B | Q80ZK9 | WD and tetratricopeptide repeats protein 1 | 2.89e-03 | NA | 0.024 |
| 3. B | Q8TC44 | POC1 centriolar protein homolog B | 1.58e-04 | NA | 2.21e-11 |
| 3. B | Q12770 | Sterol regulatory element-binding protein cleavage-activating protein | 2.41e-02 | NA | 6.06e-05 |
| 3. B | B3RNR8 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 6.21e-11 | NA | 5.07e-07 |
| 3. B | P53024 | Protein transport protein SEC13 | 9.49e-08 | NA | 2.21e-07 |
| 3. B | P0CS38 | Protein HIR1 | 4.74e-05 | NA | 0.002 |
| 3. B | P25635 | Periodic tryptophan protein 2 | 4.09e-06 | NA | 1.69e-05 |
| 3. B | P63244 | Receptor of activated protein C kinase 1 | 2.02e-10 | NA | 2.25e-06 |
| 3. B | A3LTS5 | Protein DSE1 | 1.69e-03 | NA | 5.16e-04 |
| 3. B | Q7T2F6 | WD repeat and SOCS box-containing protein 1 | 4.30e-04 | NA | 7.33e-08 |
| 3. B | Q6DTM3 | Jouberin | 6.59e-03 | NA | 1.05e-07 |
| 3. B | B4QHG6 | Lissencephaly-1 homolog | 8.87e-13 | NA | 7.09e-17 |
| 3. B | Q9D2V7 | Coronin-7 | 1.45e-08 | NA | 2.92e-06 |
| 3. B | B7PY76 | Ribosome biogenesis protein WDR12 homolog | 3.20e-05 | NA | 4.47e-07 |
| 3. B | Q9DC48 | Pre-mRNA-processing factor 17 | 8.91e-06 | NA | 2.86e-09 |
| 3. B | Q17963 | WD repeat-containing protein wdr-5.1 | 1.68e-05 | NA | 2.00e-15 |
| 3. B | Q23256 | WD repeat-containing protein wdr-5.3 | 4.01e-04 | NA | 3.42e-13 |
| 3. B | B2VWG7 | Nuclear distribution protein PAC1 | 3.40e-11 | NA | 7.82e-10 |
| 3. B | A8WGE3 | Coronin-2B | 7.03e-03 | NA | 2.03e-07 |
| 3. B | Q4R2Z6 | WD repeat-containing protein 48 | 2.35e-03 | NA | 8.56e-04 |
| 3. B | C4YFX2 | Transcriptional repressor TUP1 | 9.42e-06 | NA | 1.11e-11 |
| 3. B | C4R6H3 | Nuclear distribution protein PAC1 | 2.28e-08 | NA | 1.66e-07 |
| 3. B | P79959 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 2.70e-12 | NA | 6.86e-07 |
| 3. B | Q8YTC2 | Uncharacterized WD repeat-containing protein alr2800 | 3.36e-10 | NA | 7.64e-26 |
| 3. B | Q9DAW6 | U4/U6 small nuclear ribonucleoprotein Prp4 | 3.63e-11 | NA | 3.71e-14 |
| 3. B | Q4WLM7 | Nuclear distribution protein nudF | 5.63e-11 | NA | 6.77e-08 |
| 3. B | P62882 | Guanine nucleotide-binding protein subunit beta-5 | 9.90e-12 | NA | 8.18e-11 |
| 3. B | P07834 | Cell division control protein 4 | 4.78e-04 | NA | 1.35e-11 |
| 3. B | Q55E54 | Coronin-B | 3.22e-08 | NA | 5.69e-05 |
| 3. B | Q9S7H3 | Cell division cycle 20.3, cofactor of APC complex | 1.17e-04 | NA | 1.85e-08 |
| 3. B | Q8TED0 | U3 small nucleolar RNA-associated protein 15 homolog | 2.16e-04 | NA | 5.95e-11 |
| 3. B | P43254 | E3 ubiquitin-protein ligase COP1 | 4.46e-05 | NA | 1.05e-08 |
| 3. B | P0CS46 | Polyadenylation factor subunit 2 | 1.35e-03 | NA | 2.18e-08 |
| 3. B | P78706 | Transcriptional repressor rco-1 | 2.14e-03 | NA | 1.25e-09 |
| 3. B | Q6RI45 | Bromodomain and WD repeat-containing protein 3 | 1.59e-02 | NA | 3.06e-10 |
| 3. B | B4KT48 | Lissencephaly-1 homolog | 8.29e-13 | NA | 4.88e-18 |
| 3. B | A5DL92 | Ribosome biogenesis protein YTM1 | 6.10e-05 | NA | 5.61e-05 |
| 3. B | Q21215 | Guanine nucleotide-binding protein subunit beta-2-like 1 | 1.30e-09 | NA | 0.001 |
| 3. B | Q4R4J2 | Coronin-1A | 1.65e-03 | NA | 9.10e-07 |
| 3. B | Q9EPV5 | Apoptotic protease-activating factor 1 | 2.45e-08 | NA | 6.13e-07 |
| 3. B | O13985 | Uncharacterized WD repeat-containing protein C26H5.03 | 2.27e-03 | NA | 3.83e-04 |
| 3. B | Q9PTR5 | Lissencephaly-1 homolog | 1.83e-09 | NA | 1.61e-15 |
| 3. B | B6HP56 | Nuclear distribution protein nudF 1 | 1.59e-11 | NA | 2.12e-11 |
| 3. B | O24456 | Receptor for activated C kinase 1A | 1.51e-11 | NA | 4.37e-04 |
| 3. B | Q9EQ15 | Guanine nucleotide-binding protein subunit beta-like protein 1 | 3.15e-06 | NA | 0.043 |
| 3. B | P0CS37 | Histone acetyltransferase type B subunit 2 | 2.71e-06 | NA | 2.50e-18 |
| 3. B | O13637 | Protein transport protein sec31 | 7.85e-05 | NA | 0.001 |
| 3. B | Q3TLR7 | Denticleless protein homolog | 1.31e-04 | NA | 0.008 |
| 3. B | A0A2R8RWN9 | F-box and WD repeat domain-containing 11-B | 3.29e-05 | NA | 9.49e-17 |
| 3. B | P62883 | Guanine nucleotide-binding protein subunit beta-like protein | 2.44e-10 | NA | 1.78e-08 |
| 3. B | Q6CKE8 | Pre-mRNA-splicing factor PRP46 | 2.20e-08 | NA | 1.38e-10 |
| 3. B | Q9NV06 | DDB1- and CUL4-associated factor 13 | 2.99e-05 | NA | 0.044 |
| 3. B | Q99J79 | DNA damage-binding protein 2 | 6.44e-05 | NA | 0.013 |
| 3. B | Q6CJ50 | Mitochondrial division protein 1 | 2.21e-03 | NA | 1.35e-05 |
| 3. B | Q12417 | Pre-mRNA-splicing factor PRP46 | 4.59e-05 | NA | 1.15e-09 |
| 3. B | Q55C80 | Diphthine methyltransferase homolog | 5.53e-10 | NA | 4.63e-04 |
| 3. B | Q8CBE3 | WD repeat-containing protein 37 | 2.21e-03 | NA | 1.45e-09 |
| 3. B | Q8BG40 | Katanin p80 WD40 repeat-containing subunit B1 | 2.71e-04 | NA | 8.18e-12 |
| 3. B | Q42384 | Protein pleiotropic regulatory locus 1 | 8.52e-06 | NA | 2.16e-09 |
| 3. B | Q9LT47 | Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM | 8.88e-07 | NA | 2.52e-06 |
| 3. B | Q9UMS4 | Pre-mRNA-processing factor 19 | 4.01e-10 | NA | 4.58e-11 |
| 3. B | P16649 | General transcriptional corepressor TUP1 | 1.24e-03 | NA | 6.46e-09 |
| 3. B | Q55FR9 | Coatomer subunit alpha | 2.54e-07 | NA | 1.03e-10 |
| 3. B | Q96S15 | GATOR complex protein WDR24 | 1.48e-03 | NA | 2.05e-07 |
| 3. B | Q8RXA7 | DENN domain and WD repeat-containing protein SCD1 | 3.25e-03 | NA | 1.54e-09 |
| 3. B | A2AC93 | Dynein axonemal intermediate chain 2 | 1.64e-04 | NA | 0.014 |
| 3. B | O80990 | Protein CIA1 | 1.47e-10 | NA | 1.35e-08 |
| 3. B | Q9R1A8 | E3 ubiquitin-protein ligase COP1 | 1.14e-09 | NA | 2.14e-05 |
| 3. B | Q0CJD8 | Mitochondrial division protein 1 | 6.88e-03 | NA | 1.45e-05 |
| 3. B | Q13685 | Angio-associated migratory cell protein | 5.59e-05 | NA | 0.002 |
| 3. B | Q09150 | Meiotic recombination protein rec14 | 1.04e-09 | NA | 0.001 |
| 3. B | Q6PE01 | U5 small nuclear ribonucleoprotein 40 kDa protein | 7.36e-06 | NA | 3.08e-11 |
| 3. B | Q5SUS0 | F-box/WD repeat-containing protein 10 | 7.86e-03 | NA | 1.26e-06 |
| 3. B | Q8W1K8 | Protein Mut11 | 4.60e-07 | NA | 2.05e-13 |
| 3. B | Q9H7D7 | WD repeat-containing protein 26 | 2.23e-07 | NA | 1.90e-11 |
| 3. B | Q9BQ87 | F-box-like/WD repeat-containing protein TBL1Y | 8.20e-07 | NA | 2.17e-26 |
| 3. B | Q96EX3 | Cytoplasmic dynein 2 intermediate chain 2 | 1.13e-04 | NA | 0.008 |
| 3. B | Q5ZJW8 | Denticleless protein homolog | 1.12e-04 | NA | 8.94e-07 |
| 3. B | Q3E906 | Cell division cycle 20.5, cofactor of APC complex | 4.22e-04 | NA | 1.97e-10 |
| 3. B | P38011 | Guanine nucleotide-binding protein subunit beta-like protein | 1.09e-10 | NA | 4.08e-04 |
| 3. B | Q54DS4 | WD repeat-containing protein DDB_G0292056 | 4.68e-02 | NA | 9.36e-08 |
| 3. B | A4IIX9 | WD repeat-containing protein 37 | 3.51e-05 | NA | 5.90e-09 |
| 3. B | A0JPH4 | Sterol regulatory element-binding protein cleavage-activating protein | 8.09e-03 | NA | 5.89e-05 |
| 3. B | O35828 | Coronin-7 | 1.75e-08 | NA | 1.51e-06 |
| 3. B | Q4R571 | EARP and GARP complex-interacting protein 1 | 3.41e-10 | NA | 0.012 |
| 3. B | P63247 | Receptor of activated protein C kinase 1 | 1.91e-10 | NA | 2.25e-06 |
| 3. B | Q4P2B6 | Protein transport protein SEC31 | 6.98e-03 | NA | 9.79e-06 |
| 3. B | Q9SZQ5 | WD repeat-containing protein VIP3 | 3.00e-11 | NA | 3.14e-13 |
| 3. B | Q4X0A9 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 1.85e-03 | NA | 1.02e-11 |
| 3. B | Q8VEJ4 | Notchless protein homolog 1 | 4.86e-06 | NA | 3.94e-13 |
| 3. B | P93398 | Guanine nucleotide-binding protein subunit beta-2 | 1.31e-08 | NA | 2.39e-09 |
| 3. B | Q99KP6 | Pre-mRNA-processing factor 19 | 3.42e-06 | NA | 2.72e-11 |
| 3. B | C5FWH1 | Nuclear distribution protein PAC1 | 2.86e-11 | NA | 5.23e-08 |
| 3. B | Q27954 | Coatomer subunit alpha | 1.68e-04 | NA | 7.57e-10 |
| 3. B | Q5RAW8 | WD repeat-containing protein 48 | 1.55e-03 | NA | 0.003 |
| 3. B | Q5BJQ6 | Cleavage stimulation factor subunit 1 | 5.33e-09 | NA | 5.79e-04 |
| 3. B | B5DG67 | Ribosome biogenesis protein wdr12 | 7.17e-05 | NA | 1.70e-05 |
| 3. B | P54311 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 1.32e-12 | NA | 3.79e-06 |
| 3. B | Q5R5W8 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 2.80e-12 | NA | 4.28e-06 |
| 3. B | Q24371 | Protein lethal(2)denticleless | 1.55e-02 | NA | 1.25e-06 |
| 3. B | Q5XIG8 | Serine-threonine kinase receptor-associated protein | 8.18e-07 | NA | 0.003 |
| 3. B | Q5XI13 | Glutamate-rich WD repeat-containing protein 1 | 2.46e-04 | NA | 2.26e-12 |
| 3. B | P14197 | WD repeat-containing protein AAC3 | 2.34e-06 | NA | 3.85e-11 |
| 3. B | Q6GM65 | Phospholipase A-2-activating protein | 2.33e-04 | NA | 1.03e-10 |
| 3. B | A6ZMK5 | Eukaryotic translation initiation factor 3 subunit I | 2.03e-07 | NA | 0.001 |
| 3. B | P90917 | Probable histone-binding protein rba-1 | 6.89e-07 | NA | 1.95e-09 |
| 3. B | Q16K15 | Eukaryotic translation initiation factor 3 subunit I | 6.25e-10 | NA | 7.91e-04 |
| 3. B | Q9FNN2 | WD repeat-containing protein 26 homolog | 3.49e-04 | NA | 1.75e-07 |
| 3. B | Q7KNS3 | Lissencephaly-1 homolog | 9.66e-13 | NA | 7.09e-17 |
| 3. B | A2RRU4 | Sterol regulatory element-binding protein cleavage-activating protein | 2.12e-02 | NA | 1.70e-04 |
| 3. B | Q9NVX2 | Notchless protein homolog 1 | 5.19e-06 | NA | 3.93e-14 |
| 3. B | Q6P1V3 | WD repeat and SOCS box-containing protein 1 | 8.42e-04 | NA | 4.51e-07 |
| 3. B | Q9V3J8 | Protein will die slowly | 1.94e-06 | NA | 1.18e-13 |
| 3. B | Q9FN19 | WD40 repeat-containing protein HOS15 | 4.82e-04 | NA | 1.59e-20 |
| 3. B | Q6CU55 | Nuclear distribution protein PAC1 | 3.40e-09 | NA | 0.014 |
| 3. B | Q6GPC6 | F-box-like/WD repeat-containing protein TBL1XR1-B | 6.42e-07 | NA | 4.53e-25 |
| 3. B | Q8L611 | Protein transport protein SEC31 homolog B | 2.20e-04 | NA | 1.74e-04 |
| 3. B | Q13216 | DNA excision repair protein ERCC-8 | 3.34e-08 | NA | 1.85e-04 |
| 3. B | F4KB17 | Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 | 9.26e-08 | NA | 9.67e-13 |
| 3. B | B4HRQ6 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 5.54e-12 | NA | 1.13e-06 |
| 3. B | Q7RZF5 | Protein transport protein sec13 | 8.97e-08 | NA | 4.76e-06 |
| 3. B | A7MB12 | U3 small nucleolar RNA-associated protein 15 homolog | 9.36e-05 | NA | 3.57e-10 |
| 3. B | Q6KAU8 | Protein Atg16l2 | 4.00e-03 | NA | 0.001 |
| 3. B | Q7PS24 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 1.10e-11 | NA | 1.16e-08 |
| 3. B | Q28YY2 | WD repeat-containing protein 48 homolog | 2.36e-03 | NA | 9.44e-05 |
| 3. B | Q6FLI3 | CCR4-associated factor 4 homolog | 1.73e-05 | NA | 1.30e-04 |
| 3. B | Q2TZG4 | Polyadenylation factor subunit 2 | 5.79e-04 | NA | 1.09e-09 |
| 3. B | O48847 | Transcriptional corepressor LEUNIG_HOMOLOG | 5.14e-05 | NA | 7.62e-12 |
| 3. B | O18640 | Guanine nucleotide-binding protein subunit beta-like protein | 1.46e-10 | NA | 1.76e-05 |
| 3. B | Q9ULV4 | Coronin-1C | 3.34e-03 | NA | 1.20e-08 |
| 3. B | Q6CG48 | Nuclear distribution protein PAC1 | 7.30e-12 | NA | 6.37e-08 |
| 3. B | Q5E9A4 | mRNA export factor | 1.15e-05 | NA | 9.57e-07 |
| 3. B | A4RJV3 | Mitochondrial division protein 1 | 9.79e-04 | NA | 3.60e-09 |
| 3. B | A7TH19 | Eukaryotic translation initiation factor 3 subunit I | 1.05e-07 | NA | 0.026 |
| 3. B | Q5AZM3 | Protein transport protein sec31 | 7.21e-04 | NA | 8.40e-06 |
| 3. B | Q5SP67 | WD repeat-containing protein 26 | 1.94e-05 | NA | 7.81e-13 |
| 3. B | Q5R8K2 | Cleavage stimulation factor subunit 1 | 4.40e-09 | NA | 8.91e-04 |
| 3. B | C4JPW9 | Nuclear distribution protein PAC1-2 | 5.93e-11 | NA | 2.99e-08 |
| 3. B | Q32LP9 | Coronin-2A | 2.24e-02 | NA | 2.04e-05 |
| 3. B | P62884 | Guanine nucleotide-binding protein subunit beta-like protein | 3.08e-10 | NA | 1.78e-08 |
| 3. B | Q7ZTY4 | Histone-binding protein RBBP7 | 8.00e-07 | NA | 8.02e-10 |
| 3. B | Q9SZA4 | Cell division cycle 20.1, cofactor of APC complex | 2.73e-05 | NA | 7.85e-11 |
| 3. B | Q9LYK6 | Protein ANTHESIS POMOTING FACTOR 1 | 2.74e-08 | NA | 0.010 |
| 3. B | Q5ZMA2 | Pre-mRNA-processing factor 19 | 1.00e-05 | NA | 2.19e-10 |
| 3. B | Q6S7B0 | Transcription initiation factor TFIID subunit 5 | 1.20e-04 | NA | 3.61e-12 |
| 3. B | Q1JQD2 | Glutamate-rich WD repeat-containing protein 1 | 5.98e-05 | NA | 7.06e-12 |
| 3. B | O93377 | Histone-binding protein RBBP4-A | 4.14e-07 | NA | 2.06e-09 |
| 3. B | Q54IY5 | Component of gems protein 5 | 9.65e-06 | NA | 3.46e-07 |
| 3. B | Q99LL5 | Periodic tryptophan protein 1 homolog | 8.31e-04 | NA | 1.51e-07 |
| 3. B | C4Q0P6 | Lissencephaly-1 homolog | 6.63e-13 | NA | 7.89e-16 |
| 3. B | Q9W5Z5 | WD repeat and SOCS box-containing protein 1 | 4.58e-04 | NA | 2.13e-06 |
| 3. B | O22212 | U4/U6 small nuclear ribonucleoprotein PRP4-like protein | 2.10e-08 | NA | 5.87e-16 |
| 3. B | A1CF18 | Nuclear distribution protein nudF 2 | 1.77e-11 | NA | 2.39e-07 |
| 3. B | Q6PJI9 | GATOR complex protein WDR59 | 2.38e-03 | NA | 6.76e-05 |
| 3. B | Q6BSL7 | Eukaryotic translation initiation factor 3 subunit I | 2.06e-07 | NA | 0.023 |
| 3. B | Q6Q0C0 | E3 ubiquitin-protein ligase TRAF7 | 3.45e-09 | NA | 1.59e-05 |
| 3. B | O43684 | Mitotic checkpoint protein BUB3 | 4.14e-09 | NA | 4.54e-04 |
| 3. B | Q08706 | Guanine nucleotide-binding protein subunit beta | 3.48e-12 | NA | 3.54e-06 |
| 3. B | U4PCM1 | pre-mRNA 3' end processing protein pfs-2 | 6.71e-04 | NA | 3.16e-11 |
| 3. B | O95170 | CMT1A duplicated region transcript 1 protein | 8.68e-04 | NA | 6.63e-05 |
| 3. B | B0X2V9 | WD repeat-containing protein 48 homolog | 3.63e-03 | NA | 0.001 |
| 3. B | Q8K4P0 | pre-mRNA 3' end processing protein WDR33 | 3.71e-03 | NA | 7.83e-08 |
| 3. B | Q6FNU4 | Protein transport protein SEC31 | 2.71e-04 | NA | 0.006 |
| 3. B | Q54KL5 | WD repeat-containing protein 5 homolog | 2.41e-05 | NA | 4.14e-13 |
| 3. B | B4MU54 | Ribosome biogenesis protein WDR12 homolog | 3.57e-05 | NA | 1.87e-04 |
| 3. B | P41838 | Poly(A)+ RNA export protein | 3.75e-08 | NA | 8.66e-06 |
| 3. B | Q6GQT6 | Sterol regulatory element-binding protein cleavage-activating protein | 1.71e-02 | NA | 8.64e-05 |
| 3. B | Q4V837 | Denticleless protein homolog A | 7.15e-04 | NA | 5.31e-06 |
| 3. B | Q9Y263 | Phospholipase A-2-activating protein | 1.38e-04 | NA | 9.87e-11 |
| 3. B | Q58D20 | Notchless protein homolog 1 | 2.56e-05 | NA | 3.31e-14 |
| 3. B | Q5R654 | Histone-binding protein RBBP7 | 1.82e-06 | NA | 2.83e-09 |
| 3. B | O88342 | WD repeat-containing protein 1 | 2.36e-13 | NA | 0.003 |
| 3. B | Q0CY32 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 4.94e-04 | NA | 1.77e-11 |
| 3. B | Q4PCB8 | Protein transport protein SEC13 | 3.17e-07 | NA | 0.023 |
| 3. B | Q28DW0 | Probable cytosolic iron-sulfur protein assembly protein ciao1 | 2.04e-08 | NA | 2.77e-08 |
| 3. B | Q8C092 | Transcription initiation factor TFIID subunit 5 | 4.53e-04 | NA | 1.16e-13 |
| 3. B | Q9GZS3 | WD repeat-containing protein 61 | 4.80e-11 | NA | 1.30e-04 |
| 3. B | Q0USG2 | Probable cytosolic iron-sulfur protein assembly protein 1 | 4.81e-09 | NA | 2.10e-04 |
| 3. B | Q9URY0 | Ribosome biogenesis protein ytm1 | 2.56e-04 | NA | 4.66e-04 |
| 3. B | Q8NHV4 | Protein NEDD1 | 2.76e-05 | NA | 0.009 |
| 3. B | Q6CU59 | Ribosome biogenesis protein YTM1 | 5.66e-05 | NA | 0.015 |
| 3. B | Q922V4 | Pleiotropic regulator 1 | 1.05e-03 | NA | 3.69e-12 |
| 3. B | Q12834 | Cell division cycle protein 20 homolog | 4.14e-05 | NA | 3.52e-13 |
| 3. B | Q10281 | Guanine nucleotide-binding protein subunit beta-like protein | 7.99e-12 | NA | 6.66e-08 |
| 3. B | Q6GPU3 | Denticleless protein homolog B | 1.11e-04 | NA | 3.23e-05 |
| 3. B | P49177 | Guanine nucleotide-binding protein subunit beta | 2.08e-11 | NA | 3.91e-10 |
| 3. B | Q05AM5 | Elongator complex protein 2 | 3.13e-09 | NA | 0.005 |
| 3. B | F1QHZ6 | Dynein axonemal intermediate chain 4 | 3.49e-04 | NA | 1.44e-04 |
| 3. B | Q9FLX9 | Notchless protein homolog | 1.34e-05 | NA | 4.82e-15 |
| 3. B | Q5ZIU8 | Katanin p80 WD40 repeat-containing subunit B1 | 4.19e-04 | NA | 1.13e-11 |
| 3. B | Q8R537 | Peroxisomal targeting signal 2 receptor | 2.06e-12 | NA | 4.83e-20 |
| 3. B | Q75LV5 | U3 snoRNP-associated protein-like YAOH | 1.38e-03 | NA | 0.016 |
| 3. B | Q13112 | Chromatin assembly factor 1 subunit B | 1.69e-05 | NA | 3.30e-06 |
| 3. B | Q4QR85 | Methylosome protein 50 | 3.14e-06 | NA | 0.012 |
| 3. B | O94394 | Uncharacterized WD repeat-containing protein C126.01c | 2.72e-06 | NA | 0.006 |
| 3. B | P93107 | Flagellar WD repeat-containing protein Pf20 | 1.90e-06 | NA | 1.46e-10 |
| 3. B | Q8BX09 | Retinoblastoma-binding protein 5 | 7.93e-04 | NA | 0.001 |
| 3. B | A6R3K5 | Ribosome biogenesis protein YTM1 | 1.69e-04 | NA | 0.017 |
| 3. B | Q5ZLG9 | GATOR complex protein WDR59 | 6.78e-04 | NA | 1.29e-08 |
| 3. B | Q1JQB2 | Mitotic checkpoint protein BUB3 | 2.86e-09 | NA | 4.92e-04 |
| 3. B | Q54QU5 | WD repeat-containing protein 89 homolog | 2.61e-06 | NA | 0.004 |
| 3. B | Q7T394 | Lissencephaly-1 homolog A | 5.61e-13 | NA | 5.18e-15 |
| 3. B | Q7ZXK9 | Notchless protein homolog 1 | 2.04e-05 | NA | 8.18e-14 |
| 3. B | Q5RAC9 | Autophagy-related protein 16-1 | 8.08e-04 | NA | 1.02e-04 |
| 3. B | P83774 | Guanine nucleotide-binding protein subunit beta-like protein | 2.00e-10 | NA | 6.12e-05 |
| 3. B | D3Z902 | F-box/WD repeat-containing protein 7 | 2.79e-05 | NA | 5.64e-21 |
| 3. B | O08653 | Telomerase protein component 1 | 2.85e-05 | NA | 0.011 |
| 3. B | Q9NDC9 | Lissencephaly-1 homolog | 8.82e-13 | NA | 4.94e-10 |
| 3. B | Q1LV15 | Dynein assembly factor with WDR repeat domains 1 | 1.68e-05 | NA | 3.09e-13 |
| 3. B | O22466 | WD-40 repeat-containing protein MSI1 | 3.44e-07 | NA | 2.22e-09 |
| 3. B | Q59WJ4 | Polyadenylation factor subunit 2 | 6.79e-06 | NA | 2.15e-07 |
| 3. B | Q6FXI8 | Histone acetyltransferase type B subunit 2 | 1.46e-08 | NA | 1.14e-06 |
| 3. B | Q5RDY7 | Guanine nucleotide-binding protein subunit beta-5 | 1.08e-11 | NA | 1.11e-10 |
| 3. B | Q09715 | Transcriptional repressor tup11 | 3.13e-06 | NA | 1.67e-13 |
| 3. B | Q5H7C0 | Cell division cycle protein 20 homolog | 9.42e-04 | NA | 4.22e-13 |
| 3. B | Q7S8R5 | Mitochondrial division protein 1 | 9.08e-04 | NA | 2.32e-08 |
| 3. B | Q9LV27 | Target of rapamycin complex subunit LST8-1 | 4.53e-05 | NA | 4.65e-05 |
| 3. B | Q9FND4 | WD repeat-containing protein WDS homolog | 6.62e-05 | NA | 6.07e-12 |
| 3. B | A2QHM1 | Protein transport protein sec13 | 4.04e-08 | NA | 1.51e-06 |
| 3. B | Q86VZ2 | WD repeat-containing protein 5B | 8.90e-08 | NA | 2.65e-13 |
| 3. B | B4MY65 | Lissencephaly-1 homolog | 8.62e-13 | NA | 3.58e-18 |
| 3. B | Q8UUP2 | Polycomb protein eed-A | 2.23e-04 | NA | 0.028 |
| 3. B | Q6PBY0 | Guanine nucleotide-binding protein subunit beta-5b | 1.13e-05 | NA | 8.80e-11 |
| 3. B | A9V790 | Lissencephaly-1 homolog | 1.29e-12 | NA | 8.67e-08 |
| 3. B | Q5FWQ6 | Dynein assembly factor with WDR repeat domains 1 | 3.69e-06 | NA | 1.65e-15 |
| 3. B | Q7SZM9 | F-box-like/WD repeat-containing protein TBL1XR1-A | 9.61e-06 | NA | 2.64e-25 |
| 3. B | Q93ZG3 | WD repeat-containing protein ATCSA-1 | 4.51e-04 | NA | 1.77e-04 |
| 3. B | C5JD40 | Nuclear distribution protein PAC1 | 3.71e-10 | NA | 1.60e-07 |
| 3. B | A4R7U3 | Probable cytosolic iron-sulfur protein assembly protein 1 | 3.23e-08 | NA | 1.76e-04 |
| 3. B | Q91WM3 | U3 small nucleolar RNA-interacting protein 2 | 1.24e-08 | NA | 3.45e-04 |
| 3. B | P49027 | Guanine nucleotide-binding protein subunit beta-like protein A | 3.85e-10 | NA | 0.031 |
| 3. B | P52287 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 | 2.82e-12 | NA | 7.58e-09 |
| 3. B | Q4P553 | Histone acetyltransferase type B subunit 2 | 4.73e-09 | NA | 5.01e-12 |
| 3. B | Q7RZI0 | Protein hir-1 | 2.53e-04 | NA | 0.015 |
| 3. B | Q5RCG7 | Angio-associated migratory cell protein | 4.61e-05 | NA | 0.002 |
| 3. B | A1DP19 | Nuclear distribution protein nudF | 1.73e-08 | NA | 1.43e-07 |
| 3. B | Q5AZX0 | Polyadenylation factor subunit 2 | 6.55e-04 | NA | 8.38e-07 |
| 3. B | Q0CCS0 | Probable cytosolic iron-sulfur protein assembly protein 1 | 3.54e-10 | NA | 0.002 |
| 3. B | Q9AV81 | Pre-mRNA-processing factor 19 | 4.90e-04 | NA | 4.51e-09 |
| 3. B | Q5REE0 | U3 small nucleolar RNA-associated protein 15 homolog | 4.29e-05 | NA | 1.34e-10 |
| 3. B | Q8C0M0 | GATOR complex protein WDR59 | 1.22e-03 | NA | 9.22e-05 |
| 3. B | P87053 | F-box/WD repeat-containing protein pof1 | 2.35e-03 | NA | 4.87e-14 |
| 3. B | Q8BHB4 | WD repeat-containing protein 3 | 5.51e-08 | NA | 7.91e-10 |
| 3. B | Q8C4J7 | Transducin beta-like protein 3 | 1.17e-06 | NA | 1.90e-12 |
| 3. B | Q39336 | Guanine nucleotide-binding protein subunit beta-like protein | 1.69e-11 | NA | 0.035 |
| 3. B | Q6FL15 | Eukaryotic translation initiation factor 3 subunit I | 8.66e-08 | NA | 0.020 |
| 3. B | Q6ZMW3 | Echinoderm microtubule-associated protein-like 6 | 2.65e-03 | NA | 0.011 |
| 3. B | Q4WT34 | Pre-mRNA-splicing factor prp46 | 5.45e-05 | NA | 3.00e-10 |
| 3. B | Q9JJ66 | Cell division cycle protein 20 homolog | 8.41e-04 | NA | 6.29e-14 |
| 3. B | Q20636 | Guanine nucleotide-binding protein subunit beta-2 | 2.23e-11 | NA | 2.15e-09 |
| 3. B | Q2HJH6 | U5 small nuclear ribonucleoprotein 40 kDa protein | 1.59e-06 | NA | 1.90e-11 |
| 3. B | A0A2R8QFQ6 | F-box and WD repeat domain-containing 11-A | 4.18e-05 | NA | 4.81e-16 |
| 3. B | Q9GL51 | Platelet-activating factor acetylhydrolase IB subunit alpha | 5.85e-13 | NA | 2.53e-16 |
| 3. B | P13712 | Chromatin assembly factor 1 subunit p50 | 8.80e-08 | NA | 1.23e-08 |
| 3. B | Q9XW12 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 9.42e-08 | NA | 2.67e-04 |
| 3. B | Q0DYP5 | Zinc finger CCCH domain-containing protein 17 | 4.28e-04 | NA | 4.88e-07 |
| 3. B | Q5RB58 | Mitotic checkpoint protein BUB3 | 3.74e-09 | NA | 0.001 |
| 3. B | Q7ZX22 | GATOR complex protein WDR24 | 5.70e-04 | NA | 1.01e-06 |
| 3. B | A9VDW7 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 9.72e-04 | NA | 6.84e-08 |
| 3. B | Q9ZU34 | Actin-interacting protein 1-1 | 0.00e+00 | NA | 5.05e-04 |
| 3. B | P38129 | Transcription initiation factor TFIID subunit 5 | 1.65e-04 | NA | 2.84e-12 |
| 3. B | C6HTE8 | Nuclear distribution protein PAC1 | 3.22e-11 | NA | 3.93e-10 |
| 3. B | Q8RXU6 | WD repeat-containing protein PCN | 7.89e-07 | NA | 2.64e-06 |
| 3. B | P27133 | Coronin-A | 1.17e-03 | NA | 2.26e-06 |
| 3. B | Q7S7L4 | Nuclear distribution protein nudF-1 | 8.26e-07 | NA | 4.31e-11 |
| 3. B | P0CY34 | Transcriptional repressor TUP1 | 1.23e-05 | NA | 1.11e-11 |
| 3. B | B0XTS1 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 1.43e-03 | NA | 1.02e-11 |
| 3. B | P61964 | WD repeat-containing protein 5 | 2.13e-06 | NA | 2.95e-14 |
| 3. B | Q8CGF6 | WD repeat-containing protein 47 | 1.04e-03 | NA | 1.55e-07 |
| 3. B | P36408 | Guanine nucleotide-binding protein subunit beta | 1.70e-08 | NA | 2.77e-12 |
| 3. B | Q9SU78 | WD-40 repeat-containing protein MSI5 | 1.04e-06 | NA | 1.55e-07 |
| 3. B | P0CS42 | Nuclear distribution protein PAC1 | 5.15e-12 | NA | 1.18e-14 |
| 3. B | B4KTK4 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 3.53e-12 | NA | 2.35e-06 |
| 3. B | Q920M5 | Coronin-6 | 6.09e-04 | NA | 1.33e-08 |
| 3. B | Q9JHB4 | WD repeat-containing protein 31 | 3.18e-06 | NA | 1.74e-05 |
| 3. B | Q54S59 | WD repeat-containing protein 61 homolog | 4.75e-06 | NA | 1.27e-04 |
| 3. B | Q5NVD0 | U4/U6 small nuclear ribonucleoprotein Prp4 | 3.77e-11 | NA | 3.46e-14 |
| 3. B | Q9DAJ4 | WD repeat domain-containing protein 83 | 1.75e-07 | NA | 1.50e-06 |
| 3. B | Q05946 | U3 small nucleolar RNA-associated protein 13 | 1.01e-06 | NA | 3.67e-05 |
| 3. B | O94319 | Protein transport protein sec13 | 3.56e-08 | NA | 0.008 |
| 3. B | A0A1P8AW69 | Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 | 1.49e-04 | NA | 1.00e-11 |
| 3. B | Q4WTL0 | Probable cytosolic iron-sulfur protein assembly protein 1 | 9.83e-05 | NA | 0.023 |
| 3. B | P93471 | E3 ubiquitin-protein ligase COP1 | 3.49e-06 | NA | 6.52e-08 |
| 3. B | Q6CBI8 | Probable cytosolic iron-sulfur protein assembly protein 1 | 8.45e-11 | NA | 8.73e-09 |
| 3. B | Q12523 | WD repeat-containing protein YPL247C | 8.50e-05 | NA | 0.011 |
| 3. B | Q803D2 | Lissencephaly-1 homolog B | 6.77e-13 | NA | 2.23e-15 |
| 3. B | Q9UNX4 | WD repeat-containing protein 3 | 2.25e-07 | NA | 4.32e-09 |
| 3. B | Q54WA3 | Peroxisomal targeting signal 2 receptor | 1.21e-14 | NA | 3.49e-24 |
| 3. B | Q921E6 | Polycomb protein EED | 5.43e-05 | NA | 0.030 |
| 3. B | Q9AUR8 | Coatomer subunit alpha-1 | 1.91e-08 | NA | 1.51e-10 |
| 3. B | A6H603 | NACHT domain- and WD repeat-containing protein 1 | 1.09e-05 | NA | 1.02e-04 |
| 3. B | Q8JZX3 | POC1 centriolar protein homolog A | 6.13e-05 | NA | 2.69e-09 |
| 3. B | Q9QXL1 | Kinesin-like protein KIF21B | 1.40e-02 | NA | 0.006 |
| 3. B | Q09589 | Protein HIRA | 6.88e-04 | NA | 8.06e-05 |
| 3. B | Q6ED65 | Echinoderm microtubule-associated protein-like 5 | 4.94e-03 | NA | 2.64e-04 |
| 3. B | P40968 | Pre-mRNA-processing factor 17 | 2.00e-06 | NA | 5.08e-07 |
| 3. B | Q12024 | Ribosome biogenesis protein YTM1 | 7.58e-05 | NA | 0.041 |
| 3. B | A8PD13 | Ribosome biogenesis protein YTM1 | 1.63e-05 | NA | 0.003 |
| 3. B | Q8NBT0 | POC1 centriolar protein homolog A | 2.20e-05 | NA | 5.39e-09 |
| 3. B | O24076 | Guanine nucleotide-binding protein subunit beta-like protein | 1.52e-11 | NA | 4.44e-08 |
| 3. B | Q75A30 | Protein transport protein SEC31 | 2.37e-04 | NA | 1.65e-05 |
| 3. B | Q5ZKH3 | Polycomb protein EED | 8.78e-05 | NA | 0.029 |
| 3. B | Q9USL1 | Uncharacterized WD repeat-containing protein C18B5.10c | 2.11e-07 | NA | 0.001 |
| 3. B | Q3B7M6 | Protein NEDD1 | 2.34e-05 | NA | 0.006 |
| 3. B | Q3U3T8 | WD repeat-containing protein 62 | 1.46e-06 | NA | 5.42e-04 |
| 3. B | Q4R8E7 | Dynein assembly factor with WDR repeat domains 1 | 2.25e-05 | NA | 5.97e-18 |
| 3. B | Q9WUM4 | Coronin-1C | 1.54e-03 | NA | 4.99e-08 |
| 3. B | P17343 | Guanine nucleotide-binding protein subunit beta-1 | 2.35e-12 | NA | 4.21e-06 |
| 3. B | Q3SWX8 | Histone-binding protein RBBP7 | 7.79e-07 | NA | 8.00e-11 |
| 3. B | Q8C570 | mRNA export factor | 1.21e-05 | NA | 7.35e-07 |
| 3. B | F1M5N7 | Kinesin-like protein KIF21B | 1.82e-02 | NA | 0.007 |
| 3. B | F6ZT52 | POC1 centriolar protein homolog B | 1.30e-04 | NA | 1.44e-11 |
| 3. B | Q9XF57 | Peroxisome biogenesis protein 7 | 2.80e-14 | NA | 5.52e-15 |
| 3. B | Q9S7I8 | Cell division cycle 20.2, cofactor of APC complex | 3.91e-04 | NA | 5.62e-11 |
| 3. B | Q76B40 | WD40 repeat-containing protein SMU1 | 2.95e-06 | NA | 1.71e-07 |
| 3. B | Q9BRP4 | Proteasomal ATPase-associated factor 1 | 1.52e-05 | NA | 3.59e-08 |
| 3. B | Q9LJR3 | Protein SPA1-RELATED 3 | 7.88e-04 | NA | 4.71e-05 |
| 3. B | Q8C0J2 | Autophagy-related protein 16-1 | 8.78e-04 | NA | 2.26e-04 |
| 3. B | Q5B4R1 | Ribosome biogenesis protein ytm1 | 3.38e-04 | NA | 2.68e-04 |
| 3. B | Q0V8J1 | WD repeat and SOCS box-containing protein 2 | 3.75e-04 | NA | 6.63e-08 |
| 3. B | Q9VZF4 | F-box/WD repeat-containing protein 7 | 1.26e-02 | NA | 1.51e-16 |
| 3. B | Q3UPL0 | Protein transport protein Sec31A | 1.13e-03 | NA | 1.62e-05 |
| 3. B | A2AHJ4 | Bromodomain and WD repeat-containing protein 3 | 3.43e-02 | NA | 1.23e-09 |
| 3. B | B7FNU7 | Lissencephaly-1 homolog | 7.54e-12 | NA | 6.71e-10 |
| 3. B | Q566T0 | Polycomb protein eed | 1.66e-04 | NA | 0.024 |
| 3. B | B4JW81 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 2.32e-12 | NA | 3.65e-06 |
| 3. B | B3NSK1 | WD repeat-containing protein 48 homolog | 3.47e-03 | NA | 2.83e-04 |
| 3. B | Q04225 | Ribosome assembly protein RRB1 | 8.40e-05 | NA | 3.93e-07 |
| 3. B | Q7ZVF0 | POC1 centriolar protein homolog A | 2.36e-05 | NA | 1.11e-08 |
| 3. B | Q8H0T9 | Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4 | 4.72e-07 | NA | 1.58e-11 |
| 3. B | Q6BVZ3 | Polyadenylation factor subunit 2 | 1.10e-05 | NA | 8.82e-09 |
| 3. B | Q55E58 | Probable serine/threonine-protein kinase pats1 | NA | NA | 0.046 |
| 3. B | B6QC56 | Nuclear distribution protein nudF 1 | 5.43e-11 | NA | 1.01e-07 |
| 3. B | Q9W7I5 | Histone-binding protein RBBP4 | 1.73e-06 | NA | 1.54e-09 |
| 3. B | C4YPI7 | Nuclear distribution protein PAC1 | 5.69e-07 | NA | 2.09e-06 |
| 3. B | Q4V7Y7 | Katanin p80 WD40 repeat-containing subunit B1 | 5.26e-04 | NA | 1.29e-12 |
| 3. B | A0A1W5T363 | WD40 repeat protein poxJ | NA | NA | 4.49e-04 |
| 3. B | Q6NQ88 | Protein DAMAGED DNA-BINDING 2 | 7.48e-05 | NA | 6.69e-04 |
| 3. B | Q6ZJX0 | Polycomb group protein FIE1 | 3.30e-06 | NA | 2.33e-06 |
| 3. B | A8XZJ9 | Lissencephaly-1 homolog | 8.77e-08 | NA | 1.82e-08 |
| 3. B | B4HND9 | WD repeat-containing protein 48 homolog | 2.73e-03 | NA | 5.03e-05 |
| 3. B | Q5GIS3 | Guanine nucleotide-binding protein subunit beta | 2.33e-12 | NA | 2.46e-07 |
| 3. B | D3BUN1 | Lissencephaly-1 homolog | 4.51e-13 | NA | 9.69e-11 |
| 3. B | Q8BHJ5 | F-box-like/WD repeat-containing protein TBL1XR1 | 4.59e-07 | NA | 7.03e-25 |
| 3. B | Q922B6 | E3 ubiquitin-protein ligase TRAF7 | 2.55e-07 | NA | 9.55e-06 |
| 3. B | Q4ICM0 | Nuclear distribution protein PAC1 | 1.38e-08 | NA | 2.57e-11 |
| 3. B | Q0D0X6 | Nuclear distribution protein nudF | 1.96e-11 | NA | 7.28e-07 |
| 3. B | A3GFK8 | Protein transport protein SEC31 | 4.44e-03 | NA | 3.19e-07 |
| 3. B | B2AEZ5 | Nuclear distribution protein PAC1-1 | 3.10e-08 | NA | 8.29e-14 |
| 3. B | Q9P783 | Ribosome assembly protein rrb1 | 5.25e-05 | NA | 3.96e-13 |
| 3. B | Q7ZWF0 | mRNA export factor | 9.87e-06 | NA | 4.85e-06 |
| 3. B | Q9FNZ1 | Zinc finger CCCH domain-containing protein 63 | 7.54e-04 | NA | 1.44e-07 |
| 3. B | Q6DIF4 | WD repeat-containing protein 1 | 0.00e+00 | NA | 0.039 |
| 3. B | P62873 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 1.48e-12 | NA | 3.79e-06 |
| 3. B | Q9NZJ0 | Denticleless protein homolog | 8.40e-05 | NA | 8.12e-05 |
| 3. B | Q99LC2 | Cleavage stimulation factor subunit 1 | 4.44e-09 | NA | 5.79e-04 |
| 3. B | A5DST9 | Ribosome biogenesis protein YTM1 | 1.26e-04 | NA | 0.003 |
| 3. B | P31146 | Coronin-1A | 1.70e-03 | NA | 8.95e-07 |
| 3. B | A0A1L8HX76 | WD repeat-containing protein 18 | 1.67e-04 | NA | 0.005 |
| 3. B | Q9BR76 | Coronin-1B | 3.01e-03 | NA | 6.29e-08 |
| 3. B | Q8CFD5 | DNA excision repair protein ERCC-8 | 8.31e-10 | NA | 1.26e-04 |
| 3. B | Q6ZD63 | Chromatin assembly factor 1 subunit FAS2 homolog | 3.14e-07 | NA | 0.036 |
| 3. B | O35353 | Guanine nucleotide-binding protein subunit beta-4 | 2.17e-12 | NA | 3.26e-07 |
| 3. B | Q5FVN8 | WD repeat, SAM and U-box domain-containing protein 1 | 1.90e-04 | NA | 4.38e-05 |
| 3. B | B4GIJ0 | WD repeat-containing protein 48 homolog | 2.99e-03 | NA | 9.44e-05 |
| 3. B | Q6QEF8 | Coronin-6 | 3.85e-03 | NA | 1.69e-09 |
| 3. B | B0XQ15 | Probable cytosolic iron-sulfur protein assembly protein 1 | 1.25e-04 | NA | 0.023 |
| 3. B | Q54SF9 | Myosin heavy chain kinase D | 5.12e-03 | NA | 2.07e-04 |
| 3. B | G0SA60 | Protein transport protein SEC13 | 1.09e-07 | NA | 2.76e-06 |
| 3. B | Q2UG43 | Protein transport protein sec13 | 8.15e-08 | NA | 3.06e-06 |
| 3. B | G5EES6 | Ubiquitin fusion degradation protein 3 homolog | 2.00e-03 | NA | 3.69e-04 |
| 3. B | Q4I7L0 | Histone acetyltransferase type B subunit 2 | 1.37e-09 | NA | 1.66e-14 |
| 3. B | Q291L9 | Lissencephaly-1 homolog | 7.08e-13 | NA | 1.64e-18 |
| 3. B | P49026 | Guanine nucleotide-binding protein subunit beta-like protein | 1.42e-11 | NA | 1.30e-06 |
| 3. B | Q5BLX8 | WD repeat domain-containing protein 83 | 1.58e-07 | NA | 1.08e-06 |
| 3. B | Q5RF51 | U5 small nuclear ribonucleoprotein 40 kDa protein | 1.05e-06 | NA | 6.05e-11 |
| 3. B | P62871 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 1.48e-12 | NA | 3.79e-06 |
| 3. B | Q3Y8L7 | Dynein assembly factor with WDR repeat domains 1 | 2.84e-05 | NA | 1.28e-16 |
| 3. B | Q5F3D7 | U3 small nucleolar RNA-associated protein 15 homolog | 1.04e-03 | NA | 1.69e-07 |
| 3. B | Q68FJ6 | p21-activated protein kinase-interacting protein 1-like | 7.18e-09 | NA | 1.86e-04 |
| 3. B | Q6DJD8 | Coronin-2B | 7.67e-04 | NA | 1.18e-08 |
| 3. B | P63004 | Platelet-activating factor acetylhydrolase IB subunit alpha | 7.64e-09 | NA | 3.03e-16 |
| 3. B | Q6VNB8 | WD repeat and FYVE domain-containing protein 3 | NA | NA | 0.012 |
| 3. B | Q10990 | Cell division cycle protein cdt2 | 7.28e-04 | NA | 0.001 |
| 3. B | Q8L3Z8 | Protein FIZZY-RELATED 2 | 7.96e-05 | NA | 8.06e-11 |
| 3. B | G5EEG7 | Smu-1 suppressor of mec-8 and unc-52 protein | 3.59e-06 | NA | 3.55e-09 |
| 3. B | O42248 | Guanine nucleotide-binding protein subunit beta-2-like 1 | 2.08e-10 | NA | 9.33e-06 |
| 3. B | Q3MHL3 | Histone-binding protein RBBP4 | 1.53e-06 | NA | 1.39e-09 |
| 3. B | G0SEA3 | mRNA export factor GLE2 | 7.68e-08 | NA | 7.22e-06 |
| 3. B | Q2GT28 | Nuclear distribution protein PAC1-2 | 1.95e-11 | NA | 7.08e-09 |
| 3. B | Q8MY12 | Myosin heavy chain kinase C | 4.07e-03 | NA | 1.89e-07 |
| 3. B | Q5XGI5 | WD repeat domain-containing protein 83 | 1.87e-07 | NA | 6.87e-11 |
| 3. B | Q2KIG2 | WD repeat-containing protein 5 | 1.22e-05 | NA | 3.50e-14 |
| 3. B | P97499 | Telomerase protein component 1 | 2.28e-06 | NA | 8.91e-07 |
| 3. B | Q53HC9 | EARP and GARP complex-interacting protein 1 | 4.49e-10 | NA | 0.005 |
| 3. B | Q2HJ56 | Periodic tryptophan protein 1 homolog | 6.93e-05 | NA | 7.08e-06 |
| 3. B | Q94BR4 | Pre-mRNA-processing factor 19 homolog 1 | 4.71e-06 | NA | 2.58e-05 |
| 3. B | A7TMF9 | Ribosome biogenesis protein YTM1 | 8.50e-05 | NA | 0.023 |
| 3. B | P62880 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 | 2.56e-12 | NA | 3.47e-07 |
| 3. B | Q21624 | Coronin-like protein cor-1 | 3.28e-03 | NA | 4.28e-04 |
| 3. B | Q9LV28 | Receptor for activated C kinase 1C | 1.60e-11 | NA | 1.62e-05 |
| 3. B | Q92828 | Coronin-2A | 7.42e-03 | NA | 5.33e-04 |
| 3. B | B4QB64 | WD repeat-containing protein 48 homolog | 2.59e-03 | NA | 4.99e-05 |
| 3. B | Q3MV14 | Protein DECREASED SIZE EXCLUSION LIMIT 1 | 1.76e-04 | NA | 0.001 |
| 3. B | Q9BRX9 | WD repeat domain-containing protein 83 | 1.98e-07 | NA | 2.63e-06 |
| 3. B | B5X3C4 | Lissencephaly-1 homolog B | 6.99e-09 | NA | 5.42e-15 |
| 3. B | Q6NRT3 | WD40 repeat-containing protein SMU1 | 2.12e-06 | NA | 2.27e-07 |
| 3. B | Q9WVA3 | Mitotic checkpoint protein BUB3 | 2.76e-09 | NA | 4.92e-04 |
| 3. B | Q2UPI0 | Probable cytosolic iron-sulfur protein assembly protein 1 | 8.56e-10 | NA | 5.10e-04 |
| 3. B | O43818 | U3 small nucleolar RNA-interacting protein 2 | 2.32e-04 | NA | 4.42e-04 |
| 3. B | P39984 | Histone acetyltransferase type B subunit 2 | 6.43e-08 | NA | 2.00e-10 |
| 3. B | Q5RB07 | WD repeat-containing protein 6 | 1.33e-05 | NA | 0.027 |
| 3. B | Q96JK2 | DDB1- and CUL4-associated factor 5 | 2.00e-03 | NA | 0.001 |
| 3. B | B8M0Q1 | Nuclear distribution protein nudF | 6.26e-11 | NA | 2.03e-07 |
| 3. B | Q4WTC4 | Protein hir1 | 2.19e-04 | NA | 0.018 |
| 3. B | O76071 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 | 7.12e-11 | NA | 3.01e-08 |
| 3. B | Q10051 | Pre-mRNA-processing factor 19 | 2.79e-06 | NA | 5.46e-04 |
| 3. B | A7RWD2 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog | 6.94e-12 | NA | 1.56e-08 |
| 3. B | Q6L4F8 | Guanine nucleotide-binding protein subunit beta-like protein B | 4.88e-10 | NA | 1.62e-04 |
| 3. B | Q9I8G9 | Histone-binding protein RBBP7 | 3.09e-06 | NA | 8.47e-11 |
| 3. B | Q2KJJ5 | Transducin beta-like protein 3 | 5.91e-07 | NA | 1.63e-13 |
| 3. B | Q10272 | Pre-rRNA-processing protein crb3/ipi3 | 7.12e-04 | NA | 0.023 |
| 3. B | Q54D08 | Protein LST8 homolog | 3.46e-08 | NA | 4.35e-06 |
| 3. B | Q9LF27 | Ribosome biogenesis protein WDR12 homolog | 3.83e-04 | NA | 0.012 |
| 3. B | O74340 | Protein sof1 | 2.84e-05 | NA | 1.10e-07 |
| 3. B | Q2KID6 | Pleiotropic regulator 1 | 6.73e-04 | NA | 1.63e-11 |
| 3. B | C5PFX0 | Nuclear distribution protein PAC1 | 1.87e-10 | NA | 3.65e-07 |
| 3. B | O14435 | Guanine nucleotide-binding protein subunit beta | 7.90e-13 | NA | 3.85e-10 |
| 3. B | P38123 | COMPASS component SWD3 | 1.28e-09 | NA | 8.56e-05 |
| 3. B | Q99M63 | WD40 repeat-containing protein SMU1 | 3.42e-06 | NA | 1.98e-07 |
| 3. B | Q7KWL3 | DDB1- and CUL4-associated factor 13 | 3.16e-05 | NA | 8.27e-07 |
| 3. B | Q6NX08 | Ribosome biogenesis protein wdr12 | 5.36e-05 | NA | 1.43e-07 |
| 3. B | Q9BVA0 | Katanin p80 WD40 repeat-containing subunit B1 | 1.57e-03 | NA | 8.21e-12 |
| 3. B | P87141 | Target of rapamycin complex 1 subunit mip1 | 2.54e-05 | NA | 8.36e-04 |
| 3. B | O43660 | Pleiotropic regulator 1 | 1.57e-03 | NA | 1.64e-12 |
| 3. B | C4YN69 | Restriction of telomere capping protein 1 | 1.07e-02 | NA | 0.009 |
| 3. B | Q0UNA9 | Protein transport protein SEC13 | 2.72e-07 | NA | 4.96e-06 |
| 3. B | B3S4I5 | Lissencephaly-1 homolog | 7.73e-13 | NA | 3.50e-17 |
| 3. B | Q4P9P9 | Nuclear distribution protein PAC1 | 5.96e-12 | NA | 5.90e-09 |
| 3. B | B4LQ21 | Lissencephaly-1 homolog | 8.29e-13 | NA | 1.19e-18 |
| 3. B | P25387 | Guanine nucleotide-binding protein subunit beta-like protein | 2.50e-11 | NA | 8.60e-04 |
| 3. B | Q8VZY7 | Polycomb group protein FIE1 | 1.09e-04 | NA | 1.81e-05 |
| 3. B | Q9FKR9 | Zinc finger CCCH domain-containing protein 59 | 4.00e-03 | NA | 0.009 |
| 3. B | Q9D0N7 | Chromatin assembly factor 1 subunit B | 1.74e-05 | NA | 4.87e-05 |
| 3. B | Q9UUG8 | Transcriptional repressor tup12 | 5.46e-04 | NA | 3.43e-09 |
| 3. B | B4JPT9 | Ribosome biogenesis protein WDR12 homolog | 1.16e-04 | NA | 5.53e-05 |
| 3. B | Q25306 | Guanine nucleotide-binding protein subunit beta-like protein | 3.17e-10 | NA | 1.71e-08 |
| 3. B | P53621 | Coatomer subunit alpha | 4.51e-09 | NA | 1.28e-09 |
| 3. B | Q8BQM8 | Echinoderm microtubule-associated protein-like 5 | 1.55e-04 | NA | 2.87e-04 |
| 3. B | B4MFM2 | WD repeat-containing protein 48 homolog | 8.88e-04 | NA | 4.85e-04 |
| 3. B | Q9Z2Q1 | Protein transport protein Sec31A | 5.70e-03 | NA | 1.79e-05 |
| 3. B | Q6P5M2 | WD repeat-containing protein 61 | 1.04e-10 | NA | 1.26e-14 |
| 3. B | A5DXE2 | Protein transport protein SEC13 | 1.14e-07 | NA | 3.47e-04 |
| 3. B | Q552R1 | DDB1- and CUL4-associated factor 7 homolog | 3.22e-09 | NA | 0.008 |
| 3. B | Q9VU65 | POC1 centriolar protein homolog | 1.12e-07 | NA | 2.67e-10 |
| 3. B | Q9USN3 | Probable U3 small nucleolar RNA-associated protein 13 | 8.46e-07 | NA | 1.81e-10 |
| 3. B | Q32SG6 | Protein HIRA | 8.99e-04 | NA | 6.41e-08 |
| 3. B | Q91854 | Beta-TrCP | 2.98e-05 | NA | 2.74e-16 |
| 3. B | P78798 | Peroxisomal targeting signal 2 receptor | 1.04e-13 | NA | 3.57e-08 |
| 3. B | Q7ZVL2 | GATOR complex protein WDR24 | 5.69e-04 | NA | 6.86e-10 |
| 3. B | B5X212 | Probable cytosolic iron-sulfur protein assembly protein ciao1-B | 3.09e-11 | NA | 8.86e-12 |
| 3. B | Q6P4J8 | WD40 repeat-containing protein SMU1 | 3.07e-06 | NA | 7.65e-07 |
| 3. B | Q24338 | Polycomb protein esc | 4.91e-05 | NA | 1.96e-04 |
| 3. B | Q74ZN0 | Protein HIR1 | 2.91e-05 | NA | 0.018 |
| 3. B | Q9ZUN8 | Protein HEAT STRESS TOLERANT DWD 1 | 1.50e-04 | NA | 4.18e-07 |
| 3. B | A3LQ86 | Ribosome biogenesis protein YTM1 | 7.87e-05 | NA | 0.006 |
| 3. B | Q15269 | Periodic tryptophan protein 2 homolog | 8.61e-08 | NA | 3.04e-06 |
| 3. B | Q54S79 | WD repeat-containing protein 3 homolog | 8.04e-08 | NA | 2.61e-11 |
| 3. B | Q99KN2 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 | 5.99e-11 | NA | 2.53e-09 |
| 3. B | Q54PE0 | Periodic tryptophan protein 2 homolog | 8.84e-08 | NA | 1.17e-06 |
| 3. B | Q15751 | Probable E3 ubiquitin-protein ligase HERC1 | NA | NA | 0.005 |
| 3. B | Q04491 | Protein transport protein SEC13 | 9.21e-08 | NA | 8.18e-07 |
| 3. B | Q9AYE4 | Target of rapamycin complex subunit LST8 | 5.45e-05 | NA | 4.00e-04 |
| 3. B | B4HSL3 | Lissencephaly-1 homolog | 9.22e-13 | NA | 7.09e-17 |
| 3. B | Q5F3X8 | Protein transport protein Sec31A | 6.55e-04 | NA | 5.98e-06 |
| 3. B | Q803X4 | DDB1- and CUL4-associated factor 13 | 2.31e-04 | NA | 0.016 |
| 3. B | P63243 | Receptor of activated protein C kinase 1 | 1.97e-10 | NA | 2.25e-06 |
| 3. B | Q09855 | F-box/WD repeat-containing protein pof11 | 3.01e-05 | NA | 7.91e-12 |
| 3. B | O13615 | Pre-mRNA-splicing factor prp5 | 8.43e-06 | NA | 3.58e-10 |
| 3. B | Q9FUY2 | Transcriptional corepressor LEUNIG | 1.01e-04 | NA | 5.27e-05 |
| 3. B | A6ZYM0 | Probable cytosolic iron-sulfur protein assembly protein 1 | 4.42e-10 | NA | 4.29e-11 |
| 3. B | A3LVM1 | Probable cytosolic iron-sulfur protein assembly protein 1 | 4.28e-10 | NA | 5.63e-06 |
| 3. B | Q16576 | Histone-binding protein RBBP7 | 2.58e-07 | NA | 8.97e-11 |
| 3. B | Q60584 | F-box/WD repeat-containing protein 2 | 6.45e-04 | NA | 1.72e-06 |
| 3. B | P42841 | Polyadenylation factor subunit 2 | 8.88e-05 | NA | 1.26e-06 |
| 3. B | Q00659 | Probable E3 ubiquitin ligase complex SCF subunit sconB | 1.97e-03 | NA | 4.02e-12 |
| 3. B | D4AZ50 | Nuclear distribution protein PAC1 | 3.90e-11 | NA | 4.33e-07 |
| 3. B | Q3KQ62 | WD repeat domain-containing protein 83 | 8.13e-11 | NA | 1.17e-06 |
| 3. B | Q9ERF3 | WD repeat-containing protein 61 | 7.29e-11 | NA | 2.87e-04 |
| 3. B | Q5R650 | WD repeat-containing protein 37 | 4.42e-05 | NA | 8.90e-10 |
| 3. B | B4P116 | Ribosome biogenesis protein WDR12 homolog | 1.83e-04 | NA | 3.32e-04 |
| 3. B | Q6NVM2 | Katanin p80 WD40 repeat-containing subunit B1 | 1.70e-04 | NA | 5.04e-12 |
| 3. B | Q5M7T1 | Probable cytosolic iron-sulfur protein assembly protein CIAO1 | 6.06e-11 | NA | 2.35e-09 |
| 3. B | Q5BDJ5 | Probable cytosolic iron-sulfur protein assembly protein 1 | 8.76e-10 | NA | 7.86e-06 |
| 3. B | Q7QJ33 | Ribosome biogenesis protein WDR12 homolog | 1.79e-04 | NA | 6.64e-05 |
| 3. B | Q9BQ67 | Glutamate-rich WD repeat-containing protein 1 | 1.37e-05 | NA | 2.33e-12 |
| 3. B | O22468 | WD-40 repeat-containing protein MSI2 | 2.51e-07 | NA | 8.30e-13 |
| 3. B | Q54ED4 | Glutamate-rich WD repeat-containing protein 1 | 5.28e-06 | NA | 1.77e-13 |
| 3. B | P59328 | WD repeat and HMG-box DNA-binding protein 1 | 9.16e-04 | NA | 0.004 |
| 3. B | O42249 | Guanine nucleotide-binding protein subunit beta-2-like 1 | 2.12e-10 | NA | 2.96e-06 |
| 3. B | Q9C0J8 | pre-mRNA 3' end processing protein WDR33 | 4.48e-03 | NA | 7.33e-08 |
| 3. B | Q6CMA2 | Probable cytosolic iron-sulfur protein assembly protein 1 | 7.37e-11 | NA | 4.61e-09 |
| 3. B | D3TLL6 | Lissencephaly-1 homolog | 1.68e-12 | NA | 7.74e-15 |
| 3. B | Q6ZJW8 | Polycomb group protein FIE1 | 2.21e-04 | NA | 2.85e-06 |
| 3. B | A1CUD6 | Nuclear distribution protein nudF 1 | 4.73e-11 | NA | 1.46e-08 |
| 3. B | Q9FFA7 | WD repeat-containing protein RUP2 | 5.57e-07 | NA | 3.73e-04 |
| 3. B | O94967 | WD repeat-containing protein 47 | 2.33e-07 | NA | 3.11e-07 |
| 3. B | Q15291 | Retinoblastoma-binding protein 5 | 7.84e-04 | NA | 0.001 |
| 3. B | Q5AAU3 | Protein transport protein SEC31 | 7.01e-05 | NA | 6.61e-06 |
| 3. B | Q9CWU9 | Nucleoporin Nup37 | 1.94e-07 | NA | 0.002 |
| 3. B | Q2TBP4 | POC1 centriolar protein homolog A | 3.50e-05 | NA | 2.36e-09 |
| 3. B | Q6PH57 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 2.63e-12 | NA | 1.01e-06 |
| 3. B | P20053 | U4/U6 small nuclear ribonucleoprotein PRP4 | 7.34e-08 | NA | 1.03e-08 |
| 3. B | A2QBZ0 | Protein transport protein sec31 | 9.09e-04 | NA | 1.13e-04 |
| 3. B | Q9Y3F4 | Serine-threonine kinase receptor-associated protein | 1.36e-05 | NA | 0.003 |
| 3. B | Q5SRY7 | F-box/WD repeat-containing protein 11 | 1.39e-04 | NA | 1.86e-16 |
| 3. B | Q4V8C4 | WD repeat-containing protein 5B | 1.21e-07 | NA | 5.63e-13 |
| 3. B | Q96FK6 | WD repeat-containing protein 89 | 1.65e-04 | NA | 0.041 |
| 3. B | G0SFB5 | Ribosome biogenesis protein YTM1 | 2.46e-04 | NA | 7.92e-04 |
| 3. B | Q9VPR4 | Protein Notchless | 2.99e-05 | NA | 1.21e-21 |
| 3. B | P29387 | Guanine nucleotide-binding protein subunit beta-4 | 2.16e-12 | NA | 2.78e-07 |
| 3. B | P69103 | Guanine nucleotide-binding protein subunit beta-like protein | 7.85e-11 | NA | 1.10e-07 |
| 3. B | Q55CT5 | Protein transport protein SEC31 | 5.42e-03 | NA | 4.76e-05 |
| 3. B | B7PS00 | Lissencephaly-1 homolog | 4.11e-13 | NA | 2.21e-14 |
| 3. B | Q7ZUV2 | Katanin p80 WD40 repeat-containing subunit B1 | 5.33e-04 | NA | 2.45e-12 |
| 3. B | Q4PSE4 | Cell division cycle 20.4, cofactor of APC complex | 3.44e-04 | NA | 9.27e-10 |
| 3. B | B4QFZ8 | Probable cytosolic iron-sulfur protein assembly protein Ciao1 | 5.51e-12 | NA | 6.98e-07 |
| 3. B | A7TLU2 | Probable cytosolic iron-sulfur protein assembly protein 1 | 3.53e-10 | NA | 4.06e-05 |
| 3. B | P16520 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 | 2.80e-12 | NA | 6.17e-09 |
| 3. B | Q93794 | F-box/WD repeat-containing protein sel-10 | 3.00e-06 | NA | 2.99e-21 |
| 3. B | Q05BV3 | Echinoderm microtubule-associated protein-like 5 | 4.83e-03 | NA | 0.001 |
| 3. B | P11017 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 | 2.54e-12 | NA | 3.47e-07 |
| 3. B | Q8NAA4 | Protein Atg16l2 | 5.59e-04 | NA | 0.001 |
| 3. B | Q5AEF2 | Protein transport protein SEC13 | 8.45e-08 | NA | 6.38e-04 |
| 3. B | Q920J3 | Coronin-6 | 1.44e-03 | NA | 2.05e-08 |
| 3. B | B5X9P2 | Probable cytosolic iron-sulfur protein assembly protein ciao1-A | 3.30e-11 | NA | 6.26e-12 |
| 3. B | O15736 | Protein tipD | 1.98e-05 | NA | 2.18e-06 |
| 3. B | Q54R58 | Probable tyrosine-protein kinase DDB_G0283397 | 2.53e-02 | NA | 0.040 |
| 3. B | Q9JJA4 | Ribosome biogenesis protein WDR12 | 3.08e-05 | NA | 3.28e-07 |
| 3. B | Q00664 | Nuclear distribution protein nudF | 1.17e-11 | NA | 4.95e-06 |
| 3. B | Q4RJN5 | Lissencephaly-1 homolog | 7.91e-09 | NA | 2.11e-15 |
| 3. B | O45040 | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | 2.09e-12 | NA | 3.03e-06 |