Results | PROST

Summary

Q8IZU2

Homolog: Q9ZU34.
Function: Actin-interacting protein 1-1.

Statistics

Total GO Annotation: 894
Unique PROST Go: 210
Unique BLAST Go: 621

Total Homologs: 1352
Unique PROST Homologs: 102
Unique BLAST Homologs: 1222

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q9ZU34 (Actin-interacting protein 1-1) with a FATCAT P-Value: 0.0 and RMSD of 3.43 angstrom. The sequence alignment identity is 13.0%.
Structural alignment shown in left. Query protein Q8IZU2 colored as red in alignment, homolog Q9ZU34 colored as blue. Query protein Q8IZU2 is also shown in right top, homolog Q9ZU34 showed in right bottom. They are colored based on secondary structures.

  Q8IZU2 MAWMTYISNWFEQDDWYEGLQRANMSQV-----------RQVGLLAAGCQPWNKDVCAASGDRFAYCATLAIYIYQLDHRYNEFKLHAIMSEHKKTITAI 89
  Q9ZU34 ------------------------MAKLLETFPCVPSTERGRGILISG------D---SKSDTILYCNGRSVFIRSL-RQLQDVQVY---GEHGYAVTVA 63

  Q8IZU2 SWCPH-----NPDLFASGS-----TDNLVIIWNVAEQKVIA-KLDSTKGIPASLSWCWNAEDVVAFVSHRGPLFIWTISGPDSGVIVHKDAHSFLSDICM 178
  Q9ZU34 RYSPNGEWIASADV--SGTVRVWGTHNGFVLKN--EFRVLAGRVD-------DLQWSF---D--------G-LRI-VASG-D-G----K-GKSLVRS--- 129

  Q8IZU2 FRWHTHQKGKVVFGHIDGSLSIFHPGNKNQKHVL----RPESLEGTDEEDPVTALEWDPLST---DYLLVVNLHYG--IRLVDSESLSCITTFNLPSAAA 269
  Q9ZU34 FAWDS---GN-TMGDFDG-----H-----SRRVLSCAFKP-----T---RPFR------IATCGEDFL--VNFYDGPPFKFHSSHREH--SNF------- 190

  Q8IZU2 SVQCLAWVPSAPGM-FIT--GDSQVGVLRIWNVSRTTPIDNL-KL-KKTGFH--CLHVLN-SPPRKK-FSVQSPTKNHYTSSTSEAVPPPTLTQNQAFSL 360
  Q9ZU34 -VNCIRYSPD--GTKFITVSSDKK-GM--IYD-GKTG--DKVGELASEDG-HKGSIYAVSWSPDSKRVLTV-SADK---SAKVWEVAEDGTI-------- 268

  Q8IZU2 PPGHAV--CCFLDGGVGLYDM--GAKKW--DFL--RDLGHVETIFDCKFKPDD---PNLLATASFDGTIK-VWDI-----N--T-LTAVYTSPGNEGVIY 440
  Q9ZU34 --GSVIKTLSFMESG-GAEDMLVGC-LWQNDHLITVSLGGTMSLFSA----DDMDKPPLL----LSGHIKNVTSLAVLGENQKTILSCSY-----DGLI- 350

  Q8IZU2 SLSWAPG-GLNC-----------IAGGT-SR---NG--AFIWNV---QKGKIIQRFNEH---GTNGI-FCIAWSHKDSKRIATC--SSD-GFCIIRTIDG 512
  Q9ZU34 -VKWLKGVGYSCKLQMKDTKIKRLA-ATESSIFISGYDNMVWRIPLTDNG---YGAAEHVDIGHQPLDISIA---VDSPE-ATALVSFDSGVVL---LNG 438

  Q8IZU2 -KVLHK----YKHPAAVFGCDWSQNNKDMIATGCEDTNVRVYYVATSSDQPLK---VFSGHTAKVFHVKWSP-LREGILCSGSDDGTVR---IWD-YTQD 599
  Q9ZU34 LNILSKIDLGFAVAASVISPD----GKEAIVGG-QDGKLHIYSV--SGDNNLKEEAVLEKHRGALTVIRYSPDLT--MFASG--DAN-REAVVWDRETKQ 526

  Q8IZU2 ACI-NILNGHTAPVRGLMWNTEIP--YLLISGSWDYTIKVWDTREGTCVDTVY--D---------HGADVYGLT-------CHPSRPFTMASCSRDSTVR 678
  Q9ZU34 VKLNNMLF-HTARINSLAWS---PNNKMVATGSID-----------TCV-IVYEVDKPASSRITARNAHLGGVNAVAFIDDC------TVASSGEDASVR 604

  Q8IZU2 LWSLTALVTPVQINILADRSWEEIIGNTDYAIEPGTPPLLCGKVSRDIRQEIEKLTANSQVKKLRWFSECLSPPGGSDNLWNLVAVIKGQDDSLLPQNYC 778
  Q9ZU34 LWH----IEP-Q---------------------------------------------------------------------------------------- 611

  Q8IZU2 KGIMHLKHLIKFRTSEAQELTTVKMSKFGGGIGVPAKEERLKEAAEIHLRLGQIQRYCELMVELGEWDKALSIAPGVSVKYWKKLMQRRADQLIQEDKDD 878
  Q9ZU34 ---------------------------------------------------------------------------------------------------- 611

  Q8IZU2 VIPYCIAIGDVKKLVHFFMSRGQLKEALLVAQAACEGNMQPLHVSVPKGASYSDDIYKEDFNELLHKVSKELAEWYFQDGRAVLAACCHLAIDNIELAMA 978
  Q9ZU34 ---------------------------------------------------------------------------------------------------- 611

  Q8IZU2 YLIRGNELELAVCVGTVLGESAAPATHYALELLARKCMMISVCFPCVGYSVPFCYVNRNLAADLLLMIPDNELHLIKLCAFYPGCTEEINDLHDKCKLPT 1078
  Q9ZU34 ---------------------------------------------------------------------------------------------------- 611

  Q8IZU2 VEECMQLAETARADDNIFETVKYYLLSQEPEKALPIGISFVKEYISSSDWTLDTIYPVLDLLSYIRTEKLLLHTCTEARNELLILCGYIGALLAIRRQYQ 1178
  Q9ZU34 ---------------------------------------------------------------------------------------------------- 611

  Q8IZU2 SIVPALYEYTSQLLKRREVSVPLKIEYLSEELDAWRACTQSTNRSLEDSPYTPPSDSQRMIYATLLKRLKEESLKGIIGPDYVTGSNLPSHSDIHISCLT 1278
  Q9ZU34 ---------------------------------------------------------------------------------------------------- 611

  Q8IZU2 GLKIQGPVFFLEDGKSAISLNDALMWAKVNPFSPLGTGIRLNPF 1322
  Q9ZU34 -------------------------------------------- 611

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0005737	cytoplasm
1. PB	GO:0005765	lysosomal membrane
1. PB	GO:0061630	ubiquitin protein ligase activity
1. PB	GO:0005524	ATP binding
1. PB	GO:0097730	non-motile cilium
1. PB	GO:0030622	U4atac snRNA binding
1. PB	GO:0005884	actin filament
1. PB	GO:0030126	COPI vesicle coat
1. PB	GO:0035859	Seh1-associated complex
1. PB	GO:0005643	nuclear pore
1. PB	GO:0006886	intracellular protein transport
1. PB	GO:0061512	protein localization to cilium
1. PB	GO:0034719	SMN-Sm protein complex
1. PB	GO:0005080	protein kinase C binding
1. PB	GO:0007634	optokinetic behavior
1. PB	GO:0034718	SMN-Gemin2 complex
1. PB	GO:0032880	regulation of protein localization
1. PB	GO:0006406	mRNA export from nucleus
1. PB	GO:0007219	Notch signaling pathway
1. PB	GO:0035721	intraciliary retrograde transport
1. PB	GO:0016021	integral component of membrane
1. PB	GO:0060271	cilium assembly
1. PB	GO:0031965	nuclear membrane
1. PB	GO:0030991	intraciliary transport particle A
1. PB	GO:0061700	GATOR2 complex
1. PB	GO:2000114	regulation of establishment of cell polarity
1. PB	GO:0097504	Gemini of coiled bodies
1. PB	GO:0005198	structural molecule activity
1. PB	GO:0032008	positive regulation of TOR signaling
1. PB	GO:0005886	plasma membrane
1. PB	GO:0035845	photoreceptor cell outer segment organization
1. PB	GO:0045879	negative regulation of smoothened signaling pathway
1. PB	GO:0032991	protein-containing complex
1. PB	GO:0042073	intraciliary transport
1. PB	GO:0007368	determination of left/right symmetry
1. PB	GO:0005829	cytosol
1. PB	GO:0070986	left/right axis specification
1. PB	GO:1904263	positive regulation of TORC1 signaling
1. PB	GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
1. PB	GO:0015630	microtubule cytoskeleton
1. PB	GO:0006606	protein import into nucleus
1. PB	GO:0030621	U4 snRNA binding
1. PB	GO:0003779	actin binding
1. PB	GO:0032797	SMN complex
1. PB	GO:0051664	nuclear pore localization
1. PB	GO:0000972	transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery
1. PB	GO:0036064	ciliary basal body
1. PB	GO:0043547	positive regulation of GTPase activity
1. PB	GO:1905515	non-motile cilium assembly
1. PB	GO:0034198	cellular response to amino acid starvation
1. PB	GO:0005929	cilium
1. PB	GO:0005930	axoneme
1. PB	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
1. PB	GO:0006895	Golgi to endosome transport
1. PB	GO:0000139	Golgi membrane
1. PB	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
1. PB	GO:0006891	intra-Golgi vesicle-mediated transport
1. PB	GO:0006412	translation
1. PB	GO:2000024	regulation of leaf development
1. PB	GO:0035264	multicellular organism growth
1. PB	GO:0007227	signal transduction downstream of smoothened
1. PB	GO:0030674	protein-macromolecule adaptor activity
1. PB	GO:0031080	nuclear pore outer ring
2. P	GO:0034058	endosomal vesicle fusion
2. P	GO:0060021	roof of mouth development
2. P	GO:0030326	embryonic limb morphogenesis
2. P	GO:0005770	late endosome
2. P	GO:0030716	oocyte fate determination
2. P	GO:0006727	ommochrome biosynthetic process
2. P	GO:0030992	intraciliary transport particle B
2. P	GO:0032456	endocytic recycling
2. P	GO:0035720	intraciliary anterograde transport
2. P	GO:0034398	telomere tethering at nuclear periphery
2. P	GO:0007507	heart development
2. P	GO:0009047	dosage compensation by hyperactivation of X chromosome
2. P	GO:0031122	cytoplasmic microtubule organization
2. P	GO:0031902	late endosome membrane
2. P	GO:0010172	embryonic body morphogenesis
2. P	GO:0007293	germarium-derived egg chamber formation
2. P	GO:0048339	paraxial mesoderm development
2. P	GO:0072006	nephron development
2. P	GO:0048193	Golgi vesicle transport
2. P	GO:0006996	organelle organization
2. P	GO:0008406	gonad development
2. P	GO:0021915	neural tube development
2. P	GO:0031990	mRNA export from nucleus in response to heat stress
2. P	GO:0007032	endosome organization
2. P	GO:0060831	smoothened signaling pathway involved in dorsal/ventral neural tube patterning
2. P	GO:0031084	BLOC-2 complex
2. P	GO:0045019	negative regulation of nitric oxide biosynthetic process
2. P	GO:0045055	regulated exocytosis
2. P	GO:0036372	opsin transport
2. P	GO:0001674	female germ cell nucleus
2. P	GO:0030897	HOPS complex
2. P	GO:0050896	response to stimulus
2. P	GO:0007033	vacuole organization
2. P	GO:0030318	melanocyte differentiation
2. P	GO:0097421	liver regeneration
2. P	GO:0042471	ear morphogenesis
2. P	GO:0042144	vacuole fusion, non-autophagic
2. P	GO:0045907	positive regulation of vasoconstriction
2. P	GO:0060348	bone development
2. P	GO:0030742	GTP-dependent protein binding
2. P	GO:0097541	axonemal basal plate
2. P	GO:0097576	vacuole fusion
2. P	GO:0001841	neural tube formation
2. P	GO:0008333	endosome to lysosome transport
2. P	GO:1902501	lysosomal HOPS complex
2. P	GO:0097500	receptor localization to non-motile cilium
2. P	GO:0021914	negative regulation of smoothened signaling pathway involved in ventral spinal cord patterning
2. P	GO:0000973	posttranscriptional tethering of RNA polymerase II gene DNA at nuclear periphery
2. P	GO:0097352	autophagosome maturation
2. P	GO:2000300	regulation of synaptic vesicle exocytosis
2. P	GO:0048593	camera-type eye morphogenesis
2. P	GO:0006624	vacuolar protein processing
2. P	GO:0008057	eye pigment granule organization
2. P	GO:0043587	tongue morphogenesis
2. P	GO:0009630	gravitropism
2. P	GO:0031409	pigment binding
2. P	GO:0017069	snRNA binding
2. P	GO:0048072	compound eye pigmentation
2. P	GO:0060036	notochord cell vacuolation
2. P	GO:0072657	protein localization to membrane
2. P	GO:0005764	lysosome
2. P	GO:0043291	RAVE complex
2. P	GO:0044611	nuclear pore inner ring
2. P	GO:0031538	negative regulation of anthocyanin metabolic process
2. P	GO:0006728	pteridine biosynthetic process
2. P	GO:0036228	protein localization to nuclear inner membrane
2. P	GO:0016197	endosomal transport
2. P	GO:0140018	regulation of cytoplasmic translational fidelity
2. P	GO:0001947	heart looping
2. P	GO:0009636	response to toxic substance
2. P	GO:0001843	neural tube closure
2. P	GO:0002926	tRNA wobble base 5-methoxycarbonylmethyl-2-thiouridinylation
2. P	GO:0030123	AP-3 adaptor complex
2. P	GO:0000340	RNA 7-methylguanosine cap binding
2. P	GO:0003330	regulation of extracellular matrix constituent secretion
2. P	GO:0043053	dauer entry
2. P	GO:0022008	neurogenesis
2. P	GO:0045494	photoreceptor cell maintenance
2. P	GO:0043010	camera-type eye development
2. P	GO:0097225	sperm midpiece
2. P	GO:0048530	fruit morphogenesis
2. P	GO:0043473	pigmentation
2. P	GO:0060322	head development
2. P	GO:0060971	embryonic heart tube left/right pattern formation
2. P	GO:0005769	early endosome
2. P	GO:0071356	cellular response to tumor necrosis factor
2. P	GO:0005776	autophagosome
2. P	GO:0008589	regulation of smoothened signaling pathway
2. P	GO:0046332	SMAD binding
2. P	GO:0032391	photoreceptor connecting cilium
2. P	GO:0060541	respiratory system development
2. P	GO:0048757	pigment granule maturation
2. P	GO:0035542	regulation of SNARE complex assembly
2. P	GO:0097598	sperm cytoplasmic droplet
2. P	GO:0097228	sperm principal piece
2. P	GO:0006623	protein targeting to vacuole
2. P	GO:0006726	eye pigment biosynthetic process
2. P	GO:2000643	positive regulation of early endosome to late endosome transport
2. P	GO:0090521	glomerular visceral epithelial cell migration
2. P	GO:0097542	ciliary tip
2. P	GO:0007596	blood coagulation
2. P	GO:0044782	cilium organization
2. P	GO:0017056	structural constituent of nuclear pore
2. P	GO:0045880	positive regulation of smoothened signaling pathway
2. P	GO:0006914	autophagy
2. P	GO:0031509	subtelomeric heterochromatin assembly
2. P	GO:0071333	cellular response to glucose stimulus
2. P	GO:0099041	vesicle tethering to Golgi
2. P	GO:0060830	ciliary receptor clustering involved in smoothened signaling pathway
2. P	GO:0005768	endosome
2. P	GO:0050680	negative regulation of epithelial cell proliferation
2. P	GO:0016973	poly(A)+ mRNA export from nucleus
2. P	GO:0061065	regulation of dauer larval development
2. P	GO:0010928	regulation of auxin mediated signaling pathway
2. P	GO:0042733	embryonic digit morphogenesis
2. P	GO:0010008	endosome membrane
2. P	GO:0033263	CORVET complex
2. P	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
2. P	GO:0048568	embryonic organ development
2. P	GO:1902115	regulation of organelle assembly
2. P	GO:0099022	vesicle tethering
2. P	GO:0030619	U1 snRNA binding
2. P	GO:0021522	spinal cord motor neuron differentiation
2. P	GO:0006904	vesicle docking involved in exocytosis
2. P	GO:1900027	regulation of ruffle assembly
2. P	GO:0031901	early endosome membrane
2. P	GO:0055123	digestive system development
2. P	GO:1905705	cellular response to paclitaxel
2. P	GO:0048596	embryonic camera-type eye morphogenesis
2. P	GO:0045324	late endosome to vacuole transport
2. P	GO:0016476	regulation of embryonic cell shape
2. P	GO:0051893	regulation of focal adhesion assembly
2. P	GO:0006622	protein targeting to lysosome
2. P	GO:0048701	embryonic cranial skeleton morphogenesis
2. P	GO:0080178	5-carbamoylmethyl uridine residue modification
2. P	GO:0070647	protein modification by small protein conjugation or removal
2. P	GO:0045184	establishment of protein localization
2. P	GO:0016020	membrane
2. P	GO:0001750	photoreceptor outer segment
2. P	GO:0061909	autophagosome-lysosome fusion
2. P	GO:0001822	kidney development
2. P	GO:0021532	neural tube patterning
2. P	GO:0005802	trans-Golgi network
2. P	GO:1990816	vacuole-mitochondrion membrane contact site
2. P	GO:0061525	hindgut development
2. P	GO:0005160	transforming growth factor beta receptor binding
2. P	GO:1902500	vacuolar HOPS complex
2. P	GO:0045992	negative regulation of embryonic development
2. P	GO:1901998	toxin transport
2. P	GO:1903364	positive regulation of cellular protein catabolic process
2. P	GO:1901555	response to paclitaxel
2. P	GO:0060173	limb development
2. P	GO:0006999	nuclear pore organization
2. P	GO:1904888	cranial skeletal system development
2. P	GO:0016485	protein processing
2. P	GO:0048284	organelle fusion
2. P	GO:0060031	mediolateral intercalation
2. P	GO:1990830	cellular response to leukemia inhibitory factor
2. P	GO:0016236	macroautophagy
2. P	GO:0009953	dorsal/ventral pattern formation
2. P	GO:1990403	embryonic brain development
2. P	GO:0045022	early endosome to late endosome transport
2. P	GO:0030136	clathrin-coated vesicle
2. P	GO:0061066	positive regulation of dauer larval development
2. P	GO:0005085	guanyl-nucleotide exchange factor activity
2. P	GO:0051469	vesicle fusion with vacuole
2. P	GO:0007035	vacuolar acidification
2. P	GO:0060967	negative regulation of gene silencing by RNA
2. P	GO:0010762	regulation of fibroblast migration
2. P	GO:0032185	septin cytoskeleton organization
2. P	GO:0090200	positive regulation of release of cytochrome c from mitochondria
2. P	GO:0009267	cellular response to starvation
2. P	GO:0048278	vesicle docking
2. P	GO:0061053	somite development
2. P	GO:0008544	epidermis development
2. P	GO:0042147	retrograde transport, endosome to Golgi
2. P	GO:1903441	protein localization to ciliary membrane
2. P	GO:0009994	oocyte differentiation
2. P	GO:0072359	circulatory system development
2. P	GO:0061357	positive regulation of Wnt protein secretion
2. P	GO:0007040	lysosome organization
2. P	GO:0009705	plant-type vacuole membrane
2. P	GO:0009787	regulation of abscisic acid-activated signaling pathway
2. P	GO:0010015	root morphogenesis
2. P	GO:0034066	Ric1-Rgp1 guanyl-nucleotide exchange factor complex
2. P	GO:0002093	auditory receptor cell morphogenesis
2. P	GO:0005798	Golgi-associated vesicle
2. P	GO:0005794	Golgi apparatus
2. P	GO:1902774	late endosome to lysosome transport
2. P	GO:0043485	endosome to pigment granule transport
2. P	GO:0031267	small GTPase binding
2. P	GO:1903363	negative regulation of cellular protein catabolic process
2. P	GO:0007034	vacuolar transport
2. P	GO:0007252	I-kappaB phosphorylation
2. P	GO:0061055	myotome development
2. P	GO:0031514	motile cilium
2. P	GO:0140057	vacuole-mitochondria membrane tethering
2. P	GO:0030663	COPI-coated vesicle membrane
2. P	GO:0032418	lysosome localization
2. P	GO:0034629
2. P	GO:0048069	eye pigmentation
2. P	GO:0030990	intraciliary transport particle
2. P	GO:0035050	embryonic heart tube development
2. P	GO:0007224	smoothened signaling pathway
2. P	GO:0045467	R7 cell development
2. P	GO:0030117	membrane coat
2. P	GO:0033588	elongator holoenzyme complex
2. P	GO:1902017	regulation of cilium assembly
2. P	GO:0019905	syntaxin binding
2. P	GO:0031076	embryonic camera-type eye development
3. B	GO:0006336	DNA replication-independent chromatin assembly
3. B	GO:0021540	corpus callosum morphogenesis
3. B	GO:0140496	gamma-tubulin complex binding
3. B	GO:1902510	regulation of apoptotic DNA fragmentation
3. B	GO:0036120	cellular response to platelet-derived growth factor stimulus
3. B	GO:1990147	talin binding
3. B	GO:0090141	positive regulation of mitochondrial fission
3. B	GO:0019226	transmission of nerve impulse
3. B	GO:0000122	negative regulation of transcription by RNA polymerase II
3. B	GO:0000244	spliceosomal tri-snRNP complex assembly
3. B	GO:0005874	microtubule
3. B	GO:0008283	cell population proliferation
3. B	GO:0006368	transcription elongation from RNA polymerase II promoter
3. B	GO:1902610	response to N-phenylthiourea
3. B	GO:1901800	positive regulation of proteasomal protein catabolic process
3. B	GO:0006338	chromatin remodeling
3. B	GO:2000543	positive regulation of gastrulation
3. B	GO:0006325	chromatin organization
3. B	GO:0071353	cellular response to interleukin-4
3. B	GO:1905861	intranuclear rod assembly
3. B	GO:0032796	uropod organization
3. B	GO:0010970	transport along microtubule
3. B	GO:0060307	regulation of ventricular cardiac muscle cell membrane repolarization
3. B	GO:1903673	mitotic cleavage furrow formation
3. B	GO:1905786	positive regulation of anaphase-promoting complex-dependent catabolic process
3. B	GO:2000234	positive regulation of rRNA processing
3. B	GO:0008017	microtubule binding
3. B	GO:0009553	embryo sac development
3. B	GO:0008344	adult locomotory behavior
3. B	GO:0004842	ubiquitin-protein transferase activity
3. B	GO:0120293	dynein axonemal particle
3. B	GO:0005615	extracellular space
3. B	GO:0032956	regulation of actin cytoskeleton organization
3. B	GO:0032420	stereocilium
3. B	GO:0050885	neuromuscular process controlling balance
3. B	GO:0045722	positive regulation of gluconeogenesis
3. B	GO:0005677	chromatin silencing complex
3. B	GO:0005869	dynactin complex
3. B	GO:0006283	transcription-coupled nucleotide-excision repair
3. B	GO:0043224	nuclear SCF ubiquitin ligase complex
3. B	GO:0110136	protein-RNA complex remodeling
3. B	GO:0006342
3. B	GO:0051301	cell division
3. B	GO:0033140	negative regulation of peptidyl-serine phosphorylation of STAT protein
3. B	GO:0006337	nucleosome disassembly
3. B	GO:0016571	histone methylation
3. B	GO:0006335	DNA replication-dependent chromatin assembly
3. B	GO:0005782	peroxisomal matrix
3. B	GO:0016579	protein deubiquitination
3. B	GO:0090148	membrane fission
3. B	GO:0071217	cellular response to external biotic stimulus
3. B	GO:0003735	structural constituent of ribosome
3. B	GO:0017053	transcription repressor complex
3. B	GO:0043025	neuronal cell body
3. B	GO:0010997	anaphase-promoting complex binding
3. B	GO:0000109	nucleotide-excision repair complex
3. B	GO:0061883	clathrin-dependent endocytosis involved in vitellogenesis
3. B	GO:0070840	dynein complex binding
3. B	GO:2001162	positive regulation of histone H3-K79 methylation
3. B	GO:0097428	protein maturation by iron-sulfur cluster transfer
3. B	GO:0019985	translesion synthesis
3. B	GO:1905168	positive regulation of double-strand break repair via homologous recombination
3. B	GO:0039023	pronephric duct morphogenesis
3. B	GO:0005826	actomyosin contractile ring
3. B	GO:0072520	seminiferous tubule development
3. B	GO:0006348
3. B	GO:0009555	pollen development
3. B	GO:0040011	locomotion
3. B	GO:0090594	inflammatory response to wounding
3. B	GO:0090181	regulation of cholesterol metabolic process
3. B	GO:0005671	obsolete Ada2/Gcn5/Ada3 transcription activator complex
3. B	GO:2000393	negative regulation of lamellipodium morphogenesis
3. B	GO:0090114	COPII-coated vesicle budding
3. B	GO:0030836	positive regulation of actin filament depolymerization
3. B	GO:0045138	nematode male tail tip morphogenesis
3. B	GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process
3. B	GO:0050765	negative regulation of phagocytosis
3. B	GO:0051539	4 iron, 4 sulfur cluster binding
3. B	GO:0007015	actin filament organization
3. B	GO:0006367	transcription initiation from RNA polymerase II promoter
3. B	GO:2001137	positive regulation of endocytic recycling
3. B	GO:0006334	nucleosome assembly
3. B	GO:0016477	cell migration
3. B	GO:0061003	positive regulation of dendritic spine morphogenesis
3. B	GO:0010632	regulation of epithelial cell migration
3. B	GO:0017145	stem cell division
3. B	GO:0043521	regulation of myosin II filament disassembly
3. B	GO:0000349	generation of catalytic spliceosome for first transesterification step
3. B	GO:0005819	spindle
3. B	GO:0008611	ether lipid biosynthetic process
3. B	GO:0005053	peroxisome matrix targeting signal-2 binding
3. B	GO:0043130	ubiquitin binding
3. B	GO:0001667	ameboidal-type cell migration
3. B	GO:0031529	ruffle organization
3. B	GO:0010154	fruit development
3. B	GO:0048511	rhythmic process
3. B	GO:0048814	regulation of dendrite morphogenesis
3. B	GO:0071215	cellular response to abscisic acid stimulus
3. B	GO:0031589	cell-substrate adhesion
3. B	GO:0031037	myosin II filament disassembly
3. B	GO:0045638	negative regulation of myeloid cell differentiation
3. B	GO:0000209	protein polyubiquitination
3. B	GO:0005834	heterotrimeric G-protein complex
3. B	GO:1900024	regulation of substrate adhesion-dependent cell spreading
3. B	GO:0030425	dendrite
3. B	GO:0036170	filamentous growth of a population of unicellular organisms in response to starvation
3. B	GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0000375	RNA splicing, via transesterification reactions
3. B	GO:0005634	nucleus
3. B	GO:0009968	negative regulation of signal transduction
3. B	GO:0014909	smooth muscle cell migration
3. B	GO:0000123	histone acetyltransferase complex
3. B	GO:2000217	regulation of invasive growth in response to glucose limitation
3. B	GO:0031682	G-protein gamma-subunit binding
3. B	GO:0048527	lateral root development
3. B	GO:0000118	histone deacetylase complex
3. B	GO:0030515	snoRNA binding
3. B	GO:0005789	endoplasmic reticulum membrane
3. B	GO:0035064	methylated histone binding
3. B	GO:0099139	cheating during chimeric sorocarp development
3. B	GO:0009933	meristem structural organization
3. B	GO:0005681	spliceosomal complex
3. B	GO:0043297	apical junction assembly
3. B	GO:0051012	microtubule sliding
3. B	GO:0034388	Pwp2p-containing subcomplex of 90S preribosome
3. B	GO:1903013	response to differentiation-inducing factor 1
3. B	GO:0030971	receptor tyrosine kinase binding
3. B	GO:0001764	neuron migration
3. B	GO:0030157	pancreatic juice secretion
3. B	GO:0016905	myosin heavy chain kinase activity
3. B	GO:2000394	positive regulation of lamellipodium morphogenesis
3. B	GO:0030178	negative regulation of Wnt signaling pathway
3. B	GO:0030127	COPII vesicle coat
3. B	GO:0071339	MLL1 complex
3. B	GO:0097750	endosome membrane tubulation
3. B	GO:0007312	oocyte nucleus migration involved in oocyte dorsal/ventral axis specification
3. B	GO:0032350	regulation of hormone metabolic process
3. B	GO:0034452	dynactin binding
3. B	GO:0005840	ribosome
3. B	GO:0098792	xenophagy
3. B	GO:0005525	GTP binding
3. B	GO:0010992	ubiquitin recycling
3. B	GO:1990266	neutrophil migration
3. B	GO:0007294	germarium-derived oocyte fate determination
3. B	GO:0030043	actin filament fragmentation
3. B	GO:0071007	U2-type catalytic step 2 spliceosome
3. B	GO:1903146	regulation of autophagy of mitochondrion
3. B	GO:0030834	regulation of actin filament depolymerization
3. B	GO:0016575	histone deacetylation
3. B	GO:0008352	katanin complex
3. B	GO:0070121	Kupffer's vesicle development
3. B	GO:0051299	centrosome separation
3. B	GO:0030120	vesicle coat
3. B	GO:0035844	cloaca development
3. B	GO:1903033	positive regulation of microtubule plus-end binding
3. B	GO:0000974	Prp19 complex
3. B	GO:0047391	alkylglycerophosphoethanolamine phosphodiesterase activity
3. B	GO:0071817	MMXD complex
3. B	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0042304	regulation of fatty acid biosynthetic process
3. B	GO:0010697	negative regulation of mitotic spindle pole body separation
3. B	GO:0005662	DNA replication factor A complex
3. B	GO:0008013	beta-catenin binding
3. B	GO:0005635	nuclear envelope
3. B	GO:1990949	metaphase/anaphase transition of meiosis I
3. B	GO:0043982	histone H4-K8 acetylation
3. B	GO:0040013	negative regulation of locomotion
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0016055	Wnt signaling pathway
3. B	GO:0051434	BH3 domain binding
3. B	GO:0051081	nuclear membrane disassembly
3. B	GO:0048873	homeostasis of number of cells within a tissue
3. B	GO:0051028	mRNA transport
3. B	GO:0031465	Cul4B-RING E3 ubiquitin ligase complex
3. B	GO:0071539	protein localization to centrosome
3. B	GO:0000245	spliceosomal complex assembly
3. B	GO:0001738	morphogenesis of a polarized epithelium
3. B	GO:2000738	positive regulation of stem cell differentiation
3. B	GO:0038202	TORC1 signaling
3. B	GO:0140285	endosome fission
3. B	GO:0010026	trichome differentiation
3. B	GO:0070734	histone H3-K27 methylation
3. B	GO:0071870	cellular response to catecholamine stimulus
3. B	GO:0051510	regulation of unidimensional cell growth
3. B	GO:0043966	histone H3 acetylation
3. B	GO:0007029	endoplasmic reticulum organization
3. B	GO:0048872	homeostasis of number of cells
3. B	GO:1990716	axonemal central apparatus
3. B	GO:0001675	acrosome assembly
3. B	GO:0061502	early endosome to recycling endosome transport
3. B	GO:1901386	negative regulation of voltage-gated calcium channel activity
3. B	GO:0003714	transcription corepressor activity
3. B	GO:0048545	response to steroid hormone
3. B	GO:0030687	preribosome, large subunit precursor
3. B	GO:0030723	ovarian fusome organization
3. B	GO:0007298	border follicle cell migration
3. B	GO:0045741	positive regulation of epidermal growth factor-activated receptor activity
3. B	GO:0005911	cell-cell junction
3. B	GO:0055087	Ski complex
3. B	GO:0045542	positive regulation of cholesterol biosynthetic process
3. B	GO:0039008	pronephric nephron tubule morphogenesis
3. B	GO:0010272	response to silver ion
3. B	GO:0048713	regulation of oligodendrocyte differentiation
3. B	GO:0001826	inner cell mass cell differentiation
3. B	GO:0055082	cellular chemical homeostasis
3. B	GO:0034399	nuclear periphery
3. B	GO:0034396	negative regulation of transcription from RNA polymerase II promoter in response to iron
3. B	GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:1902525	regulation of protein monoubiquitination
3. B	GO:0050795	regulation of behavior
3. B	GO:0006310	DNA recombination
3. B	GO:0010044	response to aluminum ion
3. B	GO:0007097	nuclear migration
3. B	GO:0033276	transcription factor TFTC complex
3. B	GO:0007019	microtubule depolymerization
3. B	GO:2001224	positive regulation of neuron migration
3. B	GO:0007281	germ cell development
3. B	GO:0005815	microtubule organizing center
3. B	GO:1904672	regulation of somatic stem cell population maintenance
3. B	GO:0070534	protein K63-linked ubiquitination
3. B	GO:2001244	positive regulation of intrinsic apoptotic signaling pathway
3. B	GO:0051642	centrosome localization
3. B	GO:0005847	mRNA cleavage and polyadenylation specificity factor complex
3. B	GO:0032040	small-subunit processome
3. B	GO:0009585	red, far-red light phototransduction
3. B	GO:0043005	neuron projection
3. B	GO:0031616	spindle pole centrosome
3. B	GO:0030595	leukocyte chemotaxis
3. B	GO:0000417	HIR complex
3. B	GO:0000387	spliceosomal snRNP assembly
3. B	GO:0030308	negative regulation of cell growth
3. B	GO:0097635	extrinsic component of autophagosome membrane
3. B	GO:0031023	microtubule organizing center organization
3. B	GO:0060041	retina development in camera-type eye
3. B	GO:0009507	chloroplast
3. B	GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0000922	spindle pole
3. B	GO:0000421	autophagosome membrane
3. B	GO:0010073	meristem maintenance
3. B	GO:0005848	mRNA cleavage stimulating factor complex
3. B	GO:0032933	SREBP signaling pathway
3. B	GO:0009663	plasmodesma organization
3. B	GO:0007212	dopamine receptor signaling pathway
3. B	GO:0031139	positive regulation of conjugation with cellular fusion
3. B	GO:0060770	negative regulation of epithelial cell proliferation involved in prostate gland development
3. B	GO:2001205	negative regulation of osteoclast development
3. B	GO:0060590	ATPase regulator activity
3. B	GO:0048573	photoperiodism, flowering
3. B	GO:0045159	myosin II binding
3. B	GO:0000380	alternative mRNA splicing, via spliceosome
3. B	GO:0031339	negative regulation of vesicle fusion
3. B	GO:0007095	mitotic G2 DNA damage checkpoint signaling
3. B	GO:0034315	regulation of Arp2/3 complex-mediated actin nucleation
3. B	GO:0005741	mitochondrial outer membrane
3. B	GO:1902183	regulation of shoot apical meristem development
3. B	GO:0051219	phosphoprotein binding
3. B	GO:0048026	positive regulation of mRNA splicing, via spliceosome
3. B	GO:0051225	spindle assembly
3. B	GO:0051983	regulation of chromosome segregation
3. B	GO:0043984	histone H4-K16 acetylation
3. B	GO:0050918	positive chemotaxis
3. B	GO:0051901	positive regulation of mitochondrial depolarization
3. B	GO:0032430	positive regulation of phospholipase A2 activity
3. B	GO:0002446	neutrophil mediated immunity
3. B	GO:0034501	protein localization to kinetochore
3. B	GO:0015629	actin cytoskeleton
3. B	GO:0009967	positive regulation of signal transduction
3. B	GO:0046662	regulation of oviposition
3. B	GO:0006378	mRNA polyadenylation
3. B	GO:0009909	regulation of flower development
3. B	GO:0035973	aggrephagy
3. B	GO:0090660	cerebrospinal fluid circulation
3. B	GO:0045292	mRNA cis splicing, via spliceosome
3. B	GO:1903003	positive regulation of protein deubiquitination
3. B	GO:0033137	negative regulation of peptidyl-serine phosphorylation
3. B	GO:0030134	COPII-coated ER to Golgi transport vesicle
3. B	GO:0033365	protein localization to organelle
3. B	GO:0065001	specification of axis polarity
3. B	GO:1990630	IRE1-RACK1-PP2A complex
3. B	GO:0003700	DNA-binding transcription factor activity
3. B	GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0031507	heterochromatin assembly
3. B	GO:1990447	U2 snRNP binding
3. B	GO:0051126	negative regulation of actin nucleation
3. B	GO:0045309	protein phosphorylated amino acid binding
3. B	GO:0010393	galacturonan metabolic process
3. B	GO:0000266	mitochondrial fission
3. B	GO:0007099	centriole replication
3. B	GO:0046329	negative regulation of JNK cascade
3. B	GO:0080008	Cul4-RING E3 ubiquitin ligase complex
3. B	GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling
3. B	GO:0007049	cell cycle
3. B	GO:0000045	autophagosome assembly
3. B	GO:0071363	cellular response to growth factor stimulus
3. B	GO:0043548	phosphatidylinositol 3-kinase binding
3. B	GO:0006909	phagocytosis
3. B	GO:0030332	cyclin binding
3. B	GO:0034613	cellular protein localization
3. B	GO:0090176	microtubule cytoskeleton organization involved in establishment of planar polarity
3. B	GO:0016593	Cdc73/Paf1 complex
3. B	GO:0005828	kinetochore microtubule
3. B	GO:0009908	flower development
3. B	GO:0001961	positive regulation of cytokine-mediated signaling pathway
3. B	GO:0009411	response to UV
3. B	GO:0071599	otic vesicle development
3. B	GO:1905281	positive regulation of retrograde transport, endosome to Golgi
3. B	GO:0040020	regulation of meiotic nuclear division
3. B	GO:0038180	nerve growth factor signaling pathway
3. B	GO:0031334	positive regulation of protein-containing complex assembly
3. B	GO:0016581	NuRD complex
3. B	GO:0045739	positive regulation of DNA repair
3. B	GO:0000781	chromosome, telomeric region
3. B	GO:0005875	microtubule associated complex
3. B	GO:0051276	chromosome organization
3. B	GO:0031929	TOR signaling
3. B	GO:0030513	positive regulation of BMP signaling pathway
3. B	GO:0005813	centrosome
3. B	GO:1904951	positive regulation of establishment of protein localization
3. B	GO:0007186	G protein-coupled receptor signaling pathway
3. B	GO:0097525	spliceosomal snRNP complex
3. B	GO:0090207	regulation of triglyceride metabolic process
3. B	GO:0070507	regulation of microtubule cytoskeleton organization
3. B	GO:0031124	mRNA 3'-end processing
3. B	GO:0012507	ER to Golgi transport vesicle membrane
3. B	GO:0002102	podosome
3. B	GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process
3. B	GO:0031648	protein destabilization
3. B	GO:0090135	actin filament branching
3. B	GO:2000653	regulation of genetic imprinting
3. B	GO:0042802	identical protein binding
3. B	GO:0005938	cell cortex
3. B	GO:0005654	nucleoplasm
3. B	GO:0031932	TORC2 complex
3. B	GO:0043029	T cell homeostasis
3. B	GO:0034450	ubiquitin-ubiquitin ligase activity
3. B	GO:0045862	positive regulation of proteolysis
3. B	GO:1905191	positive regulation of metaphase/anaphase transition of meiosis II
3. B	GO:0031497	chromatin assembly
3. B	GO:0035327
3. B	GO:0047496	vesicle transport along microtubule
3. B	GO:0033186	CAF-1 complex
3. B	GO:0051013	microtubule severing
3. B	GO:0005656	nuclear pre-replicative complex
3. B	GO:0046843	dorsal appendage formation
3. B	GO:0016567	protein ubiquitination
3. B	GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
3. B	GO:0008047	enzyme activator activity
3. B	GO:0046469	platelet activating factor metabolic process
3. B	GO:0006693	prostaglandin metabolic process
3. B	GO:0051321	meiotic cell cycle
3. B	GO:0030426	growth cone
3. B	GO:0044877	protein-containing complex binding
3. B	GO:0005576	extracellular region
3. B	GO:0071672	negative regulation of smooth muscle cell chemotaxis
3. B	GO:0048359	mucilage metabolic process involved in seed coat development
3. B	GO:0120095	vacuole-isolation membrane contact site
3. B	GO:0005700	polytene chromosome
3. B	GO:0051279	regulation of release of sequestered calcium ion into cytosol
3. B	GO:0051343	positive regulation of cyclic-nucleotide phosphodiesterase activity
3. B	GO:0016319	mushroom body development
3. B	GO:1900045	negative regulation of protein K63-linked ubiquitination
3. B	GO:0007405	neuroblast proliferation
3. B	GO:1990757	ubiquitin ligase activator activity
3. B	GO:0097431	mitotic spindle pole
3. B	GO:0045504	dynein heavy chain binding
3. B	GO:1904668	positive regulation of ubiquitin protein ligase activity
3. B	GO:0000012	single strand break repair
3. B	GO:0022618	ribonucleoprotein complex assembly
3. B	GO:0008247	1-alkyl-2-acetylglycerophosphocholine esterase complex
3. B	GO:0034455	t-UTP complex
3. B	GO:0007303	cytoplasmic transport, nurse cell to oocyte
3. B	GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation
3. B	GO:1901838	positive regulation of transcription of nucleolar large rRNA by RNA polymerase I
3. B	GO:0034511	U3 snoRNA binding
3. B	GO:0030036	actin cytoskeleton organization
3. B	GO:0019005	SCF ubiquitin ligase complex
3. B	GO:0001650	fibrillar center
3. B	GO:0030041	actin filament polymerization
3. B	GO:1990889	H4K20me3 modified histone binding
3. B	GO:0042826	histone deacetylase binding
3. B	GO:0046540	U4/U6 x U5 tri-snRNP complex
3. B	GO:0040035	hermaphrodite genitalia development
3. B	GO:0071005	U2-type precatalytic spliceosome
3. B	GO:0009792	embryo development ending in birth or egg hatching
3. B	GO:0061739	protein lipidation involved in autophagosome assembly
3. B	GO:0031931	TORC1 complex
3. B	GO:0015031	protein transport
3. B	GO:2001235	positive regulation of apoptotic signaling pathway
3. B	GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
3. B	GO:0031145	anaphase-promoting complex-dependent catabolic process
3. B	GO:0090129	positive regulation of synapse maturation
3. B	GO:0039689	negative stranded viral RNA replication
3. B	GO:0030864	cortical actin cytoskeleton
3. B	GO:0001222	transcription corepressor binding
3. B	GO:0051571	positive regulation of histone H3-K4 methylation
3. B	GO:0005730	nucleolus
3. B	GO:0035097	histone methyltransferase complex
3. B	GO:0075296	positive regulation of ascospore formation
3. B	GO:1990298	bub1-bub3 complex
3. B	GO:0016589	NURF complex
3. B	GO:0042753	positive regulation of circadian rhythm
3. B	GO:2000280	regulation of root development
3. B	GO:0098789	pre-mRNA cleavage required for polyadenylation
3. B	GO:0008298	intracellular mRNA localization
3. B	GO:0016005	phospholipase A2 activator activity
3. B	GO:0097361	CIA complex
3. B	GO:0048711	positive regulation of astrocyte differentiation
3. B	GO:0051130	positive regulation of cellular component organization
3. B	GO:0036158	outer dynein arm assembly
3. B	GO:0051383	kinetochore organization
3. B	GO:0008022	protein C-terminus binding
3. B	GO:0048142	germarium-derived cystoblast division
3. B	GO:0005078	MAP-kinase scaffold activity
3. B	GO:0019827	stem cell population maintenance
3. B	GO:0051661	maintenance of centrosome location
3. B	GO:0032036	myosin heavy chain binding
3. B	GO:0072686	mitotic spindle
3. B	GO:0090326	positive regulation of locomotion involved in locomotory behavior
3. B	GO:0045540	regulation of cholesterol biosynthetic process
3. B	GO:0042273	ribosomal large subunit biogenesis
3. B	GO:1904811	positive regulation of dense core granule transport
3. B	GO:0072432	response to G1 DNA damage checkpoint signaling
3. B	GO:0032934	sterol binding
3. B	GO:0003720	telomerase activity
3. B	GO:0030473	nuclear migration along microtubule
3. B	GO:0042052	rhabdomere development
3. B	GO:0071011	precatalytic spliceosome
3. B	GO:0043143	regulation of translation by machinery localization
3. B	GO:0070971	endoplasmic reticulum exit site
3. B	GO:0001891	phagocytic cup
3. B	GO:0051660	establishment of centrosome localization
3. B	GO:1903026	negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding
3. B	GO:0045014	carbon catabolite repression of transcription by glucose
3. B	GO:0070912	Ddb1-Ckn1 complex
3. B	GO:0080135	regulation of cellular response to stress
3. B	GO:0000381	regulation of alternative mRNA splicing, via spliceosome
3. B	GO:0003677	DNA binding
3. B	GO:0007018	microtubule-based movement
3. B	GO:0031101	fin regeneration
3. B	GO:0048471	perinuclear region of cytoplasm
3. B	GO:0051015	actin filament binding
3. B	GO:0046784	viral mRNA export from host cell nucleus
3. B	GO:0090724	central region of growth cone
3. B	GO:0120197	mucociliary clearance
3. B	GO:0008270	zinc ion binding
3. B	GO:0097027	ubiquitin-protein transferase activator activity
3. B	GO:0030507	spectrin binding
3. B	GO:0000398	mRNA splicing, via spliceosome
3. B	GO:1900091	regulation of raffinose biosynthetic process
3. B	GO:0030042	actin filament depolymerization
3. B	GO:0005814	centriole
3. B	GO:0045943	positive regulation of transcription by RNA polymerase I
3. B	GO:0000235	astral microtubule
3. B	GO:0060528	secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
3. B	GO:2000574	obsolete regulation of microtubule motor activity
3. B	GO:0090049	regulation of cell migration involved in sprouting angiogenesis
3. B	GO:0010826	negative regulation of centrosome duplication
3. B	GO:0046716	muscle cell cellular homeostasis
3. B	GO:0038026	reelin-mediated signaling pathway
3. B	GO:1903378	positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
3. B	GO:1904115	axon cytoplasm
3. B	GO:0021987	cerebral cortex development
3. B	GO:1903955	positive regulation of protein targeting to mitochondrion
3. B	GO:1900087	positive regulation of G1/S transition of mitotic cell cycle
3. B	GO:0070370	cellular heat acclimation
3. B	GO:0010118	stomatal movement
3. B	GO:0006364	rRNA processing
3. B	GO:0005680	anaphase-promoting complex
3. B	GO:0040019	positive regulation of embryonic development
3. B	GO:0097344	Rix1 complex
3. B	GO:0016607	nuclear speck
3. B	GO:0051726	regulation of cell cycle
3. B	GO:0001845	phagolysosome assembly
3. B	GO:0036180	filamentous growth of a population of unicellular organisms in response to biotic stimulus
3. B	GO:0045827	negative regulation of isoprenoid metabolic process
3. B	GO:0071407	cellular response to organic cyclic compound
3. B	GO:0090110	COPII-coated vesicle cargo loading
3. B	GO:0000776	kinetochore
3. B	GO:0070176	DRM complex
3. B	GO:0030862	positive regulation of polarized epithelial cell differentiation
3. B	GO:0007315	pole plasm assembly
3. B	GO:0005858	axonemal dynein complex
3. B	GO:0021819	layer formation in cerebral cortex
3. B	GO:0035591	signaling adaptor activity
3. B	GO:0008090	retrograde axonal transport
3. B	GO:0007369	gastrulation
3. B	GO:0071555	cell wall organization
3. B	GO:0005881	cytoplasmic microtubule
3. B	GO:0035266	meristem growth
3. B	GO:0045503	dynein light chain binding
3. B	GO:0001934	positive regulation of protein phosphorylation
3. B	GO:0030220	platelet formation
3. B	GO:0051898	negative regulation of protein kinase B signaling
3. B	GO:0070545	PeBoW complex
3. B	GO:1902463	protein localization to cell leading edge
3. B	GO:0048705	skeletal system morphogenesis
3. B	GO:0007399	nervous system development
3. B	GO:0003093	regulation of glomerular filtration
3. B	GO:0000132	establishment of mitotic spindle orientation
3. B	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
3. B	GO:1903861	positive regulation of dendrite extension
3. B	GO:0044666	MLL3/4 complex
3. B	GO:0042998	positive regulation of Golgi to plasma membrane protein transport
3. B	GO:0009991	response to extracellular stimulus
3. B	GO:0042247	establishment of planar polarity of follicular epithelium
3. B	GO:0031915	positive regulation of synaptic plasticity
3. B	GO:0006974	cellular response to DNA damage stimulus
3. B	GO:0031117	positive regulation of microtubule depolymerization
3. B	GO:0016559	peroxisome fission
3. B	GO:0045214	sarcomere organization
3. B	GO:0034709	methylosome
3. B	GO:0072593	reactive oxygen species metabolic process
3. B	GO:0016558	protein import into peroxisome matrix
3. B	GO:0016226	iron-sulfur cluster assembly
3. B	GO:0009867	jasmonic acid mediated signaling pathway
3. B	GO:0005669	transcription factor TFIID complex
3. B	GO:0006513	protein monoubiquitination
3. B	GO:0007059	chromosome segregation
3. B	GO:0001895	retina homeostasis
3. B	GO:0043622	cortical microtubule organization
3. B	GO:0043981	histone H4-K5 acetylation
3. B	GO:0120151	positive regulation of mitotic actomyosin contractile ring disassembly
3. B	GO:0006405	RNA export from nucleus
3. B	GO:0006333	chromatin assembly or disassembly
3. B	GO:0048854	brain morphogenesis
3. B	GO:0043320	natural killer cell degranulation
3. B	GO:0030277	maintenance of gastrointestinal epithelium
3. B	GO:0072499	photoreceptor cell axon guidance
3. B	GO:1903423	positive regulation of synaptic vesicle recycling
3. B	GO:0033597	mitotic checkpoint complex
3. B	GO:0031252	cell leading edge
3. B	GO:1905392	plant organ morphogenesis
3. B	GO:0030030	cell projection organization
3. B	GO:0035098	ESC/E(Z) complex
3. B	GO:0048813	dendrite morphogenesis
3. B	GO:0071013	catalytic step 2 spliceosome
3. B	GO:0009845	seed germination
3. B	GO:0031154	culmination involved in sorocarp development
3. B	GO:0060236	regulation of mitotic spindle organization
3. B	GO:0048188	Set1C/COMPASS complex
3. B	GO:0044297	cell body
3. B	GO:0034773	histone H4-K20 trimethylation
3. B	GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
3. B	GO:0071006	U2-type catalytic step 1 spliceosome
3. B	GO:2000582	obsolete positive regulation of microtubule motor activity, plus-end-directed
3. B	GO:0045199	maintenance of epithelial cell apical/basal polarity
3. B	GO:1902773	GTPase activator complex
3. B	GO:0140582	adenylate cyclase-activating G protein-coupled cAMP receptor signaling pathway
3. B	GO:0051010	microtubule plus-end binding
3. B	GO:0043021	ribonucleoprotein complex binding
3. B	GO:0021895	cerebral cortex neuron differentiation
3. B	GO:0005868	cytoplasmic dynein complex
3. B	GO:0051020	GTPase binding
3. B	GO:0036035	osteoclast development
3. B	GO:0071541	eukaryotic translation initiation factor 3 complex, eIF3m
3. B	GO:0000437	carbon catabolite repression of transcription from RNA polymerase II promoter
3. B	GO:0090696	post-embryonic plant organ development
3. B	GO:0060117	auditory receptor cell development
3. B	GO:0032527	protein exit from endoplasmic reticulum
3. B	GO:0051721	protein phosphatase 2A binding
3. B	GO:0002098	tRNA wobble uridine modification
3. B	GO:0051568	histone H3-K4 methylation
3. B	GO:0030027	lamellipodium
3. B	GO:0050773	regulation of dendrite development
3. B	GO:0098532	histone H3-K27 trimethylation
3. B	GO:0000466	maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0017070	U6 snRNA binding
3. B	GO:0048135	female germ-line cyst formation
3. B	GO:0030686	90S preribosome
3. B	GO:0008092	cytoskeletal protein binding
3. B	GO:0000445	THO complex part of transcription export complex
3. B	GO:1990756	ubiquitin ligase-substrate adaptor activity
3. B	GO:0035767	endothelial cell chemotaxis
3. B	GO:0031464	Cul4A-RING E3 ubiquitin ligase complex
3. B	GO:0042393	histone binding
3. B	GO:0030286	dynein complex
3. B	GO:0036038	MKS complex
3. B	GO:0071001	U4/U6 snRNP
3. B	GO:1903725	regulation of phospholipid metabolic process
3. B	GO:0045598	regulation of fat cell differentiation
3. B	GO:0080001	mucilage extrusion from seed coat
3. B	GO:0042054	histone methyltransferase activity
3. B	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0097680	double-strand break repair via classical nonhomologous end joining
3. B	GO:0009723	response to ethylene
3. B	GO:0005871	kinesin complex
3. B	GO:0080182	histone H3-K4 trimethylation
3. B	GO:0008380	RNA splicing
3. B	GO:0003711	transcription elongation regulator activity
3. B	GO:0010659	cardiac muscle cell apoptotic process
3. B	GO:0051302	regulation of cell division
3. B	GO:1990452	Parkin-FBXW7-Cul1 ubiquitin ligase complex
3. B	GO:0097014	ciliary plasm
3. B	GO:0043293	apoptosome
3. B	GO:0030381	chorion-containing eggshell pattern formation
3. B	GO:0003777	microtubule motor activity
3. B	GO:0046872	metal ion binding
3. B	GO:0050816	phosphothreonine residue binding
3. B	GO:0045842	positive regulation of mitotic metaphase/anaphase transition
3. B	GO:0090102	cochlea development
3. B	GO:0009640	photomorphogenesis
3. B	GO:0010224	response to UV-B
3. B	GO:0031570	DNA integrity checkpoint signaling
3. B	GO:0071933	Arp2/3 complex binding
3. B	GO:0042249	establishment of planar polarity of embryonic epithelium
3. B	GO:0042169	SH2 domain binding
3. B	GO:1903208	negative regulation of hydrogen peroxide-induced neuron death
3. B	GO:0030292	protein tyrosine kinase inhibitor activity
3. B	GO:0090443	FAR/SIN/STRIPAK complex
3. B	GO:0051572	negative regulation of histone H3-K4 methylation
3. B	GO:0006349	regulation of gene expression by genomic imprinting
3. B	GO:0120206	photoreceptor distal connecting cilium
3. B	GO:0048366	leaf development
3. B	GO:0010842	retina layer formation
3. B	GO:0072344	rescue of stalled ribosome
3. B	GO:1904950	negative regulation of establishment of protein localization
3. B	GO:1901796	regulation of signal transduction by p53 class mediator
3. B	GO:1900088	regulation of inositol biosynthetic process
3. B	GO:0000433	carbon catabolite repression of transcription from RNA polymerase II promoter by glucose
3. B	GO:0070016	armadillo repeat domain binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q20168	Probable coatomer subunit beta'	2.16e-09	1.76e-07	4.55e-13
1. PB	Q6H8D6	Putative coatomer subunit beta'-3	3.05e-09	1.69e-08	1.81e-12
1. PB	Q9VKK2	GATOR complex protein Wdr59	6.41e-04	4.94e-02	9.60e-07
1. PB	Q54YD8	Coatomer subunit beta'	2.46e-08	1.88e-08	1.15e-12
1. PB	Q5R664	Coatomer subunit beta'	2.55e-08	6.01e-08	9.96e-12
1. PB	Q96WV5	Putative coatomer subunit alpha	1.01e-07	1.08e-04	2.66e-09
1. PB	F4ICD9	Protein transport protein SEC31 homolog A	3.51e-05	1.71e-03	5.42e-05
1. PB	Q9AUR7	Coatomer subunit alpha-2	2.28e-08	3.22e-02	9.59e-11
1. PB	Q8BX17	Gem-associated protein 5	3.72e-10	1.57e-20	2.90e-12
1. PB	A5DTX3	Protein transport protein SEC31	1.76e-04	9.70e-04	3.82e-07
1. PB	Q8TEQ6	Gem-associated protein 5	1.05e-10	1.14e-20	2.91e-13
1. PB	P41811	Coatomer subunit beta'	2.72e-08	6.59e-06	3.71e-09
1. PB	Q9CAA0	Coatomer subunit beta'-1	6.89e-09	4.33e-08	3.44e-12
1. PB	O62621	Coatomer subunit beta'	8.78e-09	5.68e-09	3.40e-12
1. PB	Q4R4I8	Coatomer subunit beta'	1.13e-09	4.51e-08	9.54e-12
1. PB	A8WGF4	Intraflagellar transport protein 122 homolog	2.22e-09	2.69e-12	2.11e-05
1. PB	Q9C827	Coatomer subunit beta'-2	3.69e-09	3.80e-08	6.53e-12
1. PB	O35142	Coatomer subunit beta'	9.47e-10	4.22e-08	1.09e-11
1. PB	Q6NWV3	Intraflagellar transport protein 122 homolog	2.73e-05	1.10e-13	1.66e-04
1. PB	Q6NYH1	Intraflagellar transport protein 122 homolog	1.67e-06	4.37e-12	2.82e-06
1. PB	Q5VQ78	Coatomer subunit beta'-1	4.60e-09	4.11e-08	2.37e-11
1. PB	P35606	Coatomer subunit beta'	2.54e-08	8.32e-08	1.06e-11
1. PB	Q8L828	Coatomer subunit beta'-3	1.32e-08	3.29e-08	1.22e-11
1. PB	P35605	Coatomer subunit beta'	3.49e-09	1.57e-07	9.15e-12
1. PB	O55029	Coatomer subunit beta'	1.23e-09	1.21e-07	1.03e-11
1. PB	Q8IZU2	WD repeat-containing protein 17	0	1.54e-149	0.0
1. PB	G5EFW7	Intraflagellar transport protein 122 homolog	2.31e-08	5.76e-14	2.17e-06
1. PB	Q6H8D5	Coatomer subunit beta'-2	5.96e-09	4.21e-09	4.01e-13
2. P	Q920Q4	Vacuolar protein sorting-associated protein 16 homolog	5.79e-05	1.87e-04	NA
2. P	P93043	Vacuolar protein sorting-associated protein 41 homolog	2.51e-03	7.78e-03	NA
2. P	Q9UT38	Probable vacuolar protein sorting-associated protein 16 homolog	8.88e-05	3.64e-03	NA
2. P	Q69ZJ7	Guanine nucleotide exchange factor subunit RIC1	6.32e-05	2.27e-07	NA
2. P	Q19954	Vacuolar protein sorting-associated protein 41 homolog	4.05e-03	2.62e-03	NA
2. P	A4QNS7	GATOR complex protein MIOS-B	1.46e-04	1.47e-07	NA
2. P	O95163	Elongator complex protein 1	7.64e-06	1.08e-06	NA
2. P	Q551B5	GATOR complex protein MIOS	1.10e-01	8.95e-07	NA
2. P	P36161	Nucleoporin NUP133	1.47e-03	3.13e-04	NA
2. P	F1QEB7	WD repeat-containing protein 11	5.26e-08	1.10e-08	NA
2. P	Q9JKU3	Intraflagellar transport protein 172 homolog	9.16e-06	1.06e-09	NA
2. P	Q22830	Intraflagellar transport protein osm-1	2.14e-06	1.03e-10	NA
2. P	Q9P6N4	E3 ubiquitin-protein ligase pep5	1.71e-05	1.53e-02	NA
2. P	Q7M733	Hermansky-Pudlak syndrome 6 protein homolog	4.23e-03	8.27e-04	NA
2. P	Q618H8	Vacuolar protein sorting-associated protein 41 homolog	4.84e-03	8.54e-04	NA
2. P	Q8WUM0	Nuclear pore complex protein Nup133	5.61e-03	9.88e-03	NA
2. P	Q8C456	WD repeat-containing and planar cell polarity effector protein fritz homolog	1.44e-03	6.67e-08	NA
2. P	Q9NXC5	GATOR complex protein MIOS	4.77e-04	1.26e-07	NA
2. P	Q5RCA2	GATOR complex protein MIOS	1.69e-04	6.09e-08	NA
2. P	P49754	Vacuolar protein sorting-associated protein 41 homolog	1.73e-03	1.41e-05	NA
2. P	A7MB11	Transforming growth factor-beta receptor-associated protein 1	2.46e-05	1.45e-04	NA
2. P	Q9VQ89	GATOR complex protein MIOS	5.02e-04	6.36e-06	NA
2. P	O59704	Elongator complex protein 1	3.14e-05	1.26e-10	NA
2. P	Q9P253	Vacuolar protein sorting-associated protein 18 homolog	5.77e-03	3.94e-04	NA
2. P	Q8K1X1	WD repeat-containing protein 11	1.01e-07	9.98e-08	NA
2. P	Q9P7N3	Vacuolar protein sorting-associated protein 41	6.29e-03	3.83e-03	NA
2. P	Q96JC1	Vam6/Vps39-like protein	1.12e-05	3.22e-03	NA
2. P	Q5RHH4	Intraflagellar transport protein 172 homolog	7.99e-06	5.00e-08	NA
2. P	Q1ZXS5	Vacuolar protein sorting-associated protein 39 homolog	9.97e-06	5.94e-04	NA
2. P	Q8BND3	WD repeat-containing protein 35	8.07e-09	1.53e-07	NA
2. P	P38164	SEH-associated protein 4	1.00e-02	1.33e-03	NA
2. P	Q4ADV7	Guanine nucleotide exchange factor subunit RIC1	9.04e-05	8.41e-07	NA
2. P	F4I312	Vacuolar sorting protein 3	2.97e-03	7.63e-03	NA
2. P	Q9D180	Cilia- and flagella-associated protein 57	1.31e-05	1.03e-02	NA
2. P	Q9Y817	Regulator of V-ATPase in vacuolar membrane protein 1	8.80e-07	8.09e-09	NA
2. P	Q54YB3	TSET complex member tstE	6.27e-06	3.41e-02	NA
2. P	Q9V3C5	Guanine nucleotide exchange factor subunit Rich	1.09e-04	2.54e-06	NA
2. P	Q9BZH6	WD repeat-containing protein 11	3.39e-06	5.43e-07	NA
2. P	Q8L5Y0	Vacuolar sorting protein 39	4.38e-04	6.24e-03	NA
2. P	Q5KU39	Vacuolar protein sorting-associated protein 41 homolog	1.76e-03	1.07e-05	NA
2. P	Q8BLY7	Hermansky-Pudlak syndrome 6 protein homolog	2.11e-02	8.18e-05	NA
2. P	Q9HBG6	Intraflagellar transport protein 122 homolog	1.36e-06	8.58e-14	NA
2. P	Q9P2L0	WD repeat-containing protein 35	1.36e-08	1.42e-05	NA
2. P	Q5DM57	Intraflagellar transport protein 172	1.18e-05	2.01e-08	NA
2. P	Q96RY7	Intraflagellar transport protein 140 homolog	1.98e-07	1.55e-07	NA
2. P	Q54YP4	Vacuolar protein sorting-associated protein 11 homolog	1.08e-04	5.75e-03	NA
2. P	A0A2R8QPS5	Guanine nucleotide exchange factor subunit RIC1	1.14e-04	7.12e-04	NA
2. P	Q177G4	Hermansky-Pudlak syndrome 5 protein homolog	6.40e-03	1.77e-03	NA
2. P	P93231	Vacuolar protein sorting-associated protein 41 homolog	3.46e-03	2.20e-03	NA
2. P	Q3UGF1	WD repeat-containing protein 19	3.13e-06	1.43e-11	NA
2. P	Q5U5D4	GATOR complex protein MIOS-A	5.00e-04	5.78e-08	NA
2. P	Q09417	Guanine nucleotide exchange factor subunit R06F6.8	1.41e-04	3.95e-03	NA
2. P	P47104	Regulator of V-ATPase in vacuolar membrane protein 1	1.20e-06	1.08e-11	NA
2. P	B1WC10	WD repeat-containing and planar cell polarity effector protein fritz homolog	1.64e-03	2.52e-08	NA
2. P	Q8R5L3	Vam6/Vps39-like protein	1.76e-05	1.38e-02	NA
2. P	Q24314	Vacuolar protein sorting-associated protein 18 homolog	3.35e-03	8.68e-03	NA
2. P	F1QNV4	Nuclear pore complex protein Nup133	3.53e-03	1.90e-03	NA
2. P	E9PY46	Intraflagellar transport protein 140 homolog	6.88e-07	8.09e-09	NA
2. P	Q297N8	Hermansky-Pudlak syndrome 5 protein homolog	1.44e-03	8.95e-03	NA
2. P	P40064	Nucleoporin NUP157	2.73e-02	6.24e-03	NA
2. P	Q9VGK7	Putative elongator complex protein 1	4.98e-06	6.60e-09	NA
2. P	O13955	Vacuolar morphogenesis protein 6	1.26e-02	1.42e-02	NA
2. P	Q9FNA4	Elongator complex protein 1	4.75e-07	1.99e-12	NA
2. P	Q9W040	Intraflagellar transport protein 172 homolog	7.38e-06	3.27e-13	NA
2. P	Q8N3P4	Vacuolar protein sorting-associated protein 8 homolog	1.61e-02	7.04e-03	NA
2. P	Q9SJ40	Vacuolar protein-sorting-associated protein 11 homolog	2.88e-05	7.99e-05	NA
2. P	Q9H269	Vacuolar protein sorting-associated protein 16 homolog	7.44e-05	2.07e-03	NA
2. P	Q6VH22	Intraflagellar transport protein 172 homolog	2.61e-05	1.12e-09	NA
2. P	Q60V75	Vacuolar protein sorting-associated protein 16 homolog	1.91e-04	3.34e-02	NA
2. P	Q32NR9	WD repeat-containing and planar cell polarity effector protein fritz homolog	2.46e-03	1.05e-06	NA
2. P	Q9H270	Vacuolar protein sorting-associated protein 11 homolog	2.59e-05	4.09e-05	NA
2. P	Q802U2	GATOR complex protein MIOS	1.56e-04	3.89e-06	NA
2. P	Q93VQ0	Protein VACUOLELESS1	4.11e-04	4.44e-06	NA
2. P	A6N6J5	WD repeat-containing protein 35	1.03e-08	5.10e-07	NA
2. P	Q8R307	Vacuolar protein sorting-associated protein 18 homolog	2.46e-03	5.39e-04	NA
2. P	Q8VE19	GATOR complex protein MIOS	5.37e-04	3.12e-07	NA
2. P	O74925	Vacuolar membrane protein pep3	4.77e-03	1.82e-03	NA
2. P	Q24118	Protein pigeon	5.50e-03	1.95e-02	NA
2. P	Q3UR70	Transforming growth factor-beta receptor-associated protein 1	2.55e-05	2.18e-04	NA
2. P	Q8R0G9	Nuclear pore complex protein Nup133	5.24e-03	2.87e-02	NA
2. P	Q86YV9	Hermansky-Pudlak syndrome 6 protein	7.12e-03	3.03e-04	NA
2. P	Q91W86	Vacuolar protein sorting-associated protein 11 homolog	7.14e-05	3.28e-05	NA
2. P	Q9VHN9	Hermansky-Pudlak syndrome 5 protein homolog	5.83e-04	2.62e-03	NA
2. P	Q9UG01	Intraflagellar transport protein 172 homolog	1.08e-05	2.40e-09	NA
2. P	Q0P5W1	Vacuolar protein sorting-associated protein 8 homolog	1.40e-02	6.56e-03	NA
2. P	Q09866	Uncharacterized WD repeat-containing protein C12G12.01c	1.66e-03	7.94e-03	NA
2. P	Q11182	Vacuolar protein sorting-associated protein 16 homolog	7.11e-05	3.71e-02	NA
2. P	Q9VCW3	Nuclear pore complex protein Nup133	1.06e-02	1.20e-02	NA
2. P	Q8NEZ3	WD repeat-containing protein 19	3.49e-06	1.95e-11	NA
2. P	Q8VHU4	Elongator complex protein 1	4.96e-06	6.13e-06	NA
2. P	G5ECZ4	WD repeat-containing protein dyf-2	6.67e-07	1.78e-10	NA
2. P	G0S9A7	Nucleoporin NUP133	1.64e-02	1.79e-04	NA
2. P	Q7TT37	Elongator complex protein 1	5.42e-06	2.17e-06	NA
2. P	O95876	WD repeat-containing and planar cell polarity effector protein fritz homolog	3.10e-03	1.97e-07	NA
2. P	Q8WUH2	Transforming growth factor-beta receptor-associated protein 1	5.65e-04	9.20e-04	NA
2. P	A4IG72	Transforming growth factor-beta receptor-associated protein 1 homolog	1.27e-05	2.75e-04	NA
2. P	Q06706	Elongator complex protein 1	1.04e-04	8.71e-10	NA
2. P	Q5E9L7	Vacuolar protein sorting-associated protein 16 homolog	NA	1.08e-03	NA
2. P	Q8WND5	Elongator complex protein 1	3.28e-06	8.66e-06	NA
2. P	P59015	Vacuolar protein sorting-associated protein 18 homolog	3.31e-04	6.98e-05	NA
2. P	O13756	Vacuolar protein sorting-associated protein 8	1.94e-02	1.41e-02	NA
2. P	Q2TAQ1	Putative elongator complex protein 1	1.55e-05	1.16e-08	NA
3. B	Q9D994	WD repeat-containing protein 38	1.18e-09	NA	7.79e-14
3. B	Q09406	Autophagic-related protein 16.2	3.76e-05	NA	1.08e-04
3. B	Q8YRI1	Uncharacterized WD repeat-containing protein alr3466	1.03e-07	NA	1.73e-28
3. B	Q8AVS9	DDB1- and CUL4-associated factor 10	1.11e-02	NA	0.046
3. B	B4JWA1	Lissencephaly-1 homolog	8.23e-13	NA	6.06e-18
3. B	A2R3Z3	Mitochondrial division protein 1	5.40e-03	NA	9.15e-07
3. B	Q05048	Cleavage stimulation factor subunit 1	4.22e-09	NA	3.06e-04
3. B	A1L271	Guanine nucleotide-binding protein subunit beta-5a	9.88e-12	NA	1.38e-10
3. B	Q8SRK1	Histone acetyltransferase type B subunit 2	2.20e-08	NA	3.65e-14
3. B	O43172	U4/U6 small nuclear ribonucleoprotein Prp4	3.15e-11	NA	1.57e-14
3. B	P87177	Uncharacterized WD repeat-containing protein C3D6.12	1.86e-06	NA	0.005
3. B	P0C7V8	DDB1- and CUL4-associated factor 8-like protein 2	7.08e-04	NA	0.001
3. B	P53197	APC/C activator protein CDH1	4.65e-04	NA	3.13e-08
3. B	O94244	Histone acetyltransferase type B subunit 2	3.50e-08	NA	8.92e-08
3. B	B3NPW0	Lissencephaly-1 homolog	2.67e-09	NA	1.47e-17
3. B	Q6P0D9	Probable cytosolic iron-sulfur protein assembly protein ciao1	1.99e-11	NA	1.07e-05
3. B	Q1DIW7	Mitochondrial division protein 1	4.41e-02	NA	3.83e-05
3. B	Q04305	U3 small nucleolar RNA-associated protein 15	6.64e-05	NA	0.006
3. B	Q9NYS7	WD repeat and SOCS box-containing protein 2	1.35e-04	NA	2.62e-07
3. B	Q15061	WD repeat-containing protein 43	2.54e-03	NA	4.22e-04
3. B	B4MY77	Probable cytosolic iron-sulfur protein assembly protein Ciao1	4.76e-12	NA	7.48e-08
3. B	P62881	Guanine nucleotide-binding protein subunit beta-5	1.18e-05	NA	7.37e-11
3. B	Q92636	Protein FAN	8.00e-02	NA	0.002
3. B	Q2GVT8	Protein transport protein SEC31	3.52e-03	NA	7.63e-10
3. B	Q6CEW7	Ribosome biogenesis protein YTM1	9.17e-04	NA	0.006
3. B	Q12788	Transducin beta-like protein 3	7.26e-07	NA	3.34e-13
3. B	C5FP68	Probable E3 ubiquitin ligase complex SCF subunit sconB	2.04e-03	NA	8.48e-15
3. B	Q8IZQ1	WD repeat and FYVE domain-containing protein 3	NA	NA	0.018
3. B	B8PD53	Nuclear distribution protein PAC1-2	NA	NA	2.10e-12
3. B	F4K5R6	Cell division cycle 20.6, cofactor of APC complex	1.15e-04	NA	3.34e-09
3. B	Q86HX1	Protein HIRA	4.16e-04	NA	1.79e-05
3. B	Q8MYE8	Probable proteasomal ATPase-associated factor 1	2.27e-05	NA	6.09e-08
3. B	Q7SYD5	Protein transport protein Sec31A	4.36e-03	NA	1.43e-04
3. B	Q32LN7	WD repeat-containing protein 61	7.00e-11	NA	8.90e-05
3. B	P41318	Target of rapamycin complex subunit LST8	1.60e-08	NA	5.45e-05
3. B	Q6BZX5	Protein transport protein SEC13	9.29e-08	NA	1.86e-04
3. B	Q149M9	NACHT domain- and WD repeat-containing protein 1	1.39e-05	NA	0.002
3. B	P38968	Protein transport protein SEC31	2.64e-04	NA	3.38e-05
3. B	Q6NZH4	Lissencephaly-1 homolog	7.70e-09	NA	2.67e-17
3. B	C7Z6H2	Nuclear distribution protein PAC1	4.01e-11	NA	2.94e-10
3. B	Q59RH5	Histone acetyltransferase type B subunit 2	9.08e-08	NA	6.93e-07
3. B	B0LSW3	Platelet-activating factor acetylhydrolase IB subunit beta	5.93e-13	NA	3.03e-16
3. B	P49846	Transcription initiation factor TFIID subunit 5	1.98e-03	NA	2.96e-11
3. B	Q8SQS4	Transcription initiation factor TFIID subunit 5	3.45e-08	NA	1.57e-06
3. B	Q5FW06	DDB1- and CUL4-associated factor 10	7.88e-05	NA	0.003
3. B	Q9R1K5	Fizzy-related protein homolog	1.80e-03	NA	3.50e-05
3. B	A2QP30	Nuclear distribution protein nudF	1.65e-11	NA	2.51e-08
3. B	Q4I7X1	Polyadenylation factor subunit 2	1.15e-03	NA	1.92e-08
3. B	Q8YV57	Uncharacterized WD repeat-containing protein all2124	5.49e-08	NA	1.26e-23
3. B	Q8HXX0	Platelet-activating factor acetylhydrolase IB subunit alpha	5.41e-13	NA	9.40e-16
3. B	Q9P775	Uncharacterized WD repeat-containing protein C17D11.16	1.43e-09	NA	4.39e-05
3. B	B3H5K9	Protein NEDD1	5.01e-05	NA	0.013
3. B	Q80T85	DDB1- and CUL4-associated factor 5	1.67e-03	NA	0.001
3. B	Q944S2	WD repeat-containing protein GTS1	1.22e-04	NA	0.001
3. B	Q4X0M4	Protein transport protein sec31	2.45e-03	NA	2.72e-06
3. B	Q499N3	WD repeat-containing protein 18	1.28e-03	NA	0.033
3. B	A3LNI7	Nuclear distribution protein PAC1	1.31e-06	NA	3.58e-05
3. B	O43071	Pre-mRNA-processing factor 17	5.25e-06	NA	1.07e-06
3. B	Q0VC24	Ribosome biogenesis protein WDR12	4.00e-05	NA	2.94e-05
3. B	Q05583	Cytosolic iron-sulfur protein assembly protein 1	4.69e-07	NA	5.28e-11
3. B	O59894	Peroxisomal targeting signal 2 receptor	6.19e-11	NA	3.51e-09
3. B	Q9D0I6	WD repeat, SAM and U-box domain-containing protein 1	9.11e-04	NA	1.90e-06
3. B	Q86TI4	WD repeat-containing protein 86	1.05e-07	NA	1.85e-11
3. B	Q5ACL4	Restriction of telomere capping protein 1	5.44e-02	NA	0.009
3. B	Q9FKT5	THO complex subunit 3	2.41e-10	NA	2.78e-06
3. B	Q0U1B1	Nuclear distribution protein PAC1	3.21e-11	NA	1.31e-09
3. B	Q4WVS4	Mitochondrial division protein 1	7.50e-03	NA	1.68e-05
3. B	Q5QP82	DDB1- and CUL4-associated factor 10	6.38e-03	NA	0.004
3. B	Q54MZ3	Anaphase-promoting complex subunit cdc20	2.22e-04	NA	2.36e-11
3. B	Q8NFH4	Nucleoporin Nup37	1.83e-07	NA	7.31e-04
3. B	Q90ZL4	Lissencephaly-1 homolog	6.47e-13	NA	4.24e-17
3. B	P63245	Receptor of activated protein C kinase 1	1.95e-10	NA	2.25e-06
3. B	Q28DT7	Polycomb protein eed	4.84e-05	NA	0.028
3. B	A8QB65	Ribosome biogenesis protein WDR12 homolog	5.00e-04	NA	0.001
3. B	Q9C270	Periodic tryptophan protein 2 homolog	5.48e-06	NA	3.96e-06
3. B	Q54N86	F-box/WD repeat-containing protein A-like protein	1.02e-03	NA	2.00e-05
3. B	Q5R1S9	Chromatin assembly factor 1 subunit B	1.94e-05	NA	9.28e-05
3. B	Q94AD8	F-box/WD-40 repeat-containing protein At5g21040	2.02e-03	NA	0.014
3. B	O17468	Protein HIRA homolog	2.98e-04	NA	0.001
3. B	P61480	Ribosome biogenesis protein WDR12	1.97e-05	NA	4.11e-07
3. B	P0CS54	Ribosome biogenesis protein YTM1	2.48e-04	NA	2.90e-09
3. B	Q6P1W0	Denticleless protein homolog	1.40e-04	NA	1.03e-05
3. B	Q3SWS8	mRNA export factor	1.11e-05	NA	8.31e-07
3. B	Q99973	Telomerase protein component 1	3.78e-06	NA	0.009
3. B	O75037	Kinesin-like protein KIF21B	1.33e-02	NA	0.037
3. B	Q54LT8	Serine-threonine kinase receptor-associated protein	3.40e-07	NA	6.78e-05
3. B	Q94A40	Coatomer subunit alpha-1	1.65e-05	NA	3.30e-10
3. B	Q9HAV0	Guanine nucleotide-binding protein subunit beta-4	2.30e-12	NA	6.40e-08
3. B	B3MC74	Probable cytosolic iron-sulfur protein assembly protein Ciao1	4.64e-12	NA	4.21e-07
3. B	O13286	WD repeat-containing protein srw1	2.15e-04	NA	5.34e-07
3. B	Q0J3D9	Coatomer subunit alpha-3	2.61e-08	NA	1.50e-10
3. B	Q6DH44	WD repeat domain-containing protein 83	9.37e-08	NA	1.43e-05
3. B	Q8TAF3	WD repeat-containing protein 48	2.02e-03	NA	0.001
3. B	O93277	WD repeat-containing protein 1	2.00e-13	NA	8.49e-04
3. B	P54313	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	2.49e-12	NA	3.47e-07
3. B	Q8AVH1	Histone-binding protein RBBP7	7.84e-07	NA	2.79e-10
3. B	Q6FJZ9	Pre-mRNA-splicing factor PRP46	6.69e-06	NA	1.95e-07
3. B	Q7Z4S6	Kinesin-like protein KIF21A	3.03e-02	NA	0.030
3. B	Q5ZKU8	p21-activated protein kinase-interacting protein 1-like	1.52e-05	NA	0.002
3. B	Q6NLV4	Flowering time control protein FY	2.04e-05	NA	4.63e-10
3. B	Q2TBS9	WD40 repeat-containing protein SMU1	3.95e-06	NA	1.71e-07
3. B	A7ETB3	Mitochondrial division protein 1	1.29e-02	NA	3.37e-05
3. B	Q8VE80	THO complex subunit 3	2.83e-05	NA	6.94e-08
3. B	Q29RH4	THO complex subunit 3	4.02e-05	NA	7.93e-08
3. B	Q01277	Probable E3 ubiquitin ligase complex SCF subunit scon-2	3.19e-04	NA	6.65e-11
3. B	Q9VU68	Actin-interacting protein 1	0.00e+00	NA	7.11e-06
3. B	Q86A97	EARP-interacting protein homolog	6.48e-05	NA	4.15e-05
3. B	Q3TZ89	Protein transport protein Sec31B	6.77e-05	NA	2.33e-07
3. B	O88879	Apoptotic protease-activating factor 1	2.24e-08	NA	2.36e-08
3. B	Q28I85	POC1 centriolar protein homolog A	2.67e-04	NA	1.38e-10
3. B	Q4R304	Histone-binding protein RBBP7	8.19e-07	NA	8.97e-11
3. B	Q5RE10	EARP and GARP complex-interacting protein 1	4.62e-10	NA	0.005
3. B	Q29KQ0	Ribosome biogenesis protein WDR12 homolog	2.44e-05	NA	5.58e-05
3. B	P25382	Ribosome assembly protein 4	4.12e-05	NA	6.91e-16
3. B	Q5I0B9	Autophagy-related protein 16	6.45e-03	NA	1.44e-04
3. B	Q921C3	Bromodomain and WD repeat-containing protein 1	4.59e-02	NA	1.13e-09
3. B	O94979	Protein transport protein Sec31A	3.92e-04	NA	1.54e-05
3. B	Q7RY68	Polyadenylation factor subunit 2	6.95e-03	NA	1.29e-06
3. B	F1MNN4	F-box/WD repeat-containing protein 7	2.78e-05	NA	4.92e-21
3. B	A0DB19	Lissencephaly-1 homolog 1	4.27e-13	NA	5.38e-13
3. B	Q54Y96	WD40 repeat-containing protein smu1	8.15e-05	NA	9.04e-09
3. B	Q66HC9	Dynein axonemal intermediate chain 2	2.00e-04	NA	0.031
3. B	Q9SY00	COMPASS-like H3K4 histone methylase component WDR5B	1.36e-07	NA	2.42e-15
3. B	O54929	WD repeat and SOCS box-containing protein 2	3.86e-04	NA	9.70e-07
3. B	Q6BIR1	Protein transport protein SEC13	9.95e-08	NA	3.47e-04
3. B	Q6NNP0	Autophagy-related protein 16	4.75e-07	NA	1.16e-06
3. B	Q9GZL7	Ribosome biogenesis protein WDR12	7.83e-05	NA	9.29e-06
3. B	D4DG66	Nuclear distribution protein PAC1	2.86e-11	NA	4.33e-07
3. B	Q8VZY6	Polycomb group protein FIE2	2.08e-06	NA	1.45e-05
3. B	Q55AR8	U5 small nuclear ribonucleoprotein 40 kDa protein	5.61e-07	NA	4.85e-10
3. B	Q55DA2	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	7.51e-11	NA	6.62e-06
3. B	Q873A1	Protein transport protein sec31	7.89e-04	NA	2.92e-08
3. B	O60336	Mitogen-activated protein kinase-binding protein 1	1.55e-07	NA	2.16e-07
3. B	P56094	General transcriptional corepressor TUP1	1.25e-04	NA	1.39e-09
3. B	Q91ZN1	Coronin-1A	4.97e-03	NA	7.93e-07
3. B	A2CEH0	POC1 centriolar protein homolog B	2.44e-04	NA	6.28e-14
3. B	Q58D00	F-box/WD repeat-containing protein 2	3.76e-06	NA	1.20e-07
3. B	P53962	Uncharacterized WD repeat-containing protein YNL035C	3.20e-05	NA	0.013
3. B	O54927	WD repeat and SOCS box-containing protein 1	2.32e-04	NA	1.02e-07
3. B	Q9Y0T2	F-box/WD repeat-containing protein A	2.02e-03	NA	1.31e-05
3. B	Q75C99	Histone acetyltransferase type B subunit 2	8.88e-06	NA	3.59e-16
3. B	Q5A7Q6	Nuclear distribution protein PAC1	5.19e-10	NA	2.09e-06
3. B	Q8VBV4	F-box/WD repeat-containing protein 7	2.69e-05	NA	7.26e-21
3. B	Q4X1Y0	Polyadenylation factor subunit 2	1.91e-03	NA	4.97e-08
3. B	P69104	Guanine nucleotide-binding protein subunit beta-like protein	5.70e-11	NA	1.10e-07
3. B	P53622	Coatomer subunit alpha	5.14e-08	NA	6.04e-09
3. B	Q9FNZ2	Zinc finger CCCH domain-containing protein 48	4.18e-04	NA	4.64e-06
3. B	O14301	Uncharacterized WD repeat-containing protein C9G1.05	0.00e+00	NA	4.14e-04
3. B	Q08E38	Pre-mRNA-processing factor 19	2.10e-08	NA	1.52e-11
3. B	Q9NSI6	Bromodomain and WD repeat-containing protein 1	1.73e-01	NA	1.20e-09
3. B	P0CS45	Mitochondrial division protein 1	3.53e-02	NA	5.46e-06
3. B	Q9D7H2	WD repeat-containing protein 5B	1.32e-07	NA	7.01e-13
3. B	O60508	Pre-mRNA-processing factor 17	8.13e-06	NA	1.93e-09
3. B	Q5BDU4	Protein hir1	5.66e-03	NA	1.34e-04
3. B	Q54RP0	UDP-galactose:fucoside alpha-3-galactosyltransferase	2.83e-03	NA	1.94e-04
3. B	Q54KM3	Anaphase-promoting complex subunit cdh1	6.79e-04	NA	6.24e-06
3. B	O75529	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	4.75e-04	NA	5.98e-14
3. B	A5DHD9	Protein transport protein SEC13	2.40e-08	NA	0.001
3. B	Q8WWQ0	PH-interacting protein	3.08e-02	NA	4.72e-09
3. B	Q75C26	Probable cytosolic iron-sulfur protein assembly protein 1	4.67e-11	NA	1.39e-07
3. B	Q94BM7	Protein SPA1-RELATED 4	2.68e-04	NA	7.88e-05
3. B	Q6ZQL4	WD repeat-containing protein 43	3.33e-03	NA	5.37e-05
3. B	Q4WEI5	Histone acetyltransferase type B subunit 2	1.73e-07	NA	3.97e-14
3. B	B8P4B0	Nuclear distribution protein PAC1-1	8.50e-12	NA	1.09e-11
3. B	Q5IS43	Platelet-activating factor acetylhydrolase IB subunit alpha	1.52e-08	NA	1.84e-15
3. B	B6K1G6	Probable cytosolic Fe-S cluster assembly factor SJAG_02895	5.71e-04	NA	4.32e-10
3. B	Q5FVA9	mRNA export factor	7.38e-06	NA	8.50e-06
3. B	Q8H594	Ribosome biogenesis protein WDR12 homolog	1.36e-04	NA	0.003
3. B	Q26458	Polycomb protein esc	7.21e-04	NA	8.82e-04
3. B	A7RHG8	Ribosome biogenesis protein WDR12 homolog (Fragment)	2.76e-04	NA	2.19e-05
3. B	C3XVT5	Lissencephaly-1 homolog	5.81e-13	NA	3.68e-19
3. B	Q8HXL3	WD repeat-containing protein 62	1.79e-06	NA	3.19e-04
3. B	Q96DI7	U5 small nuclear ribonucleoprotein 40 kDa protein	1.21e-06	NA	7.64e-11
3. B	B8M7Q5	Probable E3 ubiquitin ligase complex SCF subunit sconB	6.64e-03	NA	1.57e-12
3. B	Q2UA71	Histone acetyltransferase type B subunit 2	1.99e-07	NA	2.47e-12
3. B	O22467	Histone-binding protein MSI1	3.21e-07	NA	4.62e-10
3. B	Q9DCE5	p21-activated protein kinase-interacting protein 1	1.20e-08	NA	2.03e-04
3. B	Q8BHD1	POC1 centriolar protein homolog B	2.93e-04	NA	6.81e-10
3. B	Q6CSI1	Histone acetyltransferase type B subunit 2	1.30e-06	NA	1.11e-11
3. B	C5GVJ9	Nuclear distribution protein PAC1	3.63e-10	NA	1.60e-07
3. B	P90916	Probable histone-binding protein lin-53	2.89e-06	NA	1.09e-11
3. B	A1CBP8	Mitochondrial division protein 1	7.27e-03	NA	2.62e-08
3. B	Q6CGP9	Polyadenylation factor subunit 2	8.22e-05	NA	2.08e-07
3. B	F4IIK6	Non-functional target of rapamycin complex subunit LST8-2	3.91e-08	NA	0.031
3. B	Q8VZS9	Protein FIZZY-RELATED 1	2.36e-04	NA	7.59e-11
3. B	A1CGS0	Protein transport protein sec13	7.61e-08	NA	9.35e-06
3. B	Q9VKQ3	Ribosome biogenesis protein WDR12 homolog	2.71e-05	NA	4.23e-04
3. B	Q0P593	Dynein assembly factor with WDR repeat domains 1	2.20e-05	NA	2.40e-17
3. B	Q54DS8	Protein SEC13 homolog	6.51e-08	NA	0.009
3. B	Q71UF4	Histone-binding protein RBBP7	8.09e-07	NA	8.97e-11
3. B	Q0CLJ4	Ribosome biogenesis protein ytm1	1.70e-04	NA	0.020
3. B	Q8VYZ5	Periodic tryptophan protein 2	4.10e-07	NA	6.33e-11
3. B	P54686	Actin-interacting protein 1	1.38e-13	NA	0.007
3. B	A8NEG8	Nuclear distribution protein PAC1	5.85e-12	NA	4.60e-13
3. B	P58404	Striatin-4	2.44e-03	NA	0.006
3. B	Q8C6G8	WD repeat-containing protein 26	7.94e-07	NA	5.31e-11
3. B	A8Q2R5	WD repeat-containing protein 48 homolog	4.51e-04	NA	0.008
3. B	P58405	Striatin-3	1.98e-03	NA	4.45e-07
3. B	Q5BJ90	Ribosome biogenesis protein wdr12	2.61e-05	NA	1.46e-06
3. B	Q4R6D2	mRNA export factor	1.16e-05	NA	1.75e-06
3. B	A2QI22	Ribosome biogenesis protein ytm1	1.74e-04	NA	0.017
3. B	Q6AZS2	Polycomb protein eed-B	4.82e-04	NA	0.028
3. B	O82266	Protein SLOW WALKER 1	3.39e-05	NA	2.32e-06
3. B	Q68EI0	WD repeat-containing protein 18	1.32e-03	NA	2.20e-04
3. B	Q6BU94	Pre-mRNA-splicing factor PRP46	3.51e-05	NA	7.08e-10
3. B	Q09028	Histone-binding protein RBBP4	1.84e-06	NA	1.39e-09
3. B	Q5M786	WD repeat-containing protein 5	4.82e-08	NA	4.61e-13
3. B	O89046	Coronin-1B	3.76e-03	NA	2.10e-07
3. B	Q5XX13	F-box/WD repeat-containing protein 10	7.29e-03	NA	9.84e-05
3. B	B6QC06	Nuclear distribution protein nudF 2	3.39e-11	NA	1.16e-08
3. B	Q2UFN8	Probable E3 ubiquitin ligase complex SCF subunit sconB	7.69e-03	NA	8.51e-12
3. B	Q4WNK7	Protein transport protein sec13	1.08e-07	NA	5.92e-06
3. B	Q8LPL5	Protein FIZZY-RELATED 3	2.48e-04	NA	0.001
3. B	Q6BK34	Histone acetyltransferase type B subunit 2	8.69e-07	NA	7.87e-08
3. B	A4RD35	Protein transport protein SEC31	2.61e-03	NA	1.99e-06
3. B	Q61Y48	Probable histone-binding protein lin-53	2.78e-06	NA	6.88e-12
3. B	O24467	LEC14B homolog	7.16e-08	NA	0.001
3. B	P62872	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.52e-12	NA	3.79e-06
3. B	P39108	Peroxisomal targeting signal 2 receptor	1.12e-12	NA	0.003
3. B	Q03897	Maintenance of telomere capping protein 5	5.33e-03	NA	0.001
3. B	Q9ERG2	Striatin-3	5.88e-03	NA	4.13e-07
3. B	Q6P3H7	Histone-binding protein RBBP4	1.73e-06	NA	3.49e-10
3. B	O13686	Uncharacterized RWD, RING finger and WD repeat-containing protein C11E3.05	1.57e-02	NA	0.041
3. B	Q2HBX6	Nuclear distribution protein PAC1-1	4.47e-08	NA	5.34e-16
3. B	Q148I1	Proteasomal ATPase-associated factor 1	2.95e-05	NA	2.37e-04
3. B	Q6CL75	Protein transport protein SEC31	2.84e-03	NA	0.002
3. B	Q10282	Guanine nucleotide-binding protein subunit beta	2.83e-12	NA	3.06e-07
3. B	Q5E959	Serine-threonine kinase receptor-associated protein	8.57e-06	NA	0.007
3. B	A2RRU3	U3 small nucleolar RNA-associated protein 15 homolog	1.59e-04	NA	9.25e-10
3. B	Q6BIR9	Probable cytosolic iron-sulfur protein assembly protein 1	5.81e-10	NA	1.38e-05
3. B	O22785	Pre-mRNA-processing factor 19 homolog 2	2.57e-05	NA	0.021
3. B	P53699	Cell division control protein 4	1.62e-05	NA	1.48e-08
3. B	Q19124	Autophagic-related protein 16.1	1.57e-06	NA	5.30e-04
3. B	Q54W52	Ribosome biogenesis protein WDR12 homolog	3.01e-04	NA	0.007
3. B	A6ZPA9	Ribosome biogenesis protein YTM1	7.43e-05	NA	0.041
3. B	Q5EA99	p21-activated protein kinase-interacting protein 1	1.25e-03	NA	1.07e-04
3. B	F4HTH8	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2	1.36e-04	NA	2.23e-10
3. B	Q13610	Periodic tryptophan protein 1 homolog	7.49e-05	NA	1.13e-05
3. B	Q0CHM0	Protein transport protein sec13	8.80e-08	NA	1.27e-05
3. B	Q9JMJ4	Pre-mRNA-processing factor 19	2.89e-05	NA	2.72e-11
3. B	P93339	Guanine nucleotide-binding protein subunit beta	NA	NA	3.20e-09
3. B	Q8BH44	Coronin-2B	2.85e-03	NA	1.67e-07
3. B	O76734	General transcriptional corepressor tupA	8.34e-04	NA	2.46e-14
3. B	P59235	Nucleoporin Nup43	5.76e-09	NA	1.29e-04
3. B	Q93847	WD repeat-containing protein wdr-5.2	1.16e-04	NA	1.57e-11
3. B	Q2TAY7	WD40 repeat-containing protein SMU1	1.15e-05	NA	1.71e-07
3. B	P0CS44	Mitochondrial division protein 1	2.21e-02	NA	5.46e-06
3. B	P26308	Guanine nucleotide-binding protein subunit beta-1	2.51e-12	NA	1.15e-08
3. B	O94620	Pre-mRNA-splicing factor cwf17	9.10e-07	NA	0.003
3. B	Q6BRR2	Protein transport protein SEC31	8.02e-04	NA	5.53e-06
3. B	Q1LZ08	WD repeat-containing protein 48 homolog	3.66e-03	NA	2.43e-04
3. B	Q4V7A0	WD repeat-containing protein 61	8.42e-11	NA	1.94e-04
3. B	Q5AG86	Probable cytosolic iron-sulfur protein assembly protein 1	5.07e-10	NA	1.19e-05
3. B	P33215	Protein NEDD1	8.64e-06	NA	2.30e-04
3. B	Q9T014	Protein SPA1-RELATED 2	3.09e-06	NA	0.001
3. B	O43379	WD repeat-containing protein 62	5.81e-06	NA	0.001
3. B	A7TNS8	CCR4-associated factor 4 homolog	1.88e-03	NA	2.61e-08
3. B	Q61011	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	3.07e-12	NA	1.18e-08
3. B	A3LNW3	Protein transport protein SEC13	2.59e-08	NA	0.044
3. B	Q6DDF0	WD repeat-containing protein 37	2.07e-06	NA	6.86e-09
3. B	Q8QFR2	Protein HIRA	6.92e-04	NA	2.37e-05
3. B	Q7K1Y4	Probable cytosolic iron-sulfur protein assembly protein Ciao1	4.24e-12	NA	3.35e-06
3. B	Q8K3E5	Jouberin	1.13e-02	NA	1.11e-07
3. B	Q4R8H1	F-box-like/WD repeat-containing protein TBL1X	6.38e-07	NA	1.24e-26
3. B	B5X3Z6	Lissencephaly-1 homolog A	5.94e-13	NA	1.14e-15
3. B	Q39836	Guanine nucleotide-binding protein subunit beta-like protein	1.36e-11	NA	1.37e-07
3. B	Q7RY30	Nuclear distribution protein nudF-2	1.17e-08	NA	2.11e-13
3. B	A5E2R6	Probable cytosolic iron-sulfur protein assembly protein 1	9.49e-10	NA	7.17e-04
3. B	D4AM37	Probable E3 ubiquitin ligase complex SCF subunit sconB	6.14e-08	NA	8.28e-13
3. B	Q5REG7	Platelet-activating factor acetylhydrolase IB subunit alpha	5.92e-09	NA	2.33e-16
3. B	P62874	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.37e-12	NA	3.79e-06
3. B	A2QPW4	Probable cytosolic iron-sulfur protein assembly protein 1	2.61e-04	NA	0.003
3. B	Q5U4F6	Cytoplasmic dynein 2 intermediate chain 2	5.32e-05	NA	3.43e-04
3. B	Q06078	U3 small nucleolar RNA-associated protein 21	3.15e-06	NA	0.047
3. B	Q759U7	Nuclear distribution protein PAC1	2.61e-07	NA	0.008
3. B	Q9UT57	Probable cytosolic Fe-S cluster assembly factor SPAC806.02c	8.51e-04	NA	2.64e-06
3. B	Q5B563	Protein transport protein sec13	4.22e-08	NA	8.31e-06
3. B	Q5NVK4	Coronin-1B	3.01e-03	NA	2.87e-08
3. B	Q9C1X0	Uncharacterized WD repeat-containing protein C713.05	2.58e-11	NA	0.013
3. B	Q62623	Cell division cycle protein 20 homolog	8.75e-04	NA	4.81e-13
3. B	Q8VDD9	PH-interacting protein	7.19e-02	NA	6.50e-09
3. B	Q92176	Coronin-1A	1.67e-03	NA	4.36e-07
3. B	C4JZS6	Nuclear distribution protein PAC1-1	2.67e-12	NA	1.89e-06
3. B	Q6BLS5	Ribosome biogenesis protein YTM1	1.43e-03	NA	0.018
3. B	B4GAJ1	Lissencephaly-1 homolog	6.81e-13	NA	1.64e-18
3. B	Q6C414	Protein transport protein SEC31	1.81e-04	NA	1.46e-05
3. B	P0CS39	Protein HIR1	1.31e-04	NA	0.002
3. B	P42527	Myosin heavy chain kinase A	1.96e-02	NA	4.54e-07
3. B	P0CS55	Ribosome biogenesis protein YTM1	3.06e-04	NA	2.90e-09
3. B	Q5REE6	Ribosome biogenesis protein WDR12	3.35e-05	NA	1.13e-05
3. B	Q54JS5	GATOR complex protein WDR24	1.43e-04	NA	7.90e-10
3. B	Q9SYX2	Protein SUPPRESSOR OF PHYA-105 1	1.27e-05	NA	0.023
3. B	P0CS36	Histone acetyltransferase type B subunit 2	2.76e-08	NA	2.50e-18
3. B	Q969H0	F-box/WD repeat-containing protein 7	2.74e-05	NA	7.65e-21
3. B	Q4P5F5	Probable cytosolic iron-sulfur protein assembly protein 1	6.17e-07	NA	0.001
3. B	A7S338	Lissencephaly-1 homolog	6.34e-13	NA	1.69e-15
3. B	P78972	WD repeat-containing protein slp1	4.58e-04	NA	0.029
3. B	Q676U5	Autophagy-related protein 16-1	7.67e-04	NA	7.44e-05
3. B	Q652L2	Protein HIRA	3.52e-03	NA	6.12e-08
3. B	B8NGT5	Probable E3 ubiquitin ligase complex SCF subunit sconB	9.31e-04	NA	8.30e-12
3. B	A5DHD2	Probable cytosolic iron-sulfur protein assembly protein 1	4.83e-10	NA	0.001
3. B	Q40687	Guanine nucleotide-binding protein subunit beta	3.19e-11	NA	2.08e-07
3. B	Q6P315	Histone-binding protein RBBP7	4.92e-07	NA	4.17e-10
3. B	P36130	CCR4-associated factor 4	2.59e-07	NA	2.17e-09
3. B	Q6DFF9	Mitogen-activated protein kinase-binding protein 1	3.93e-05	NA	1.78e-07
3. B	Q6PFM9	WD repeat-containing protein 48	1.62e-03	NA	4.22e-04
3. B	Q9WUM3	Coronin-1B	3.28e-03	NA	9.34e-08
3. B	D1ZEM6	Nuclear distribution protein PAC1-2	7.30e-06	NA	5.00e-11
3. B	Q1DX43	Protein transport protein SEC31	2.67e-03	NA	0.006
3. B	Q9UTN4	Polyadenylation factor subunit 2	6.12e-04	NA	3.46e-11
3. B	Q5BK30	Dynein assembly factor with WDR repeat domains 1	2.29e-05	NA	2.56e-17
3. B	O94423	Meiotic fizzy-related protein 1	2.85e-09	NA	8.12e-06
3. B	Q9I9H8	Apoptotic protease-activating factor 1	5.98e-06	NA	1.43e-10
3. B	B4LJT7	Probable cytosolic iron-sulfur protein assembly protein Ciao1	3.62e-12	NA	3.20e-09
3. B	O22469	WD-40 repeat-containing protein MSI3	3.62e-09	NA	9.42e-11
3. B	P23232	Guanine nucleotide-binding protein subunit beta	2.41e-12	NA	4.88e-07
3. B	Q11176	Actin-interacting protein 1	0.00e+00	NA	0.002
3. B	Q8W117	Suppressor of mec-8 and unc-52 protein homolog 1	1.29e-06	NA	9.10e-08
3. B	Q6DUZ9	EARP-interacting protein homolog	4.27e-10	NA	0.040
3. B	Q5DFU0	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	2.21e-11	NA	2.55e-05
3. B	Q8K0G5	EARP and GARP complex-interacting protein 1	4.38e-10	NA	0.003
3. B	Q810D6	Glutamate-rich WD repeat-containing protein 1	1.39e-05	NA	2.98e-12
3. B	Q9SXY1	Chromatin assembly factor 1 subunit FAS2	1.73e-07	NA	0.004
3. B	O14170	WD repeat-containing protein pop2	6.24e-03	NA	2.29e-11
3. B	Q54R82	Mitogen-activated protein kinase kinase kinase A	1.42e-07	NA	1.23e-05
3. B	Q5A7Q3	Pre-mRNA-splicing factor PRP46	1.46e-05	NA	9.65e-07
3. B	B6H7A3	Probable cytosolic iron-sulfur protein assembly protein 1	2.09e-04	NA	1.69e-07
3. B	B7QKS1	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	1.21e-11	NA	2.01e-06
3. B	O16023	Polycomb protein esc	1.06e-03	NA	0.001
3. B	Q9QXE7	F-box-like/WD repeat-containing protein TBL1X	5.91e-07	NA	2.78e-25
3. B	P0CS47	Polyadenylation factor subunit 2	8.62e-04	NA	2.04e-08
3. B	Q9BZK7	F-box-like/WD repeat-containing protein TBL1XR1	6.52e-05	NA	6.84e-25
3. B	Q7ZXZ2	U3 small nucleolar RNA-associated protein 15 homolog	1.35e-04	NA	1.83e-10
3. B	P91341	Periodic tryptophan protein 2 homolog	7.52e-06	NA	0.002
3. B	P90648	Myosin heavy chain kinase B	1.71e-03	NA	3.18e-13
3. B	G0SC29	Ribosome assembly protein 4	1.99e-05	NA	2.11e-19
3. B	Q6TMK6	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	NA	NA	2.66e-06
3. B	Q54ZP5	WD repeat-containing protein 48 homolog	1.65e-01	NA	0.025
3. B	Q4R7Y4	Guanine nucleotide-binding protein subunit beta-2-like 1	2.12e-10	NA	2.25e-06
3. B	Q91WQ5	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	3.47e-04	NA	1.17e-13
3. B	P97260	Sterol regulatory element-binding protein cleavage-activating protein	2.14e-02	NA	1.44e-04
3. B	Q0CYG9	Protein transport protein sec31	3.72e-04	NA	5.14e-05
3. B	S8ASK6	WD40 repeat protein poxJ	NA	NA	4.49e-04
3. B	A5D7H2	Striatin-3	4.18e-03	NA	1.31e-07
3. B	B4J8H6	WD repeat-containing protein 48 homolog	6.93e-04	NA	2.28e-05
3. B	A7THX0	Mitochondrial division protein 1	7.53e-07	NA	2.62e-10
3. B	P0CS50	Protein transport protein SEC13	1.77e-07	NA	0.028
3. B	B3RQN1	Ribosome biogenesis protein WDR12 homolog	8.03e-05	NA	1.76e-06
3. B	Q26544	WD repeat-containing protein SL1-17	NA	NA	0.032
3. B	O14186	Uncharacterized WD repeat-containing protein C4F8.11	6.12e-04	NA	1.33e-04
3. B	Q28D01	WD repeat-containing protein 26	3.36e-07	NA	2.73e-12
3. B	O13923	Coronin-like protein crn1	1.42e-02	NA	8.26e-09
3. B	Q9C1X1	Periodic tryptophan protein 2 homolog	2.68e-06	NA	4.04e-04
3. B	Q9VLN1	WD repeat-containing protein 82	5.06e-09	NA	0.001
3. B	Q4P8R5	Mitochondrial division protein 1	4.58e-02	NA	4.69e-08
3. B	F1DLK1	Protein DECREASED SIZE EXCLUSION LIMIT 1	3.72e-09	NA	0.023
3. B	B0R0D7	Coronin-1C-A	3.41e-03	NA	2.43e-08
3. B	A6ZQL5	Mitochondrial division protein 1	2.18e-04	NA	8.65e-06
3. B	O64740	Protein transport protein SEC13 homolog B	7.56e-08	NA	0.012
3. B	P54703	Cytoplasmic dynein 1 intermediate chain	2.95e-03	NA	0.034
3. B	P49695	Probable serine/threonine-protein kinase PkwA	7.62e-05	NA	8.87e-19
3. B	Q9NQW1	Protein transport protein Sec31B	4.10e-05	NA	1.20e-07
3. B	Q95RJ9	F-box-like/WD repeat-containing protein ebi	4.54e-06	NA	1.91e-22
3. B	O74319	Transcription initiation factor TFIID subunit taf73	1.84e-08	NA	1.01e-11
3. B	Q6BUA6	Nuclear distribution protein PAC1	1.61e-06	NA	3.18e-06
3. B	Q3ULA2	F-box/WD repeat-containing protein 1A	4.67e-05	NA	1.21e-15
3. B	Q05B17	WD repeat-containing protein 48	2.38e-03	NA	2.83e-04
3. B	Q39190	Protein pleiotropic regulator PRL2	6.32e-06	NA	4.73e-10
3. B	B8MWR8	Probable cytosolic iron-sulfur protein assembly protein 1	8.71e-10	NA	5.10e-04
3. B	Q93134	Guanine nucleotide-binding protein subunit beta-2-like 1	7.92e-11	NA	1.42e-04
3. B	P61965	WD repeat-containing protein 5	4.69e-08	NA	2.95e-14
3. B	Q9XS70	Coronin-1B	3.48e-03	NA	4.03e-07
3. B	B4KRQ4	WD repeat-containing protein 48 homolog	4.20e-04	NA	3.31e-05
3. B	Q8I0F4	Lissencephaly-1 homolog	4.64e-13	NA	1.13e-13
3. B	B0XM00	Nuclear distribution protein nudF	5.35e-11	NA	6.77e-08
3. B	Q96J01	THO complex subunit 3	3.20e-05	NA	1.26e-08
3. B	P29829	Guanine nucleotide-binding protein subunit beta-2	2.21e-12	NA	1.17e-09
3. B	P49178	Guanine nucleotide-binding protein subunit beta	1.64e-11	NA	3.62e-09
3. B	Q5U2W5	Transducin beta-like protein 3	2.43e-09	NA	3.80e-13
3. B	Q32PG3	WD repeat-containing protein 48	1.07e-03	NA	0.001
3. B	P43033	Platelet-activating factor acetylhydrolase IB subunit beta	5.47e-09	NA	3.14e-16
3. B	Q6FJS0	Polyadenylation factor subunit 2	1.32e-05	NA	3.49e-09
3. B	Q6CSZ5	Protein transport protein SEC13	1.01e-07	NA	8.84e-05
3. B	Q5RF99	mRNA export factor	1.23e-05	NA	6.79e-07
3. B	Q5ZJH5	WD repeat-containing protein 61	9.93e-12	NA	2.61e-06
3. B	Q00808	Vegetative incompatibility protein HET-E-1	2.90e-07	NA	2.24e-29
3. B	P63246	Receptor of activated protein C kinase 1	1.98e-10	NA	2.25e-06
3. B	A0AUS0	WD repeat, SAM and U-box domain-containing protein 1	4.41e-04	NA	9.27e-09
3. B	A8IR43	Ribosome biogenesis protein WDR12 homolog	4.33e-04	NA	6.23e-05
3. B	C0S902	Nuclear distribution protein PAC1	2.12e-10	NA	8.69e-09
3. B	P78406	mRNA export factor	1.15e-05	NA	6.79e-07
3. B	Q8N136	Dynein assembly factor with WDR repeat domains 1	2.59e-05	NA	4.08e-18
3. B	Q6NS57	Mitogen-activated protein kinase-binding protein 1	6.65e-06	NA	1.04e-06
3. B	P20484	Protein MAK11	5.55e-04	NA	4.81e-05
3. B	A5GFN6	mRNA export factor	1.16e-05	NA	1.09e-06
3. B	Q5RBW3	Coronin-7	9.76e-07	NA	4.01e-05
3. B	Q0UXP3	Ribosome biogenesis protein YTM1	1.17e-04	NA	1.17e-05
3. B	Q0U2T3	Mitochondrial division protein 1	5.88e-03	NA	1.81e-05
3. B	O75083	WD repeat-containing protein 1	2.73e-13	NA	7.96e-05
3. B	P87060	WD repeat-containing protein pop1	4.48e-05	NA	2.69e-07
3. B	P0CS43	Nuclear distribution protein PAC1	4.72e-12	NA	1.18e-14
3. B	B9WHJ2	Probable cytosolic iron-sulfur protein assembly protein 1	4.92e-10	NA	1.22e-06
3. B	B6GZD3	Nuclear distribution protein nudF 2	4.70e-09	NA	3.90e-10
3. B	A8XEN7	DDB1- and CUL4-associated factor 11 homolog	3.57e-07	NA	0.015
3. B	Q3SZ25	Polycomb protein EED	6.21e-05	NA	0.031
3. B	Q4P4R3	Protein HIR1	1.47e-03	NA	2.31e-04
3. B	Q8N0X2	Sperm-associated antigen 16 protein	2.14e-06	NA	2.79e-10
3. B	P54319	Phospholipase A-2-activating protein	3.91e-04	NA	7.91e-11
3. B	P38262	SIR4-interacting protein SIF2	4.72e-04	NA	9.71e-07
3. B	P55735	Protein SEC13 homolog	2.87e-08	NA	0.017
3. B	A8IZG4	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	1.07e-11	NA	5.19e-10
3. B	Q6GMD2	WD repeat-containing protein 61	9.47e-12	NA	2.46e-07
3. B	Q61ZF6	Guanine nucleotide-binding protein subunit beta-1	2.32e-12	NA	4.21e-06
3. B	B3NQR5	Probable cytosolic iron-sulfur protein assembly protein Ciao1	5.36e-12	NA	1.32e-06
3. B	Q7ZVA0	WD40 repeat-containing protein SMU1	6.34e-07	NA	8.93e-07
3. B	P57737	Coronin-7	2.79e-08	NA	1.42e-06
3. B	Q8K450	Sperm-associated antigen 16 protein	1.19e-04	NA	4.28e-10
3. B	O60137	Set1 complex component swd2	2.06e-07	NA	1.45e-04
3. B	B2RZ17	F-box/WD repeat-containing protein 2	4.16e-06	NA	2.15e-06
3. B	A2AKB9	DDB1- and CUL4-associated factor 10	1.73e-04	NA	0.005
3. B	Q54SA5	WD repeat-containing protein 55 homolog	5.97e-05	NA	9.24e-07
3. B	B0XFT7	Eukaryotic translation initiation factor 3 subunit I	1.10e-08	NA	0.008
3. B	A7EKM8	Nuclear distribution protein PAC1	1.05e-07	NA	3.22e-08
3. B	Q5F3K4	WD repeat-containing protein 48	6.11e-04	NA	0.002
3. B	Q3U821	WD repeat-containing protein 75	6.25e-06	NA	0.001
3. B	Q4V7Z1	POC1 centriolar protein homolog B	1.07e-04	NA	7.16e-11
3. B	B4HWV6	Ribosome biogenesis protein WDR12 homolog	2.92e-05	NA	6.03e-04
3. B	Q5SQM0	Echinoderm microtubule-associated protein-like 6	2.14e-04	NA	0.010
3. B	Q38960	WD repeat-containing protein LWD2	6.25e-07	NA	0.016
3. B	Q15542	Transcription initiation factor TFIID subunit 5	1.94e-04	NA	2.04e-13
3. B	Q5S580	Protein transport protein SEC31	7.08e-04	NA	0.017
3. B	Q01369	Guanine nucleotide-binding protein subunit beta-like protein	1.15e-10	NA	4.88e-05
3. B	Q09373	WD repeat-containing protein fzy-1	7.96e-04	NA	0.003
3. B	Q8N9V3	WD repeat, SAM and U-box domain-containing protein 1	8.20e-05	NA	1.52e-06
3. B	Q86Y33	Cell division cycle protein 20 homolog B	6.04e-04	NA	1.38e-04
3. B	Q5RFF8	Notchless protein homolog 1	2.13e-05	NA	4.77e-14
3. B	P46800	Guanine nucleotide-binding protein subunit beta-like protein	3.37e-12	NA	3.05e-08
3. B	O22607	WD-40 repeat-containing protein MSI4	8.87e-05	NA	1.21e-09
3. B	Q5ZMC3	WD repeat, SAM and U-box domain-containing protein 1	1.54e-04	NA	3.54e-07
3. B	Q6LA54	Uncharacterized WD repeat-containing protein C3H5.08c	1.45e-02	NA	4.70e-04
3. B	B3N534	Ribosome biogenesis protein WDR12 homolog	1.97e-04	NA	3.21e-04
3. B	Q9UKB1	F-box/WD repeat-containing protein 11	3.37e-05	NA	3.28e-16
3. B	Q6INH0	Histone-binding protein RBBP4-B	2.57e-06	NA	3.36e-09
3. B	O14775	Guanine nucleotide-binding protein subunit beta-5	9.57e-06	NA	1.04e-10
3. B	Q2UGK1	Ribosome biogenesis protein ytm1	3.39e-04	NA	0.043
3. B	Q54J37	Striatin homolog	1.38e-04	NA	5.60e-07
3. B	P87314	Protein hir1	1.13e-03	NA	0.004
3. B	Q9YGY3	Mitotic checkpoint protein BUB3	2.90e-09	NA	0.040
3. B	Q60973	Histone-binding protein RBBP7	2.50e-07	NA	8.82e-11
3. B	Q8BH57	WD repeat-containing protein 48	6.74e-03	NA	0.001
3. B	Q8C0P5	Coronin-2A	1.57e-03	NA	1.83e-04
3. B	Q8SRB0	Guanine nucleotide-binding protein subunit beta-like protein	3.16e-10	NA	0.002
3. B	B9WD30	Nuclear distribution protein PAC1	6.62e-10	NA	2.14e-06
3. B	B8AP31	Guanine nucleotide-binding protein subunit beta	3.73e-08	NA	2.08e-07
3. B	Q6PNB6	Guanine nucleotide-binding protein subunit beta-5	1.06e-11	NA	1.72e-10
3. B	Q12220	U3 small nucleolar RNA-associated protein 12	1.75e-06	NA	1.03e-08
3. B	Q5AXW3	Mitochondrial division protein 1	4.10e-03	NA	4.20e-07
3. B	A5DJX5	Nuclear distribution protein PAC1	1.16e-07	NA	1.49e-10
3. B	O74184	Target of rapamycin complex subunit wat1	5.06e-08	NA	1.17e-04
3. B	Q8N157	Jouberin	1.22e-02	NA	8.91e-05
3. B	A1C7E4	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.96e-03	NA	5.86e-12
3. B	Q0V8F1	Coronin-7	9.84e-09	NA	4.32e-07
3. B	Q9W2E7	Protein Rae1	1.25e-07	NA	0.002
3. B	Q5APF0	Ribosome biogenesis protein YTM1	3.11e-04	NA	4.08e-04
3. B	Q09990	F-box/WD repeat-containing protein lin-23	1.02e-03	NA	3.94e-13
3. B	Q54UI3	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4	3.24e-04	NA	0.002
3. B	O43017	Set1 complex component swd3	4.23e-08	NA	7.85e-14
3. B	Q3UKJ7	WD40 repeat-containing protein SMU1	8.04e-06	NA	1.71e-07
3. B	A3LX18	Eukaryotic translation initiation factor 3 subunit I	1.05e-08	NA	0.039
3. B	B6Q4Z5	Probable E3 ubiquitin ligase complex SCF subunit sconB	6.75e-04	NA	7.13e-13
3. B	D4D8P3	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.05e-04	NA	1.14e-12
3. B	Q75BS2	Protein transport protein SEC13	1.03e-07	NA	2.86e-06
3. B	Q9Y297	F-box/WD repeat-containing protein 1A	4.87e-05	NA	2.88e-16
3. B	B4GT01	Ribosome biogenesis protein WDR12 homolog	1.70e-04	NA	1.31e-04
3. B	Q9NRL3	Striatin-4	4.03e-03	NA	0.026
3. B	P57775	F-box/WD repeat-containing protein 4	2.00e-05	NA	0.026
3. B	Q9D1M0	Protein SEC13 homolog	2.86e-08	NA	0.006
3. B	Q5ZMV9	GATOR complex protein WDR24	6.41e-03	NA	6.04e-07
3. B	Q1DHE1	Protein HIR1	1.36e-03	NA	0.006
3. B	Q25189	Guanine nucleotide-binding protein subunit beta-like protein	2.07e-10	NA	1.38e-05
3. B	A2QCU8	Probable E3 ubiquitin ligase complex SCF subunit sconB	6.32e-03	NA	6.59e-12
3. B	Q9C4Z6	Receptor for activated C kinase 1B	1.32e-10	NA	2.85e-05
3. B	Q60972	Histone-binding protein RBBP4	2.28e-06	NA	1.39e-09
3. B	B4GDM7	Probable cytosolic iron-sulfur protein assembly protein Ciao1	4.58e-12	NA	5.17e-05
3. B	Q5R4F4	Protein transport protein Sec31A	1.26e-04	NA	1.20e-05
3. B	Q498F0	WD repeat-containing protein 44	8.79e-03	NA	0.021
3. B	Q6TNS2	p21-activated protein kinase-interacting protein 1-like	4.87e-06	NA	9.58e-05
3. B	Q229Z6	POC1 centriolar protein homolog	4.49e-03	NA	6.75e-09
3. B	O13982	Uncharacterized WD repeat-containing protein C25H1.08c	4.41e-06	NA	5.42e-07
3. B	C1GB49	Nuclear distribution protein PAC1	2.17e-10	NA	5.08e-09
3. B	P0DPA1	WD repeat-containing protein DDB_G0349043	5.75e-09	NA	8.50e-10
3. B	Q54MP8	Bromodomain and WD repeat-containing DDB_G0285837	6.54e-02	NA	2.45e-04
3. B	Q9SJT9	Coatomer subunit alpha-2	6.96e-06	NA	6.60e-10
3. B	Q8BU03	Periodic tryptophan protein 2 homolog	2.88e-07	NA	3.87e-05
3. B	A1DHK2	Protein transport protein sec31	7.41e-04	NA	7.96e-06
3. B	P36037	Protein DOA1	1.80e-04	NA	0.005
3. B	Q80ZD0	Guanine nucleotide-binding protein subunit beta-5	1.03e-11	NA	1.16e-10
3. B	O13282	Transcription initiation factor TFIID subunit 5	2.02e-08	NA	3.53e-10
3. B	B4P6P9	Lissencephaly-1 homolog	8.71e-13	NA	1.47e-17
3. B	Q9XZ25	GATOR complex protein WDR24	6.67e-04	NA	7.98e-10
3. B	O94289	Ubiquitin homeostasis protein lub1	8.09e-05	NA	3.04e-09
3. B	P79147	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	2.62e-12	NA	1.26e-08
3. B	O94365	U3 small nucleolar RNA-associated protein 15	1.99e-05	NA	1.42e-07
3. B	Q3SZK1	Angio-associated migratory cell protein	5.80e-05	NA	6.68e-04
3. B	B6GZA1	Probable E3 ubiquitin ligase complex SCF subunit sconB	7.61e-04	NA	6.12e-11
3. B	Q8NA23	WD repeat-containing protein 31	2.02e-05	NA	3.92e-04
3. B	B3MJV8	Ribosome biogenesis protein WDR12 homolog	1.28e-05	NA	6.52e-05
3. B	Q5RFQ3	Periodic tryptophan protein 2 homolog	1.46e-07	NA	1.44e-05
3. B	B4KKN1	Ribosome biogenesis protein WDR12 homolog	1.70e-04	NA	3.52e-04
3. B	Q20059	WD repeat-containing protein 48 homolog	9.92e-03	NA	0.006
3. B	A0JP70	WD repeat-containing protein 90	4.34e-09	NA	0.011
3. B	Q2UGU1	Nuclear distribution protein nudF	3.72e-11	NA	5.73e-09
3. B	O13046	WD repeat and HMG-box DNA-binding protein 1	7.29e-04	NA	4.24e-04
3. B	Q9UKT8	F-box/WD repeat-containing protein 2	4.43e-06	NA	1.22e-07
3. B	A4R2Q6	Ribosome biogenesis protein YTM1	1.15e-04	NA	2.99e-04
3. B	Q8NFH3	Nucleoporin Nup43	3.34e-09	NA	2.29e-04
3. B	B3MET8	WD repeat-containing protein 48 homolog	1.81e-03	NA	1.51e-04
3. B	Q9LXN4	Protein HIRA	2.08e-03	NA	5.34e-08
3. B	Q7S7N3	Histone acetyltransferase type B subunit 2	2.13e-07	NA	2.13e-10
3. B	Q3ZCC9	Protein SEC13 homolog	2.65e-08	NA	0.017
3. B	Q6PAX7	WD repeat-containing protein 1-B	0.00e+00	NA	0.002
3. B	Q8CFJ9	GATOR complex protein WDR24	5.58e-03	NA	2.41e-07
3. B	Q9Y2I8	WD repeat-containing protein 37	2.96e-03	NA	7.40e-10
3. B	O42937	Probable coatomer subunit beta'	8.85e-11	NA	5.46e-13
3. B	Q9M2Z2	COMPASS-like H3K4 histone methylase component WDR5A	3.54e-11	NA	6.17e-14
3. B	Q16MY0	WD repeat-containing protein 48 homolog	5.99e-04	NA	8.18e-04
3. B	A1C6X5	Protein transport protein sec31	1.89e-03	NA	1.18e-05
3. B	P63005	Platelet-activating factor acetylhydrolase IB subunit beta	2.15e-09	NA	3.03e-16
3. B	Q292E8	Probable cytosolic iron-sulfur protein assembly protein Ciao1	4.47e-12	NA	5.27e-05
3. B	Q2UF60	Protein transport protein sec31	4.74e-04	NA	2.19e-04
3. B	A5DB75	Protein transport protein SEC31	9.71e-05	NA	9.11e-09
3. B	P93340	Guanine nucleotide-binding protein subunit beta-like protein	1.18e-10	NA	1.31e-05
3. B	Q5RF92	Histone-binding protein RBBP4	1.85e-06	NA	1.42e-09
3. B	O60907	F-box-like/WD repeat-containing protein TBL1X	6.90e-07	NA	1.57e-25
3. B	A1Z8D0	Periodic tryptophan protein 1 homolog	9.21e-06	NA	6.44e-06
3. B	Q8CIE6	Coatomer subunit alpha	5.63e-09	NA	7.64e-10
3. B	D1ZEB4	Nuclear distribution protein PAC1-1	1.65e-08	NA	2.28e-13
3. B	B8N9H4	Nuclear distribution protein nudF	3.55e-11	NA	5.73e-09
3. B	Q5JTN6	WD repeat-containing protein 38	1.55e-10	NA	1.34e-11
3. B	Q5RD06	POC1 centriolar protein homolog B	3.12e-04	NA	4.92e-11
3. B	Q9Z1Z2	Serine-threonine kinase receptor-associated protein	6.82e-06	NA	0.004
3. B	P62879	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	2.53e-12	NA	3.47e-07
3. B	Q2GSM6	Protein transport protein SEC13	1.34e-07	NA	4.91e-06
3. B	Q32PJ6	Probable cytosolic iron-sulfur protein assembly protein CIAO1	4.01e-08	NA	5.22e-09
3. B	O14021	RbAp48-related WD40 repeat-containing protein prw1	8.59e-07	NA	6.49e-09
3. B	Q55563	Uncharacterized WD repeat-containing protein sll0163	1.83e-05	NA	1.91e-14
3. B	Q6CP71	Polyadenylation factor subunit 2	8.47e-06	NA	1.94e-07
3. B	B0XAF3	Probable cytosolic iron-sulfur protein assembly protein Ciao1	3.49e-12	NA	2.43e-08
3. B	Q2H139	Mitochondrial division protein 1	3.94e-03	NA	1.75e-06
3. B	D3ZW91	POC1 centriolar protein homolog B	2.47e-04	NA	1.94e-10
3. B	Q9P5P0	Probable cytosolic iron-sulfur protein assembly protein 1	1.46e-09	NA	0.014
3. B	O60161	U3 small nucleolar RNA-associated protein 4	3.17e-07	NA	0.021
3. B	Q9H2Y7	Zinc finger protein 106	1.16e-02	NA	0.006
3. B	O42858	Set1 complex component swd1	5.33e-06	NA	7.30e-04
3. B	O62471	Protein qui-1	1.45e-05	NA	1.88e-06
3. B	Q7K0L4	WD repeat-containing protein 26 homolog	2.91e-07	NA	6.91e-14
3. B	A6ZZZ8	CCR4-associated factor 4	1.56e-04	NA	3.57e-09
3. B	P68040	Receptor of activated protein C kinase 1	2.02e-10	NA	2.25e-06
3. B	Q0UYV9	DNA damage-binding protein CMR1	2.14e-05	NA	0.012
3. B	Q9Y6I7	WD repeat and SOCS box-containing protein 1	2.16e-04	NA	6.54e-09
3. B	Q9WUC8	Pleiotropic regulator 1	4.44e-04	NA	5.11e-12
3. B	Q5RKI0	WD repeat-containing protein 1	2.15e-13	NA	2.02e-04
3. B	O61585	Katanin p80 WD40 repeat-containing subunit B1	8.42e-04	NA	1.35e-11
3. B	B2VZH2	Ribosome biogenesis protein ytm1	7.87e-05	NA	2.95e-08
3. B	Q5ZME8	WD40 repeat-containing protein SMU1	3.04e-06	NA	1.02e-07
3. B	Q8WQ85	Villidin	8.33e-02	NA	1.95e-04
3. B	Q5AI86	Eukaryotic translation initiation factor 3 subunit I	3.14e-07	NA	0.037
3. B	P93397	Guanine nucleotide-binding protein subunit beta-1	1.42e-08	NA	6.61e-10
3. B	P74598	Uncharacterized WD repeat-containing protein sll1491	8.84e-07	NA	3.90e-05
3. B	Q17BB0	Ribosome biogenesis protein WDR12 homolog	7.45e-05	NA	2.50e-08
3. B	B0W517	Ribosome biogenesis protein WDR12 homolog	1.97e-04	NA	9.74e-06
3. B	Q9LPV9	WD repeat-containing protein LWD1	1.32e-09	NA	0.006
3. B	Q5RE95	WD repeat-containing protein 5B	1.31e-07	NA	6.36e-13
3. B	Q06440	Coronin-like protein	9.57e-03	NA	3.34e-08
3. B	O00628	Peroxisomal targeting signal 2 receptor	2.95e-12	NA	4.15e-20
3. B	Q5MNU5	Sterol regulatory element-binding protein cleavage-activating protein	3.89e-02	NA	1.45e-04
3. B	P97865	Peroxisomal targeting signal 2 receptor	2.12e-12	NA	3.04e-19
3. B	Q5RBZ2	Methylosome protein 50	2.10e-07	NA	0.002
3. B	P33750	Protein SOF1	1.07e-04	NA	1.04e-05
3. B	Q6PBD6	WD repeat-containing protein 61	1.14e-11	NA	5.38e-08
3. B	Q17N69	Lissencephaly-1 homolog	7.79e-13	NA	3.94e-17
3. B	Q8N5D0	WD and tetratricopeptide repeats protein 1	2.32e-03	NA	0.024
3. B	Q9XGN1	Protein TRANSPARENT TESTA GLABRA 1	1.26e-09	NA	5.33e-04
3. B	Q54SD4	Probable histone-binding protein rbbD	3.12e-07	NA	1.42e-12
3. B	B4P7H8	WD repeat-containing protein 48 homolog	5.61e-04	NA	2.17e-04
3. B	Q6C709	Pre-mRNA-splicing factor PRP46	4.45e-06	NA	8.34e-09
3. B	Q5BIM8	DNA excision repair protein ERCC-8	2.39e-08	NA	5.82e-04
3. B	Q8C7V3	U3 small nucleolar RNA-associated protein 15 homolog	2.38e-04	NA	2.33e-09
3. B	Q758R7	Mitochondrial division protein 1	5.36e-03	NA	1.31e-06
3. B	P43034	Platelet-activating factor acetylhydrolase IB subunit beta	5.96e-13	NA	2.95e-16
3. B	P27612	Phospholipase A-2-activating protein	9.89e-04	NA	6.39e-11
3. B	B4P7Q3	Probable cytosolic iron-sulfur protein assembly protein Ciao1	5.22e-12	NA	9.78e-07
3. B	Q9USR0	DNA excision repair protein ckn1	2.50e-07	NA	3.95e-09
3. B	A1DDL6	Mitochondrial division protein 1	6.82e-03	NA	2.92e-06
3. B	Q6FT96	Mitochondrial division protein 1	3.24e-04	NA	1.13e-09
3. B	Q9UT85	Uncharacterized WD repeat-containing protein C343.04c	1.97e-09	NA	1.16e-07
3. B	Q9FE91	Zinc finger CCCH domain-containing protein 62	1.17e-03	NA	1.36e-05
3. B	A8PTE4	Mitochondrial division protein 1	4.13e-03	NA	3.03e-07
3. B	Q9VAT2	DDB1- and CUL4-associated factor 10 homolog	1.59e-02	NA	0.010
3. B	Q9UQ03	Coronin-2B	3.07e-03	NA	1.45e-07
3. B	O75717	WD repeat and HMG-box DNA-binding protein 1	1.43e-04	NA	0.011
3. B	Q6NVS5	DDB1- and CUL4-associated factor 13	4.37e-04	NA	0.004
3. B	B3MEY6	Lissencephaly-1 homolog	5.94e-09	NA	1.80e-18
3. B	A4REK3	Protein transport protein SEC13	1.15e-07	NA	3.87e-08
3. B	A1DHW6	Probable E3 ubiquitin ligase complex SCF subunit sconB	6.63e-04	NA	8.35e-12
3. B	O14727	Apoptotic protease-activating factor 1	2.86e-08	NA	5.36e-08
3. B	Q2U5Z8	Mitochondrial division protein 1	1.32e-02	NA	2.60e-04
3. B	Q7YR70	Angio-associated migratory cell protein	3.07e-04	NA	0.004
3. B	B2B766	Nuclear distribution protein PAC1-2	8.99e-11	NA	5.76e-06
3. B	Q2KJH4	WD repeat-containing protein 1	2.31e-13	NA	0.015
3. B	Q5BE22	Pre-mRNA-splicing factor prp46	3.73e-06	NA	3.35e-10
3. B	G8SD34	NAD(+) hydrolase ApTIR	3.98e-08	NA	3.79e-10
3. B	Q7ZW33	U3 small nucleolar RNA-associated protein 15 homolog	7.38e-05	NA	8.91e-11
3. B	Q9U1Q0	EARP-interacting protein 1	5.39e-10	NA	2.48e-06
3. B	Q756D0	Ribosome biogenesis protein YTM1	6.24e-05	NA	5.34e-04
3. B	Q58E77	WD repeat-containing protein 82-B	4.49e-10	NA	0.017
3. B	Q10G81	Histone-binding protein MSI1 homolog	2.94e-07	NA	4.08e-10
3. B	G4MQX3	MST50-interacting protein 11	1.25e-10	NA	3.50e-04
3. B	Q9W7F2	WD repeat-containing protein 1-A	2.01e-13	NA	0.001
3. B	D5GBI7	Nuclear distribution protein PAC1	4.68e-11	NA	3.21e-07
3. B	Q9BQA1	Methylosome protein 50	2.03e-07	NA	0.005
3. B	P0CS51	Protein transport protein SEC13	3.41e-07	NA	0.028
3. B	Q13033	Striatin-3	2.60e-03	NA	1.94e-05
3. B	Q9W1J3	Gastrulation defective protein 1 homolog	1.51e-03	NA	0.046
3. B	O89053	Coronin-1A	4.57e-03	NA	3.64e-07
3. B	P0CS49	Pre-mRNA-splicing factor PRP46	3.71e-06	NA	2.63e-11
3. B	Q5RHI5	Denticleless protein homolog	4.79e-04	NA	2.63e-07
3. B	Q75AV4	Polyadenylation factor subunit 2	6.24e-05	NA	4.67e-06
3. B	O74855	Ribosome assembly protein 4	1.07e-05	NA	8.23e-17
3. B	P74442	Uncharacterized WD repeat-containing protein slr0143	2.13e-06	NA	2.35e-13
3. B	P93563	Guanine nucleotide-binding protein subunit beta	2.23e-08	NA	1.50e-08
3. B	O75530	Polycomb protein EED	6.30e-05	NA	0.030
3. B	Q6C7Q4	Histone acetyltransferase type B subunit 2	2.16e-06	NA	1.24e-07
3. B	Q2UBU2	Protein HIR1	1.00e-03	NA	0.002
3. B	B4Q9T6	Ribosome biogenesis protein WDR12 homolog	1.78e-04	NA	0.002
3. B	Q7PP77	Eukaryotic translation initiation factor 3 subunit I	3.42e-10	NA	0.005
3. B	Q6FWT9	Nuclear distribution protein PAC1	1.71e-09	NA	0.002
3. B	B4LS78	Ribosome biogenesis protein WDR12 homolog	6.94e-05	NA	5.83e-05
3. B	A6QM06	Sterol regulatory element-binding protein cleavage-activating protein	2.22e-02	NA	1.42e-04
3. B	Q4IBR4	Protein HIR1	2.95e-04	NA	0.049
3. B	Q5ZK69	Proteasomal ATPase-associated factor 1	1.82e-05	NA	4.08e-06
3. B	Q75BY3	Pre-mRNA-splicing factor PRP46	1.29e-08	NA	8.97e-11
3. B	Q3MHE2	U4/U6 small nuclear ribonucleoprotein Prp4	3.92e-11	NA	2.93e-14
3. B	Q6FJ73	Probable cytosolic iron-sulfur protein assembly protein 1	1.22e-10	NA	3.16e-08
3. B	Q1DZQ0	Protein transport protein SEC13	3.23e-08	NA	4.43e-06
3. B	A4R3M4	Nuclear distribution protein PAC1	2.79e-11	NA	1.55e-08
3. B	Q6P2Y2	Dynein assembly factor with WDR repeat domains 1	4.19e-06	NA	9.12e-16
3. B	Q6FNV4	Protein transport protein SEC13-1	1.01e-07	NA	1.04e-06
3. B	Q7T0P4	POC1 centriolar protein homolog A	1.25e-04	NA	3.54e-10
3. B	Q5PPK9	EARP and GARP complex-interacting protein 1	4.86e-10	NA	0.002
3. B	C0NRC6	Nuclear distribution protein PAC1	3.80e-11	NA	3.93e-10
3. B	Q5XGE2	U3 small nucleolar RNA-associated protein 15 homolog	1.29e-04	NA	1.53e-11
3. B	Q59Y20	Protein DSE1	1.14e-02	NA	0.001
3. B	A0CH87	Lissencephaly-1 homolog 2	2.80e-13	NA	8.64e-11
3. B	Q5M7K4	Histone-binding protein RBBP4	3.90e-07	NA	1.44e-09
3. B	Q9BVC4	Target of rapamycin complex subunit LST8	2.56e-07	NA	0.029
3. B	P91343	Ribosome biogenesis protein WDR12 homolog	9.00e-05	NA	0.016
3. B	C5MJE8	Nuclear distribution protein PAC1	6.34e-10	NA	1.04e-07
3. B	Q6ZMY6	WD repeat-containing protein 88	3.18e-05	NA	7.67e-10
3. B	Q40507	Guanine nucleotide-binding protein subunit beta	6.13e-13	NA	9.16e-10
3. B	Q9C2I5	Ribosome biogenesis protein ytm1	6.81e-05	NA	0.002
3. B	B0WYR6	WD repeat-containing protein on Y chromosome	5.21e-07	NA	1.33e-04
3. B	P47025	Mitochondrial division protein 1	6.01e-07	NA	8.65e-06
3. B	P40217	Eukaryotic translation initiation factor 3 subunit I	8.58e-08	NA	0.001
3. B	Q9UTC7	Uncharacterized WD repeat-containing protein C227.12	1.81e-11	NA	2.13e-09
3. B	A8X8C6	WD repeat-containing protein tag-125	2.62e-06	NA	2.87e-15
3. B	C5DF48	Nuclear distribution protein PAC1	6.93e-10	NA	1.57e-04
3. B	Q9NWT1	p21-activated protein kinase-interacting protein 1	5.20e-04	NA	2.29e-04
3. B	Q61FW2	F-box/WD repeat-containing protein sel-10	3.20e-06	NA	3.57e-20
3. B	P39014	F-box protein MET30	9.86e-04	NA	1.57e-11
3. B	Q9P7I3	Mitochondrial division protein 1	1.25e-02	NA	4.32e-08
3. B	P0CS48	Pre-mRNA-splicing factor PRP46	3.14e-06	NA	2.60e-11
3. B	Q6CB13	Mitochondrial division protein 1	4.01e-07	NA	6.35e-07
3. B	Q8NHY2	E3 ubiquitin-protein ligase COP1	8.24e-04	NA	2.05e-05
3. B	F1LTR1	WD repeat-containing protein 26	5.39e-08	NA	8.02e-12
3. B	Q5XFW8	Protein SEC13 homolog	7.30e-08	NA	0.006
3. B	Q498M4	WD repeat-containing protein 5	1.15e-05	NA	2.95e-14
3. B	Q17GR9	Probable cytosolic iron-sulfur protein assembly protein Ciao1	4.87e-12	NA	3.09e-07
3. B	Q9UM11	Fizzy-related protein homolog	1.73e-03	NA	1.72e-05
3. B	Q24572	Chromatin assembly factor 1 p55 subunit	4.31e-07	NA	1.43e-11
3. B	Q80ZK9	WD and tetratricopeptide repeats protein 1	2.89e-03	NA	0.024
3. B	Q8TC44	POC1 centriolar protein homolog B	1.58e-04	NA	2.21e-11
3. B	Q12770	Sterol regulatory element-binding protein cleavage-activating protein	2.41e-02	NA	6.06e-05
3. B	B3RNR8	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	6.21e-11	NA	5.07e-07
3. B	P53024	Protein transport protein SEC13	9.49e-08	NA	2.21e-07
3. B	P0CS38	Protein HIR1	4.74e-05	NA	0.002
3. B	P25635	Periodic tryptophan protein 2	4.09e-06	NA	1.69e-05
3. B	P63244	Receptor of activated protein C kinase 1	2.02e-10	NA	2.25e-06
3. B	A3LTS5	Protein DSE1	1.69e-03	NA	5.16e-04
3. B	Q7T2F6	WD repeat and SOCS box-containing protein 1	4.30e-04	NA	7.33e-08
3. B	Q6DTM3	Jouberin	6.59e-03	NA	1.05e-07
3. B	B4QHG6	Lissencephaly-1 homolog	8.87e-13	NA	7.09e-17
3. B	Q9D2V7	Coronin-7	1.45e-08	NA	2.92e-06
3. B	B7PY76	Ribosome biogenesis protein WDR12 homolog	3.20e-05	NA	4.47e-07
3. B	Q9DC48	Pre-mRNA-processing factor 17	8.91e-06	NA	2.86e-09
3. B	Q17963	WD repeat-containing protein wdr-5.1	1.68e-05	NA	2.00e-15
3. B	Q23256	WD repeat-containing protein wdr-5.3	4.01e-04	NA	3.42e-13
3. B	B2VWG7	Nuclear distribution protein PAC1	3.40e-11	NA	7.82e-10
3. B	A8WGE3	Coronin-2B	7.03e-03	NA	2.03e-07
3. B	Q4R2Z6	WD repeat-containing protein 48	2.35e-03	NA	8.56e-04
3. B	C4YFX2	Transcriptional repressor TUP1	9.42e-06	NA	1.11e-11
3. B	C4R6H3	Nuclear distribution protein PAC1	2.28e-08	NA	1.66e-07
3. B	P79959	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	2.70e-12	NA	6.86e-07
3. B	Q8YTC2	Uncharacterized WD repeat-containing protein alr2800	3.36e-10	NA	7.64e-26
3. B	Q9DAW6	U4/U6 small nuclear ribonucleoprotein Prp4	3.63e-11	NA	3.71e-14
3. B	Q4WLM7	Nuclear distribution protein nudF	5.63e-11	NA	6.77e-08
3. B	P62882	Guanine nucleotide-binding protein subunit beta-5	9.90e-12	NA	8.18e-11
3. B	P07834	Cell division control protein 4	4.78e-04	NA	1.35e-11
3. B	Q55E54	Coronin-B	3.22e-08	NA	5.69e-05
3. B	Q9S7H3	Cell division cycle 20.3, cofactor of APC complex	1.17e-04	NA	1.85e-08
3. B	Q8TED0	U3 small nucleolar RNA-associated protein 15 homolog	2.16e-04	NA	5.95e-11
3. B	P43254	E3 ubiquitin-protein ligase COP1	4.46e-05	NA	1.05e-08
3. B	P0CS46	Polyadenylation factor subunit 2	1.35e-03	NA	2.18e-08
3. B	P78706	Transcriptional repressor rco-1	2.14e-03	NA	1.25e-09
3. B	Q6RI45	Bromodomain and WD repeat-containing protein 3	1.59e-02	NA	3.06e-10
3. B	B4KT48	Lissencephaly-1 homolog	8.29e-13	NA	4.88e-18
3. B	A5DL92	Ribosome biogenesis protein YTM1	6.10e-05	NA	5.61e-05
3. B	Q21215	Guanine nucleotide-binding protein subunit beta-2-like 1	1.30e-09	NA	0.001
3. B	Q4R4J2	Coronin-1A	1.65e-03	NA	9.10e-07
3. B	Q9EPV5	Apoptotic protease-activating factor 1	2.45e-08	NA	6.13e-07
3. B	O13985	Uncharacterized WD repeat-containing protein C26H5.03	2.27e-03	NA	3.83e-04
3. B	Q9PTR5	Lissencephaly-1 homolog	1.83e-09	NA	1.61e-15
3. B	B6HP56	Nuclear distribution protein nudF 1	1.59e-11	NA	2.12e-11
3. B	O24456	Receptor for activated C kinase 1A	1.51e-11	NA	4.37e-04
3. B	Q9EQ15	Guanine nucleotide-binding protein subunit beta-like protein 1	3.15e-06	NA	0.043
3. B	P0CS37	Histone acetyltransferase type B subunit 2	2.71e-06	NA	2.50e-18
3. B	O13637	Protein transport protein sec31	7.85e-05	NA	0.001
3. B	Q3TLR7	Denticleless protein homolog	1.31e-04	NA	0.008
3. B	A0A2R8RWN9	F-box and WD repeat domain-containing 11-B	3.29e-05	NA	9.49e-17
3. B	P62883	Guanine nucleotide-binding protein subunit beta-like protein	2.44e-10	NA	1.78e-08
3. B	Q6CKE8	Pre-mRNA-splicing factor PRP46	2.20e-08	NA	1.38e-10
3. B	Q9NV06	DDB1- and CUL4-associated factor 13	2.99e-05	NA	0.044
3. B	Q99J79	DNA damage-binding protein 2	6.44e-05	NA	0.013
3. B	Q6CJ50	Mitochondrial division protein 1	2.21e-03	NA	1.35e-05
3. B	Q12417	Pre-mRNA-splicing factor PRP46	4.59e-05	NA	1.15e-09
3. B	Q55C80	Diphthine methyltransferase homolog	5.53e-10	NA	4.63e-04
3. B	Q8CBE3	WD repeat-containing protein 37	2.21e-03	NA	1.45e-09
3. B	Q8BG40	Katanin p80 WD40 repeat-containing subunit B1	2.71e-04	NA	8.18e-12
3. B	Q42384	Protein pleiotropic regulatory locus 1	8.52e-06	NA	2.16e-09
3. B	Q9LT47	Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM	8.88e-07	NA	2.52e-06
3. B	Q9UMS4	Pre-mRNA-processing factor 19	4.01e-10	NA	4.58e-11
3. B	P16649	General transcriptional corepressor TUP1	1.24e-03	NA	6.46e-09
3. B	Q55FR9	Coatomer subunit alpha	2.54e-07	NA	1.03e-10
3. B	Q96S15	GATOR complex protein WDR24	1.48e-03	NA	2.05e-07
3. B	Q8RXA7	DENN domain and WD repeat-containing protein SCD1	3.25e-03	NA	1.54e-09
3. B	A2AC93	Dynein axonemal intermediate chain 2	1.64e-04	NA	0.014
3. B	O80990	Protein CIA1	1.47e-10	NA	1.35e-08
3. B	Q9R1A8	E3 ubiquitin-protein ligase COP1	1.14e-09	NA	2.14e-05
3. B	Q0CJD8	Mitochondrial division protein 1	6.88e-03	NA	1.45e-05
3. B	Q13685	Angio-associated migratory cell protein	5.59e-05	NA	0.002
3. B	Q09150	Meiotic recombination protein rec14	1.04e-09	NA	0.001
3. B	Q6PE01	U5 small nuclear ribonucleoprotein 40 kDa protein	7.36e-06	NA	3.08e-11
3. B	Q5SUS0	F-box/WD repeat-containing protein 10	7.86e-03	NA	1.26e-06
3. B	Q8W1K8	Protein Mut11	4.60e-07	NA	2.05e-13
3. B	Q9H7D7	WD repeat-containing protein 26	2.23e-07	NA	1.90e-11
3. B	Q9BQ87	F-box-like/WD repeat-containing protein TBL1Y	8.20e-07	NA	2.17e-26
3. B	Q96EX3	Cytoplasmic dynein 2 intermediate chain 2	1.13e-04	NA	0.008
3. B	Q5ZJW8	Denticleless protein homolog	1.12e-04	NA	8.94e-07
3. B	Q3E906	Cell division cycle 20.5, cofactor of APC complex	4.22e-04	NA	1.97e-10
3. B	P38011	Guanine nucleotide-binding protein subunit beta-like protein	1.09e-10	NA	4.08e-04
3. B	Q54DS4	WD repeat-containing protein DDB_G0292056	4.68e-02	NA	9.36e-08
3. B	A4IIX9	WD repeat-containing protein 37	3.51e-05	NA	5.90e-09
3. B	A0JPH4	Sterol regulatory element-binding protein cleavage-activating protein	8.09e-03	NA	5.89e-05
3. B	O35828	Coronin-7	1.75e-08	NA	1.51e-06
3. B	Q4R571	EARP and GARP complex-interacting protein 1	3.41e-10	NA	0.012
3. B	P63247	Receptor of activated protein C kinase 1	1.91e-10	NA	2.25e-06
3. B	Q4P2B6	Protein transport protein SEC31	6.98e-03	NA	9.79e-06
3. B	Q9SZQ5	WD repeat-containing protein VIP3	3.00e-11	NA	3.14e-13
3. B	Q4X0A9	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.85e-03	NA	1.02e-11
3. B	Q8VEJ4	Notchless protein homolog 1	4.86e-06	NA	3.94e-13
3. B	P93398	Guanine nucleotide-binding protein subunit beta-2	1.31e-08	NA	2.39e-09
3. B	Q99KP6	Pre-mRNA-processing factor 19	3.42e-06	NA	2.72e-11
3. B	C5FWH1	Nuclear distribution protein PAC1	2.86e-11	NA	5.23e-08
3. B	Q27954	Coatomer subunit alpha	1.68e-04	NA	7.57e-10
3. B	Q5RAW8	WD repeat-containing protein 48	1.55e-03	NA	0.003
3. B	Q5BJQ6	Cleavage stimulation factor subunit 1	5.33e-09	NA	5.79e-04
3. B	B5DG67	Ribosome biogenesis protein wdr12	7.17e-05	NA	1.70e-05
3. B	P54311	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.32e-12	NA	3.79e-06
3. B	Q5R5W8	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	2.80e-12	NA	4.28e-06
3. B	Q24371	Protein lethal(2)denticleless	1.55e-02	NA	1.25e-06
3. B	Q5XIG8	Serine-threonine kinase receptor-associated protein	8.18e-07	NA	0.003
3. B	Q5XI13	Glutamate-rich WD repeat-containing protein 1	2.46e-04	NA	2.26e-12
3. B	P14197	WD repeat-containing protein AAC3	2.34e-06	NA	3.85e-11
3. B	Q6GM65	Phospholipase A-2-activating protein	2.33e-04	NA	1.03e-10
3. B	A6ZMK5	Eukaryotic translation initiation factor 3 subunit I	2.03e-07	NA	0.001
3. B	P90917	Probable histone-binding protein rba-1	6.89e-07	NA	1.95e-09
3. B	Q16K15	Eukaryotic translation initiation factor 3 subunit I	6.25e-10	NA	7.91e-04
3. B	Q9FNN2	WD repeat-containing protein 26 homolog	3.49e-04	NA	1.75e-07
3. B	Q7KNS3	Lissencephaly-1 homolog	9.66e-13	NA	7.09e-17
3. B	A2RRU4	Sterol regulatory element-binding protein cleavage-activating protein	2.12e-02	NA	1.70e-04
3. B	Q9NVX2	Notchless protein homolog 1	5.19e-06	NA	3.93e-14
3. B	Q6P1V3	WD repeat and SOCS box-containing protein 1	8.42e-04	NA	4.51e-07
3. B	Q9V3J8	Protein will die slowly	1.94e-06	NA	1.18e-13
3. B	Q9FN19	WD40 repeat-containing protein HOS15	4.82e-04	NA	1.59e-20
3. B	Q6CU55	Nuclear distribution protein PAC1	3.40e-09	NA	0.014
3. B	Q6GPC6	F-box-like/WD repeat-containing protein TBL1XR1-B	6.42e-07	NA	4.53e-25
3. B	Q8L611	Protein transport protein SEC31 homolog B	2.20e-04	NA	1.74e-04
3. B	Q13216	DNA excision repair protein ERCC-8	3.34e-08	NA	1.85e-04
3. B	F4KB17	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3	9.26e-08	NA	9.67e-13
3. B	B4HRQ6	Probable cytosolic iron-sulfur protein assembly protein Ciao1	5.54e-12	NA	1.13e-06
3. B	Q7RZF5	Protein transport protein sec13	8.97e-08	NA	4.76e-06
3. B	A7MB12	U3 small nucleolar RNA-associated protein 15 homolog	9.36e-05	NA	3.57e-10
3. B	Q6KAU8	Protein Atg16l2	4.00e-03	NA	0.001
3. B	Q7PS24	Probable cytosolic iron-sulfur protein assembly protein Ciao1	1.10e-11	NA	1.16e-08
3. B	Q28YY2	WD repeat-containing protein 48 homolog	2.36e-03	NA	9.44e-05
3. B	Q6FLI3	CCR4-associated factor 4 homolog	1.73e-05	NA	1.30e-04
3. B	Q2TZG4	Polyadenylation factor subunit 2	5.79e-04	NA	1.09e-09
3. B	O48847	Transcriptional corepressor LEUNIG_HOMOLOG	5.14e-05	NA	7.62e-12
3. B	O18640	Guanine nucleotide-binding protein subunit beta-like protein	1.46e-10	NA	1.76e-05
3. B	Q9ULV4	Coronin-1C	3.34e-03	NA	1.20e-08
3. B	Q6CG48	Nuclear distribution protein PAC1	7.30e-12	NA	6.37e-08
3. B	Q5E9A4	mRNA export factor	1.15e-05	NA	9.57e-07
3. B	A4RJV3	Mitochondrial division protein 1	9.79e-04	NA	3.60e-09
3. B	A7TH19	Eukaryotic translation initiation factor 3 subunit I	1.05e-07	NA	0.026
3. B	Q5AZM3	Protein transport protein sec31	7.21e-04	NA	8.40e-06
3. B	Q5SP67	WD repeat-containing protein 26	1.94e-05	NA	7.81e-13
3. B	Q5R8K2	Cleavage stimulation factor subunit 1	4.40e-09	NA	8.91e-04
3. B	C4JPW9	Nuclear distribution protein PAC1-2	5.93e-11	NA	2.99e-08
3. B	Q32LP9	Coronin-2A	2.24e-02	NA	2.04e-05
3. B	P62884	Guanine nucleotide-binding protein subunit beta-like protein	3.08e-10	NA	1.78e-08
3. B	Q7ZTY4	Histone-binding protein RBBP7	8.00e-07	NA	8.02e-10
3. B	Q9SZA4	Cell division cycle 20.1, cofactor of APC complex	2.73e-05	NA	7.85e-11
3. B	Q9LYK6	Protein ANTHESIS POMOTING FACTOR 1	2.74e-08	NA	0.010
3. B	Q5ZMA2	Pre-mRNA-processing factor 19	1.00e-05	NA	2.19e-10
3. B	Q6S7B0	Transcription initiation factor TFIID subunit 5	1.20e-04	NA	3.61e-12
3. B	Q1JQD2	Glutamate-rich WD repeat-containing protein 1	5.98e-05	NA	7.06e-12
3. B	O93377	Histone-binding protein RBBP4-A	4.14e-07	NA	2.06e-09
3. B	Q54IY5	Component of gems protein 5	9.65e-06	NA	3.46e-07
3. B	Q99LL5	Periodic tryptophan protein 1 homolog	8.31e-04	NA	1.51e-07
3. B	C4Q0P6	Lissencephaly-1 homolog	6.63e-13	NA	7.89e-16
3. B	Q9W5Z5	WD repeat and SOCS box-containing protein 1	4.58e-04	NA	2.13e-06
3. B	O22212	U4/U6 small nuclear ribonucleoprotein PRP4-like protein	2.10e-08	NA	5.87e-16
3. B	A1CF18	Nuclear distribution protein nudF 2	1.77e-11	NA	2.39e-07
3. B	Q6PJI9	GATOR complex protein WDR59	2.38e-03	NA	6.76e-05
3. B	Q6BSL7	Eukaryotic translation initiation factor 3 subunit I	2.06e-07	NA	0.023
3. B	Q6Q0C0	E3 ubiquitin-protein ligase TRAF7	3.45e-09	NA	1.59e-05
3. B	O43684	Mitotic checkpoint protein BUB3	4.14e-09	NA	4.54e-04
3. B	Q08706	Guanine nucleotide-binding protein subunit beta	3.48e-12	NA	3.54e-06
3. B	U4PCM1	pre-mRNA 3' end processing protein pfs-2	6.71e-04	NA	3.16e-11
3. B	O95170	CMT1A duplicated region transcript 1 protein	8.68e-04	NA	6.63e-05
3. B	B0X2V9	WD repeat-containing protein 48 homolog	3.63e-03	NA	0.001
3. B	Q8K4P0	pre-mRNA 3' end processing protein WDR33	3.71e-03	NA	7.83e-08
3. B	Q6FNU4	Protein transport protein SEC31	2.71e-04	NA	0.006
3. B	Q54KL5	WD repeat-containing protein 5 homolog	2.41e-05	NA	4.14e-13
3. B	B4MU54	Ribosome biogenesis protein WDR12 homolog	3.57e-05	NA	1.87e-04
3. B	P41838	Poly(A)+ RNA export protein	3.75e-08	NA	8.66e-06
3. B	Q6GQT6	Sterol regulatory element-binding protein cleavage-activating protein	1.71e-02	NA	8.64e-05
3. B	Q4V837	Denticleless protein homolog A	7.15e-04	NA	5.31e-06
3. B	Q9Y263	Phospholipase A-2-activating protein	1.38e-04	NA	9.87e-11
3. B	Q58D20	Notchless protein homolog 1	2.56e-05	NA	3.31e-14
3. B	Q5R654	Histone-binding protein RBBP7	1.82e-06	NA	2.83e-09
3. B	O88342	WD repeat-containing protein 1	2.36e-13	NA	0.003
3. B	Q0CY32	Probable E3 ubiquitin ligase complex SCF subunit sconB	4.94e-04	NA	1.77e-11
3. B	Q4PCB8	Protein transport protein SEC13	3.17e-07	NA	0.023
3. B	Q28DW0	Probable cytosolic iron-sulfur protein assembly protein ciao1	2.04e-08	NA	2.77e-08
3. B	Q8C092	Transcription initiation factor TFIID subunit 5	4.53e-04	NA	1.16e-13
3. B	Q9GZS3	WD repeat-containing protein 61	4.80e-11	NA	1.30e-04
3. B	Q0USG2	Probable cytosolic iron-sulfur protein assembly protein 1	4.81e-09	NA	2.10e-04
3. B	Q9URY0	Ribosome biogenesis protein ytm1	2.56e-04	NA	4.66e-04
3. B	Q8NHV4	Protein NEDD1	2.76e-05	NA	0.009
3. B	Q6CU59	Ribosome biogenesis protein YTM1	5.66e-05	NA	0.015
3. B	Q922V4	Pleiotropic regulator 1	1.05e-03	NA	3.69e-12
3. B	Q12834	Cell division cycle protein 20 homolog	4.14e-05	NA	3.52e-13
3. B	Q10281	Guanine nucleotide-binding protein subunit beta-like protein	7.99e-12	NA	6.66e-08
3. B	Q6GPU3	Denticleless protein homolog B	1.11e-04	NA	3.23e-05
3. B	P49177	Guanine nucleotide-binding protein subunit beta	2.08e-11	NA	3.91e-10
3. B	Q05AM5	Elongator complex protein 2	3.13e-09	NA	0.005
3. B	F1QHZ6	Dynein axonemal intermediate chain 4	3.49e-04	NA	1.44e-04
3. B	Q9FLX9	Notchless protein homolog	1.34e-05	NA	4.82e-15
3. B	Q5ZIU8	Katanin p80 WD40 repeat-containing subunit B1	4.19e-04	NA	1.13e-11
3. B	Q8R537	Peroxisomal targeting signal 2 receptor	2.06e-12	NA	4.83e-20
3. B	Q75LV5	U3 snoRNP-associated protein-like YAOH	1.38e-03	NA	0.016
3. B	Q13112	Chromatin assembly factor 1 subunit B	1.69e-05	NA	3.30e-06
3. B	Q4QR85	Methylosome protein 50	3.14e-06	NA	0.012
3. B	O94394	Uncharacterized WD repeat-containing protein C126.01c	2.72e-06	NA	0.006
3. B	P93107	Flagellar WD repeat-containing protein Pf20	1.90e-06	NA	1.46e-10
3. B	Q8BX09	Retinoblastoma-binding protein 5	7.93e-04	NA	0.001
3. B	A6R3K5	Ribosome biogenesis protein YTM1	1.69e-04	NA	0.017
3. B	Q5ZLG9	GATOR complex protein WDR59	6.78e-04	NA	1.29e-08
3. B	Q1JQB2	Mitotic checkpoint protein BUB3	2.86e-09	NA	4.92e-04
3. B	Q54QU5	WD repeat-containing protein 89 homolog	2.61e-06	NA	0.004
3. B	Q7T394	Lissencephaly-1 homolog A	5.61e-13	NA	5.18e-15
3. B	Q7ZXK9	Notchless protein homolog 1	2.04e-05	NA	8.18e-14
3. B	Q5RAC9	Autophagy-related protein 16-1	8.08e-04	NA	1.02e-04
3. B	P83774	Guanine nucleotide-binding protein subunit beta-like protein	2.00e-10	NA	6.12e-05
3. B	D3Z902	F-box/WD repeat-containing protein 7	2.79e-05	NA	5.64e-21
3. B	O08653	Telomerase protein component 1	2.85e-05	NA	0.011
3. B	Q9NDC9	Lissencephaly-1 homolog	8.82e-13	NA	4.94e-10
3. B	Q1LV15	Dynein assembly factor with WDR repeat domains 1	1.68e-05	NA	3.09e-13
3. B	O22466	WD-40 repeat-containing protein MSI1	3.44e-07	NA	2.22e-09
3. B	Q59WJ4	Polyadenylation factor subunit 2	6.79e-06	NA	2.15e-07
3. B	Q6FXI8	Histone acetyltransferase type B subunit 2	1.46e-08	NA	1.14e-06
3. B	Q5RDY7	Guanine nucleotide-binding protein subunit beta-5	1.08e-11	NA	1.11e-10
3. B	Q09715	Transcriptional repressor tup11	3.13e-06	NA	1.67e-13
3. B	Q5H7C0	Cell division cycle protein 20 homolog	9.42e-04	NA	4.22e-13
3. B	Q7S8R5	Mitochondrial division protein 1	9.08e-04	NA	2.32e-08
3. B	Q9LV27	Target of rapamycin complex subunit LST8-1	4.53e-05	NA	4.65e-05
3. B	Q9FND4	WD repeat-containing protein WDS homolog	6.62e-05	NA	6.07e-12
3. B	A2QHM1	Protein transport protein sec13	4.04e-08	NA	1.51e-06
3. B	Q86VZ2	WD repeat-containing protein 5B	8.90e-08	NA	2.65e-13
3. B	B4MY65	Lissencephaly-1 homolog	8.62e-13	NA	3.58e-18
3. B	Q8UUP2	Polycomb protein eed-A	2.23e-04	NA	0.028
3. B	Q6PBY0	Guanine nucleotide-binding protein subunit beta-5b	1.13e-05	NA	8.80e-11
3. B	A9V790	Lissencephaly-1 homolog	1.29e-12	NA	8.67e-08
3. B	Q5FWQ6	Dynein assembly factor with WDR repeat domains 1	3.69e-06	NA	1.65e-15
3. B	Q7SZM9	F-box-like/WD repeat-containing protein TBL1XR1-A	9.61e-06	NA	2.64e-25
3. B	Q93ZG3	WD repeat-containing protein ATCSA-1	4.51e-04	NA	1.77e-04
3. B	C5JD40	Nuclear distribution protein PAC1	3.71e-10	NA	1.60e-07
3. B	A4R7U3	Probable cytosolic iron-sulfur protein assembly protein 1	3.23e-08	NA	1.76e-04
3. B	Q91WM3	U3 small nucleolar RNA-interacting protein 2	1.24e-08	NA	3.45e-04
3. B	P49027	Guanine nucleotide-binding protein subunit beta-like protein A	3.85e-10	NA	0.031
3. B	P52287	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	2.82e-12	NA	7.58e-09
3. B	Q4P553	Histone acetyltransferase type B subunit 2	4.73e-09	NA	5.01e-12
3. B	Q7RZI0	Protein hir-1	2.53e-04	NA	0.015
3. B	Q5RCG7	Angio-associated migratory cell protein	4.61e-05	NA	0.002
3. B	A1DP19	Nuclear distribution protein nudF	1.73e-08	NA	1.43e-07
3. B	Q5AZX0	Polyadenylation factor subunit 2	6.55e-04	NA	8.38e-07
3. B	Q0CCS0	Probable cytosolic iron-sulfur protein assembly protein 1	3.54e-10	NA	0.002
3. B	Q9AV81	Pre-mRNA-processing factor 19	4.90e-04	NA	4.51e-09
3. B	Q5REE0	U3 small nucleolar RNA-associated protein 15 homolog	4.29e-05	NA	1.34e-10
3. B	Q8C0M0	GATOR complex protein WDR59	1.22e-03	NA	9.22e-05
3. B	P87053	F-box/WD repeat-containing protein pof1	2.35e-03	NA	4.87e-14
3. B	Q8BHB4	WD repeat-containing protein 3	5.51e-08	NA	7.91e-10
3. B	Q8C4J7	Transducin beta-like protein 3	1.17e-06	NA	1.90e-12
3. B	Q39336	Guanine nucleotide-binding protein subunit beta-like protein	1.69e-11	NA	0.035
3. B	Q6FL15	Eukaryotic translation initiation factor 3 subunit I	8.66e-08	NA	0.020
3. B	Q6ZMW3	Echinoderm microtubule-associated protein-like 6	2.65e-03	NA	0.011
3. B	Q4WT34	Pre-mRNA-splicing factor prp46	5.45e-05	NA	3.00e-10
3. B	Q9JJ66	Cell division cycle protein 20 homolog	8.41e-04	NA	6.29e-14
3. B	Q20636	Guanine nucleotide-binding protein subunit beta-2	2.23e-11	NA	2.15e-09
3. B	Q2HJH6	U5 small nuclear ribonucleoprotein 40 kDa protein	1.59e-06	NA	1.90e-11
3. B	A0A2R8QFQ6	F-box and WD repeat domain-containing 11-A	4.18e-05	NA	4.81e-16
3. B	Q9GL51	Platelet-activating factor acetylhydrolase IB subunit alpha	5.85e-13	NA	2.53e-16
3. B	P13712	Chromatin assembly factor 1 subunit p50	8.80e-08	NA	1.23e-08
3. B	Q9XW12	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	9.42e-08	NA	2.67e-04
3. B	Q0DYP5	Zinc finger CCCH domain-containing protein 17	4.28e-04	NA	4.88e-07
3. B	Q5RB58	Mitotic checkpoint protein BUB3	3.74e-09	NA	0.001
3. B	Q7ZX22	GATOR complex protein WDR24	5.70e-04	NA	1.01e-06
3. B	A9VDW7	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	9.72e-04	NA	6.84e-08
3. B	Q9ZU34	Actin-interacting protein 1-1	0.00e+00	NA	5.05e-04
3. B	P38129	Transcription initiation factor TFIID subunit 5	1.65e-04	NA	2.84e-12
3. B	C6HTE8	Nuclear distribution protein PAC1	3.22e-11	NA	3.93e-10
3. B	Q8RXU6	WD repeat-containing protein PCN	7.89e-07	NA	2.64e-06
3. B	P27133	Coronin-A	1.17e-03	NA	2.26e-06
3. B	Q7S7L4	Nuclear distribution protein nudF-1	8.26e-07	NA	4.31e-11
3. B	P0CY34	Transcriptional repressor TUP1	1.23e-05	NA	1.11e-11
3. B	B0XTS1	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.43e-03	NA	1.02e-11
3. B	P61964	WD repeat-containing protein 5	2.13e-06	NA	2.95e-14
3. B	Q8CGF6	WD repeat-containing protein 47	1.04e-03	NA	1.55e-07
3. B	P36408	Guanine nucleotide-binding protein subunit beta	1.70e-08	NA	2.77e-12
3. B	Q9SU78	WD-40 repeat-containing protein MSI5	1.04e-06	NA	1.55e-07
3. B	P0CS42	Nuclear distribution protein PAC1	5.15e-12	NA	1.18e-14
3. B	B4KTK4	Probable cytosolic iron-sulfur protein assembly protein Ciao1	3.53e-12	NA	2.35e-06
3. B	Q920M5	Coronin-6	6.09e-04	NA	1.33e-08
3. B	Q9JHB4	WD repeat-containing protein 31	3.18e-06	NA	1.74e-05
3. B	Q54S59	WD repeat-containing protein 61 homolog	4.75e-06	NA	1.27e-04
3. B	Q5NVD0	U4/U6 small nuclear ribonucleoprotein Prp4	3.77e-11	NA	3.46e-14
3. B	Q9DAJ4	WD repeat domain-containing protein 83	1.75e-07	NA	1.50e-06
3. B	Q05946	U3 small nucleolar RNA-associated protein 13	1.01e-06	NA	3.67e-05
3. B	O94319	Protein transport protein sec13	3.56e-08	NA	0.008
3. B	A0A1P8AW69	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1	1.49e-04	NA	1.00e-11
3. B	Q4WTL0	Probable cytosolic iron-sulfur protein assembly protein 1	9.83e-05	NA	0.023
3. B	P93471	E3 ubiquitin-protein ligase COP1	3.49e-06	NA	6.52e-08
3. B	Q6CBI8	Probable cytosolic iron-sulfur protein assembly protein 1	8.45e-11	NA	8.73e-09
3. B	Q12523	WD repeat-containing protein YPL247C	8.50e-05	NA	0.011
3. B	Q803D2	Lissencephaly-1 homolog B	6.77e-13	NA	2.23e-15
3. B	Q9UNX4	WD repeat-containing protein 3	2.25e-07	NA	4.32e-09
3. B	Q54WA3	Peroxisomal targeting signal 2 receptor	1.21e-14	NA	3.49e-24
3. B	Q921E6	Polycomb protein EED	5.43e-05	NA	0.030
3. B	Q9AUR8	Coatomer subunit alpha-1	1.91e-08	NA	1.51e-10
3. B	A6H603	NACHT domain- and WD repeat-containing protein 1	1.09e-05	NA	1.02e-04
3. B	Q8JZX3	POC1 centriolar protein homolog A	6.13e-05	NA	2.69e-09
3. B	Q9QXL1	Kinesin-like protein KIF21B	1.40e-02	NA	0.006
3. B	Q09589	Protein HIRA	6.88e-04	NA	8.06e-05
3. B	Q6ED65	Echinoderm microtubule-associated protein-like 5	4.94e-03	NA	2.64e-04
3. B	P40968	Pre-mRNA-processing factor 17	2.00e-06	NA	5.08e-07
3. B	Q12024	Ribosome biogenesis protein YTM1	7.58e-05	NA	0.041
3. B	A8PD13	Ribosome biogenesis protein YTM1	1.63e-05	NA	0.003
3. B	Q8NBT0	POC1 centriolar protein homolog A	2.20e-05	NA	5.39e-09
3. B	O24076	Guanine nucleotide-binding protein subunit beta-like protein	1.52e-11	NA	4.44e-08
3. B	Q75A30	Protein transport protein SEC31	2.37e-04	NA	1.65e-05
3. B	Q5ZKH3	Polycomb protein EED	8.78e-05	NA	0.029
3. B	Q9USL1	Uncharacterized WD repeat-containing protein C18B5.10c	2.11e-07	NA	0.001
3. B	Q3B7M6	Protein NEDD1	2.34e-05	NA	0.006
3. B	Q3U3T8	WD repeat-containing protein 62	1.46e-06	NA	5.42e-04
3. B	Q4R8E7	Dynein assembly factor with WDR repeat domains 1	2.25e-05	NA	5.97e-18
3. B	Q9WUM4	Coronin-1C	1.54e-03	NA	4.99e-08
3. B	P17343	Guanine nucleotide-binding protein subunit beta-1	2.35e-12	NA	4.21e-06
3. B	Q3SWX8	Histone-binding protein RBBP7	7.79e-07	NA	8.00e-11
3. B	Q8C570	mRNA export factor	1.21e-05	NA	7.35e-07
3. B	F1M5N7	Kinesin-like protein KIF21B	1.82e-02	NA	0.007
3. B	F6ZT52	POC1 centriolar protein homolog B	1.30e-04	NA	1.44e-11
3. B	Q9XF57	Peroxisome biogenesis protein 7	2.80e-14	NA	5.52e-15
3. B	Q9S7I8	Cell division cycle 20.2, cofactor of APC complex	3.91e-04	NA	5.62e-11
3. B	Q76B40	WD40 repeat-containing protein SMU1	2.95e-06	NA	1.71e-07
3. B	Q9BRP4	Proteasomal ATPase-associated factor 1	1.52e-05	NA	3.59e-08
3. B	Q9LJR3	Protein SPA1-RELATED 3	7.88e-04	NA	4.71e-05
3. B	Q8C0J2	Autophagy-related protein 16-1	8.78e-04	NA	2.26e-04
3. B	Q5B4R1	Ribosome biogenesis protein ytm1	3.38e-04	NA	2.68e-04
3. B	Q0V8J1	WD repeat and SOCS box-containing protein 2	3.75e-04	NA	6.63e-08
3. B	Q9VZF4	F-box/WD repeat-containing protein 7	1.26e-02	NA	1.51e-16
3. B	Q3UPL0	Protein transport protein Sec31A	1.13e-03	NA	1.62e-05
3. B	A2AHJ4	Bromodomain and WD repeat-containing protein 3	3.43e-02	NA	1.23e-09
3. B	B7FNU7	Lissencephaly-1 homolog	7.54e-12	NA	6.71e-10
3. B	Q566T0	Polycomb protein eed	1.66e-04	NA	0.024
3. B	B4JW81	Probable cytosolic iron-sulfur protein assembly protein Ciao1	2.32e-12	NA	3.65e-06
3. B	B3NSK1	WD repeat-containing protein 48 homolog	3.47e-03	NA	2.83e-04
3. B	Q04225	Ribosome assembly protein RRB1	8.40e-05	NA	3.93e-07
3. B	Q7ZVF0	POC1 centriolar protein homolog A	2.36e-05	NA	1.11e-08
3. B	Q8H0T9	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4	4.72e-07	NA	1.58e-11
3. B	Q6BVZ3	Polyadenylation factor subunit 2	1.10e-05	NA	8.82e-09
3. B	Q55E58	Probable serine/threonine-protein kinase pats1	NA	NA	0.046
3. B	B6QC56	Nuclear distribution protein nudF 1	5.43e-11	NA	1.01e-07
3. B	Q9W7I5	Histone-binding protein RBBP4	1.73e-06	NA	1.54e-09
3. B	C4YPI7	Nuclear distribution protein PAC1	5.69e-07	NA	2.09e-06
3. B	Q4V7Y7	Katanin p80 WD40 repeat-containing subunit B1	5.26e-04	NA	1.29e-12
3. B	A0A1W5T363	WD40 repeat protein poxJ	NA	NA	4.49e-04
3. B	Q6NQ88	Protein DAMAGED DNA-BINDING 2	7.48e-05	NA	6.69e-04
3. B	Q6ZJX0	Polycomb group protein FIE1	3.30e-06	NA	2.33e-06
3. B	A8XZJ9	Lissencephaly-1 homolog	8.77e-08	NA	1.82e-08
3. B	B4HND9	WD repeat-containing protein 48 homolog	2.73e-03	NA	5.03e-05
3. B	Q5GIS3	Guanine nucleotide-binding protein subunit beta	2.33e-12	NA	2.46e-07
3. B	D3BUN1	Lissencephaly-1 homolog	4.51e-13	NA	9.69e-11
3. B	Q8BHJ5	F-box-like/WD repeat-containing protein TBL1XR1	4.59e-07	NA	7.03e-25
3. B	Q922B6	E3 ubiquitin-protein ligase TRAF7	2.55e-07	NA	9.55e-06
3. B	Q4ICM0	Nuclear distribution protein PAC1	1.38e-08	NA	2.57e-11
3. B	Q0D0X6	Nuclear distribution protein nudF	1.96e-11	NA	7.28e-07
3. B	A3GFK8	Protein transport protein SEC31	4.44e-03	NA	3.19e-07
3. B	B2AEZ5	Nuclear distribution protein PAC1-1	3.10e-08	NA	8.29e-14
3. B	Q9P783	Ribosome assembly protein rrb1	5.25e-05	NA	3.96e-13
3. B	Q7ZWF0	mRNA export factor	9.87e-06	NA	4.85e-06
3. B	Q9FNZ1	Zinc finger CCCH domain-containing protein 63	7.54e-04	NA	1.44e-07
3. B	Q6DIF4	WD repeat-containing protein 1	0.00e+00	NA	0.039
3. B	P62873	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.48e-12	NA	3.79e-06
3. B	Q9NZJ0	Denticleless protein homolog	8.40e-05	NA	8.12e-05
3. B	Q99LC2	Cleavage stimulation factor subunit 1	4.44e-09	NA	5.79e-04
3. B	A5DST9	Ribosome biogenesis protein YTM1	1.26e-04	NA	0.003
3. B	P31146	Coronin-1A	1.70e-03	NA	8.95e-07
3. B	A0A1L8HX76	WD repeat-containing protein 18	1.67e-04	NA	0.005
3. B	Q9BR76	Coronin-1B	3.01e-03	NA	6.29e-08
3. B	Q8CFD5	DNA excision repair protein ERCC-8	8.31e-10	NA	1.26e-04
3. B	Q6ZD63	Chromatin assembly factor 1 subunit FAS2 homolog	3.14e-07	NA	0.036
3. B	O35353	Guanine nucleotide-binding protein subunit beta-4	2.17e-12	NA	3.26e-07
3. B	Q5FVN8	WD repeat, SAM and U-box domain-containing protein 1	1.90e-04	NA	4.38e-05
3. B	B4GIJ0	WD repeat-containing protein 48 homolog	2.99e-03	NA	9.44e-05
3. B	Q6QEF8	Coronin-6	3.85e-03	NA	1.69e-09
3. B	B0XQ15	Probable cytosolic iron-sulfur protein assembly protein 1	1.25e-04	NA	0.023
3. B	Q54SF9	Myosin heavy chain kinase D	5.12e-03	NA	2.07e-04
3. B	G0SA60	Protein transport protein SEC13	1.09e-07	NA	2.76e-06
3. B	Q2UG43	Protein transport protein sec13	8.15e-08	NA	3.06e-06
3. B	G5EES6	Ubiquitin fusion degradation protein 3 homolog	2.00e-03	NA	3.69e-04
3. B	Q4I7L0	Histone acetyltransferase type B subunit 2	1.37e-09	NA	1.66e-14
3. B	Q291L9	Lissencephaly-1 homolog	7.08e-13	NA	1.64e-18
3. B	P49026	Guanine nucleotide-binding protein subunit beta-like protein	1.42e-11	NA	1.30e-06
3. B	Q5BLX8	WD repeat domain-containing protein 83	1.58e-07	NA	1.08e-06
3. B	Q5RF51	U5 small nuclear ribonucleoprotein 40 kDa protein	1.05e-06	NA	6.05e-11
3. B	P62871	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	1.48e-12	NA	3.79e-06
3. B	Q3Y8L7	Dynein assembly factor with WDR repeat domains 1	2.84e-05	NA	1.28e-16
3. B	Q5F3D7	U3 small nucleolar RNA-associated protein 15 homolog	1.04e-03	NA	1.69e-07
3. B	Q68FJ6	p21-activated protein kinase-interacting protein 1-like	7.18e-09	NA	1.86e-04
3. B	Q6DJD8	Coronin-2B	7.67e-04	NA	1.18e-08
3. B	P63004	Platelet-activating factor acetylhydrolase IB subunit alpha	7.64e-09	NA	3.03e-16
3. B	Q6VNB8	WD repeat and FYVE domain-containing protein 3	NA	NA	0.012
3. B	Q10990	Cell division cycle protein cdt2	7.28e-04	NA	0.001
3. B	Q8L3Z8	Protein FIZZY-RELATED 2	7.96e-05	NA	8.06e-11
3. B	G5EEG7	Smu-1 suppressor of mec-8 and unc-52 protein	3.59e-06	NA	3.55e-09
3. B	O42248	Guanine nucleotide-binding protein subunit beta-2-like 1	2.08e-10	NA	9.33e-06
3. B	Q3MHL3	Histone-binding protein RBBP4	1.53e-06	NA	1.39e-09
3. B	G0SEA3	mRNA export factor GLE2	7.68e-08	NA	7.22e-06
3. B	Q2GT28	Nuclear distribution protein PAC1-2	1.95e-11	NA	7.08e-09
3. B	Q8MY12	Myosin heavy chain kinase C	4.07e-03	NA	1.89e-07
3. B	Q5XGI5	WD repeat domain-containing protein 83	1.87e-07	NA	6.87e-11
3. B	Q2KIG2	WD repeat-containing protein 5	1.22e-05	NA	3.50e-14
3. B	P97499	Telomerase protein component 1	2.28e-06	NA	8.91e-07
3. B	Q53HC9	EARP and GARP complex-interacting protein 1	4.49e-10	NA	0.005
3. B	Q2HJ56	Periodic tryptophan protein 1 homolog	6.93e-05	NA	7.08e-06
3. B	Q94BR4	Pre-mRNA-processing factor 19 homolog 1	4.71e-06	NA	2.58e-05
3. B	A7TMF9	Ribosome biogenesis protein YTM1	8.50e-05	NA	0.023
3. B	P62880	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	2.56e-12	NA	3.47e-07
3. B	Q21624	Coronin-like protein cor-1	3.28e-03	NA	4.28e-04
3. B	Q9LV28	Receptor for activated C kinase 1C	1.60e-11	NA	1.62e-05
3. B	Q92828	Coronin-2A	7.42e-03	NA	5.33e-04
3. B	B4QB64	WD repeat-containing protein 48 homolog	2.59e-03	NA	4.99e-05
3. B	Q3MV14	Protein DECREASED SIZE EXCLUSION LIMIT 1	1.76e-04	NA	0.001
3. B	Q9BRX9	WD repeat domain-containing protein 83	1.98e-07	NA	2.63e-06
3. B	B5X3C4	Lissencephaly-1 homolog B	6.99e-09	NA	5.42e-15
3. B	Q6NRT3	WD40 repeat-containing protein SMU1	2.12e-06	NA	2.27e-07
3. B	Q9WVA3	Mitotic checkpoint protein BUB3	2.76e-09	NA	4.92e-04
3. B	Q2UPI0	Probable cytosolic iron-sulfur protein assembly protein 1	8.56e-10	NA	5.10e-04
3. B	O43818	U3 small nucleolar RNA-interacting protein 2	2.32e-04	NA	4.42e-04
3. B	P39984	Histone acetyltransferase type B subunit 2	6.43e-08	NA	2.00e-10
3. B	Q5RB07	WD repeat-containing protein 6	1.33e-05	NA	0.027
3. B	Q96JK2	DDB1- and CUL4-associated factor 5	2.00e-03	NA	0.001
3. B	B8M0Q1	Nuclear distribution protein nudF	6.26e-11	NA	2.03e-07
3. B	Q4WTC4	Protein hir1	2.19e-04	NA	0.018
3. B	O76071	Probable cytosolic iron-sulfur protein assembly protein CIAO1	7.12e-11	NA	3.01e-08
3. B	Q10051	Pre-mRNA-processing factor 19	2.79e-06	NA	5.46e-04
3. B	A7RWD2	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	6.94e-12	NA	1.56e-08
3. B	Q6L4F8	Guanine nucleotide-binding protein subunit beta-like protein B	4.88e-10	NA	1.62e-04
3. B	Q9I8G9	Histone-binding protein RBBP7	3.09e-06	NA	8.47e-11
3. B	Q2KJJ5	Transducin beta-like protein 3	5.91e-07	NA	1.63e-13
3. B	Q10272	Pre-rRNA-processing protein crb3/ipi3	7.12e-04	NA	0.023
3. B	Q54D08	Protein LST8 homolog	3.46e-08	NA	4.35e-06
3. B	Q9LF27	Ribosome biogenesis protein WDR12 homolog	3.83e-04	NA	0.012
3. B	O74340	Protein sof1	2.84e-05	NA	1.10e-07
3. B	Q2KID6	Pleiotropic regulator 1	6.73e-04	NA	1.63e-11
3. B	C5PFX0	Nuclear distribution protein PAC1	1.87e-10	NA	3.65e-07
3. B	O14435	Guanine nucleotide-binding protein subunit beta	7.90e-13	NA	3.85e-10
3. B	P38123	COMPASS component SWD3	1.28e-09	NA	8.56e-05
3. B	Q99M63	WD40 repeat-containing protein SMU1	3.42e-06	NA	1.98e-07
3. B	Q7KWL3	DDB1- and CUL4-associated factor 13	3.16e-05	NA	8.27e-07
3. B	Q6NX08	Ribosome biogenesis protein wdr12	5.36e-05	NA	1.43e-07
3. B	Q9BVA0	Katanin p80 WD40 repeat-containing subunit B1	1.57e-03	NA	8.21e-12
3. B	P87141	Target of rapamycin complex 1 subunit mip1	2.54e-05	NA	8.36e-04
3. B	O43660	Pleiotropic regulator 1	1.57e-03	NA	1.64e-12
3. B	C4YN69	Restriction of telomere capping protein 1	1.07e-02	NA	0.009
3. B	Q0UNA9	Protein transport protein SEC13	2.72e-07	NA	4.96e-06
3. B	B3S4I5	Lissencephaly-1 homolog	7.73e-13	NA	3.50e-17
3. B	Q4P9P9	Nuclear distribution protein PAC1	5.96e-12	NA	5.90e-09
3. B	B4LQ21	Lissencephaly-1 homolog	8.29e-13	NA	1.19e-18
3. B	P25387	Guanine nucleotide-binding protein subunit beta-like protein	2.50e-11	NA	8.60e-04
3. B	Q8VZY7	Polycomb group protein FIE1	1.09e-04	NA	1.81e-05
3. B	Q9FKR9	Zinc finger CCCH domain-containing protein 59	4.00e-03	NA	0.009
3. B	Q9D0N7	Chromatin assembly factor 1 subunit B	1.74e-05	NA	4.87e-05
3. B	Q9UUG8	Transcriptional repressor tup12	5.46e-04	NA	3.43e-09
3. B	B4JPT9	Ribosome biogenesis protein WDR12 homolog	1.16e-04	NA	5.53e-05
3. B	Q25306	Guanine nucleotide-binding protein subunit beta-like protein	3.17e-10	NA	1.71e-08
3. B	P53621	Coatomer subunit alpha	4.51e-09	NA	1.28e-09
3. B	Q8BQM8	Echinoderm microtubule-associated protein-like 5	1.55e-04	NA	2.87e-04
3. B	B4MFM2	WD repeat-containing protein 48 homolog	8.88e-04	NA	4.85e-04
3. B	Q9Z2Q1	Protein transport protein Sec31A	5.70e-03	NA	1.79e-05
3. B	Q6P5M2	WD repeat-containing protein 61	1.04e-10	NA	1.26e-14
3. B	A5DXE2	Protein transport protein SEC13	1.14e-07	NA	3.47e-04
3. B	Q552R1	DDB1- and CUL4-associated factor 7 homolog	3.22e-09	NA	0.008
3. B	Q9VU65	POC1 centriolar protein homolog	1.12e-07	NA	2.67e-10
3. B	Q9USN3	Probable U3 small nucleolar RNA-associated protein 13	8.46e-07	NA	1.81e-10
3. B	Q32SG6	Protein HIRA	8.99e-04	NA	6.41e-08
3. B	Q91854	Beta-TrCP	2.98e-05	NA	2.74e-16
3. B	P78798	Peroxisomal targeting signal 2 receptor	1.04e-13	NA	3.57e-08
3. B	Q7ZVL2	GATOR complex protein WDR24	5.69e-04	NA	6.86e-10
3. B	B5X212	Probable cytosolic iron-sulfur protein assembly protein ciao1-B	3.09e-11	NA	8.86e-12
3. B	Q6P4J8	WD40 repeat-containing protein SMU1	3.07e-06	NA	7.65e-07
3. B	Q24338	Polycomb protein esc	4.91e-05	NA	1.96e-04
3. B	Q74ZN0	Protein HIR1	2.91e-05	NA	0.018
3. B	Q9ZUN8	Protein HEAT STRESS TOLERANT DWD 1	1.50e-04	NA	4.18e-07
3. B	A3LQ86	Ribosome biogenesis protein YTM1	7.87e-05	NA	0.006
3. B	Q15269	Periodic tryptophan protein 2 homolog	8.61e-08	NA	3.04e-06
3. B	Q54S79	WD repeat-containing protein 3 homolog	8.04e-08	NA	2.61e-11
3. B	Q99KN2	Probable cytosolic iron-sulfur protein assembly protein CIAO1	5.99e-11	NA	2.53e-09
3. B	Q54PE0	Periodic tryptophan protein 2 homolog	8.84e-08	NA	1.17e-06
3. B	Q15751	Probable E3 ubiquitin-protein ligase HERC1	NA	NA	0.005
3. B	Q04491	Protein transport protein SEC13	9.21e-08	NA	8.18e-07
3. B	Q9AYE4	Target of rapamycin complex subunit LST8	5.45e-05	NA	4.00e-04
3. B	B4HSL3	Lissencephaly-1 homolog	9.22e-13	NA	7.09e-17
3. B	Q5F3X8	Protein transport protein Sec31A	6.55e-04	NA	5.98e-06
3. B	Q803X4	DDB1- and CUL4-associated factor 13	2.31e-04	NA	0.016
3. B	P63243	Receptor of activated protein C kinase 1	1.97e-10	NA	2.25e-06
3. B	Q09855	F-box/WD repeat-containing protein pof11	3.01e-05	NA	7.91e-12
3. B	O13615	Pre-mRNA-splicing factor prp5	8.43e-06	NA	3.58e-10
3. B	Q9FUY2	Transcriptional corepressor LEUNIG	1.01e-04	NA	5.27e-05
3. B	A6ZYM0	Probable cytosolic iron-sulfur protein assembly protein 1	4.42e-10	NA	4.29e-11
3. B	A3LVM1	Probable cytosolic iron-sulfur protein assembly protein 1	4.28e-10	NA	5.63e-06
3. B	Q16576	Histone-binding protein RBBP7	2.58e-07	NA	8.97e-11
3. B	Q60584	F-box/WD repeat-containing protein 2	6.45e-04	NA	1.72e-06
3. B	P42841	Polyadenylation factor subunit 2	8.88e-05	NA	1.26e-06
3. B	Q00659	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.97e-03	NA	4.02e-12
3. B	D4AZ50	Nuclear distribution protein PAC1	3.90e-11	NA	4.33e-07
3. B	Q3KQ62	WD repeat domain-containing protein 83	8.13e-11	NA	1.17e-06
3. B	Q9ERF3	WD repeat-containing protein 61	7.29e-11	NA	2.87e-04
3. B	Q5R650	WD repeat-containing protein 37	4.42e-05	NA	8.90e-10
3. B	B4P116	Ribosome biogenesis protein WDR12 homolog	1.83e-04	NA	3.32e-04
3. B	Q6NVM2	Katanin p80 WD40 repeat-containing subunit B1	1.70e-04	NA	5.04e-12
3. B	Q5M7T1	Probable cytosolic iron-sulfur protein assembly protein CIAO1	6.06e-11	NA	2.35e-09
3. B	Q5BDJ5	Probable cytosolic iron-sulfur protein assembly protein 1	8.76e-10	NA	7.86e-06
3. B	Q7QJ33	Ribosome biogenesis protein WDR12 homolog	1.79e-04	NA	6.64e-05
3. B	Q9BQ67	Glutamate-rich WD repeat-containing protein 1	1.37e-05	NA	2.33e-12
3. B	O22468	WD-40 repeat-containing protein MSI2	2.51e-07	NA	8.30e-13
3. B	Q54ED4	Glutamate-rich WD repeat-containing protein 1	5.28e-06	NA	1.77e-13
3. B	P59328	WD repeat and HMG-box DNA-binding protein 1	9.16e-04	NA	0.004
3. B	O42249	Guanine nucleotide-binding protein subunit beta-2-like 1	2.12e-10	NA	2.96e-06
3. B	Q9C0J8	pre-mRNA 3' end processing protein WDR33	4.48e-03	NA	7.33e-08
3. B	Q6CMA2	Probable cytosolic iron-sulfur protein assembly protein 1	7.37e-11	NA	4.61e-09
3. B	D3TLL6	Lissencephaly-1 homolog	1.68e-12	NA	7.74e-15
3. B	Q6ZJW8	Polycomb group protein FIE1	2.21e-04	NA	2.85e-06
3. B	A1CUD6	Nuclear distribution protein nudF 1	4.73e-11	NA	1.46e-08
3. B	Q9FFA7	WD repeat-containing protein RUP2	5.57e-07	NA	3.73e-04
3. B	O94967	WD repeat-containing protein 47	2.33e-07	NA	3.11e-07
3. B	Q15291	Retinoblastoma-binding protein 5	7.84e-04	NA	0.001
3. B	Q5AAU3	Protein transport protein SEC31	7.01e-05	NA	6.61e-06
3. B	Q9CWU9	Nucleoporin Nup37	1.94e-07	NA	0.002
3. B	Q2TBP4	POC1 centriolar protein homolog A	3.50e-05	NA	2.36e-09
3. B	Q6PH57	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	2.63e-12	NA	1.01e-06
3. B	P20053	U4/U6 small nuclear ribonucleoprotein PRP4	7.34e-08	NA	1.03e-08
3. B	A2QBZ0	Protein transport protein sec31	9.09e-04	NA	1.13e-04
3. B	Q9Y3F4	Serine-threonine kinase receptor-associated protein	1.36e-05	NA	0.003
3. B	Q5SRY7	F-box/WD repeat-containing protein 11	1.39e-04	NA	1.86e-16
3. B	Q4V8C4	WD repeat-containing protein 5B	1.21e-07	NA	5.63e-13
3. B	Q96FK6	WD repeat-containing protein 89	1.65e-04	NA	0.041
3. B	G0SFB5	Ribosome biogenesis protein YTM1	2.46e-04	NA	7.92e-04
3. B	Q9VPR4	Protein Notchless	2.99e-05	NA	1.21e-21
3. B	P29387	Guanine nucleotide-binding protein subunit beta-4	2.16e-12	NA	2.78e-07
3. B	P69103	Guanine nucleotide-binding protein subunit beta-like protein	7.85e-11	NA	1.10e-07
3. B	Q55CT5	Protein transport protein SEC31	5.42e-03	NA	4.76e-05
3. B	B7PS00	Lissencephaly-1 homolog	4.11e-13	NA	2.21e-14
3. B	Q7ZUV2	Katanin p80 WD40 repeat-containing subunit B1	5.33e-04	NA	2.45e-12
3. B	Q4PSE4	Cell division cycle 20.4, cofactor of APC complex	3.44e-04	NA	9.27e-10
3. B	B4QFZ8	Probable cytosolic iron-sulfur protein assembly protein Ciao1	5.51e-12	NA	6.98e-07
3. B	A7TLU2	Probable cytosolic iron-sulfur protein assembly protein 1	3.53e-10	NA	4.06e-05
3. B	P16520	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	2.80e-12	NA	6.17e-09
3. B	Q93794	F-box/WD repeat-containing protein sel-10	3.00e-06	NA	2.99e-21
3. B	Q05BV3	Echinoderm microtubule-associated protein-like 5	4.83e-03	NA	0.001
3. B	P11017	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	2.54e-12	NA	3.47e-07
3. B	Q8NAA4	Protein Atg16l2	5.59e-04	NA	0.001
3. B	Q5AEF2	Protein transport protein SEC13	8.45e-08	NA	6.38e-04
3. B	Q920J3	Coronin-6	1.44e-03	NA	2.05e-08
3. B	B5X9P2	Probable cytosolic iron-sulfur protein assembly protein ciao1-A	3.30e-11	NA	6.26e-12
3. B	O15736	Protein tipD	1.98e-05	NA	2.18e-06
3. B	Q54R58	Probable tyrosine-protein kinase DDB_G0283397	2.53e-02	NA	0.040
3. B	Q9JJA4	Ribosome biogenesis protein WDR12	3.08e-05	NA	3.28e-07
3. B	Q00664	Nuclear distribution protein nudF	1.17e-11	NA	4.95e-06
3. B	Q4RJN5	Lissencephaly-1 homolog	7.91e-09	NA	2.11e-15
3. B	O45040	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	2.09e-12	NA	3.03e-06