Summary

Q8N0U7

Homolog: O02217.
Function: Serine/threonine-protein phosphatase 2A regulatory subunit rsa-1.

Statistics

Total GO Annotation: 80
Unique PROST Go: 80
Unique BLAST Go: 0

Total Homologs: 38
Unique PROST Homologs: 36
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was O02217 (Serine/threonine-protein phosphatase 2A regulatory subunit rsa-1) with a FATCAT P-Value: 0.00996 and RMSD of 3.53 angstrom. The sequence alignment identity is 19.3%.
Structural alignment shown in left. Query protein Q8N0U7 colored as red in alignment, homolog O02217 colored as blue. Query protein Q8N0U7 is also shown in right top, homolog O02217 showed in right bottom. They are colored based on secondary structures. 

  Q8N0U7 MSSAWKTPRGSDAMPEIMVKIIGSKHFQYLVEKPKIKENDSLKT-ETQTMHQK---PMTDNARQMSRDTPVPINFTDQQTTDNPDDVKE-KKHPE---NN 92
  O02217 ----------------------------MPTDEPS-KRKSILPTIPTSLMLKKSNEALSDFERTFN-DRVMDI-FAENRRI----DVEEFKKNAECFLNI 65

  Q8N0U7 QKSENNQKL-LT-GANS-SRFLDGNIPSQANVHCSSVPTGDQSLSYVHGIPRRKLRDWSLEQMVRGSSDQPEDIGQSPSGTTNE----DAFLL-ALVRRE 184
  O02217 IRS-N--KIDLNWGEGGESRYV--TITRLMKI----LKTSPQSIKDL--LPHN-----TVSNFVK--------I-------TNYNLTIDITLLEELVR-- 132

  Q8N0U7 LKSRPLSSNLLEKLQKELKILDPISSGFLLQSQLS--RL--FL-KHEVPLQL--PTVKILCQRFSKRGSPEMVNYEKLLWFLNSA-ASD--YPQQNKAAA 274
  O02217 --------TVIHAEESYIKLL-PFSEN---STEISSYSLQDFVATHFIPIMIEEPENPVYYTAYA-VGT---------IFFLLGARRRDCVYLKDLLAST 210

  Q8N0U7 DLRKTES--HG-THSQSTPPQHSSSQPEVNRSLLEILKMA-LRTTNGRLNIDNLNLS-FRKEDRSFSGCL-P--LPKVRAICGKHGLY---LTLSLLETL 363
  O02217 LLLQLEECIHAENHCLS-PPK------------IDVFTVAQFRTT----------LSEFRFLDSQRKGLLAPADL-KFF----RDGIFNEVFTKRIFEIS 282

  Q8N0U7 LNHQDLGYQNEIKWQNFVEMLT----R---ASS----DLLSDLPTGKNEKKAPAPPMEPEVPEMSQSKTEHMK--TPEE-ELQPESSPAETSACKDPLKP 449
  O02217 ITYED-G---RIDFKAFVDFVTALKFRHTTASAKYHFEIL-DL---KDDGLLD----EEEIRSISSFQLQNLPDYVPEDNSVNPE---VATAELRDMMR- 366

  Q8N0U7 LKIRPVSQPFVNPAVKNKAEECETWIDRFRKLE---NALYLCDLSNTGVLEK-ERARRLIHNYNLIYNLSLSPQKIDQALRRFRSGENMLLEPALRYLKE 545
  O02217 ----------LN---QNGI----T-LEEF--LANRMNSTFAGFLSNSDDYMKYERREQ------------------------------------------ 404

  Q8N0U7 L 546
  O02217 - 404

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0005509 calcium ion binding
2. P GO:0043029 T cell homeostasis
2. P GO:0097623 potassium ion export across plasma membrane
2. P GO:1900069 regulation of cellular hyperosmotic salinity response
2. P GO:0009826 unidimensional cell growth
2. P GO:0051260 protein homooligomerization
2. P GO:0006942 regulation of striated muscle contraction
2. P GO:0005622 intracellular anatomical structure
2. P GO:0031674 I band
2. P GO:0007615 anesthesia-resistant memory
2. P GO:0005819 spindle
2. P GO:0009524 phragmoplast
2. P GO:0005758 mitochondrial intermembrane space
2. P GO:0086013 membrane repolarization during cardiac muscle cell action potential
2. P GO:0008307 structural constituent of muscle
2. P GO:0004198 calcium-dependent cysteine-type endopeptidase activity
2. P GO:0000159 protein phosphatase type 2A complex
2. P GO:1903818 positive regulation of voltage-gated potassium channel activity
2. P GO:0051721 protein phosphatase 2A binding
2. P GO:0005244 voltage-gated ion channel activity
2. P GO:0033365 protein localization to organelle
2. P GO:0051561 positive regulation of mitochondrial calcium ion concentration
2. P GO:0015459 potassium channel regulator activity
2. P GO:0044325 transmembrane transporter binding
2. P GO:0050864 regulation of B cell activation
2. P GO:0045163 clustering of voltage-gated potassium channels
2. P GO:0002026 regulation of the force of heart contraction
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0031672 A band
2. P GO:0019888 protein phosphatase regulator activity
2. P GO:0032781 positive regulation of ATP-dependent activity
2. P GO:0001782 B cell homeostasis
2. P GO:0005513 detection of calcium ion
2. P GO:0030049 muscle filament sliding
2. P GO:0008016 regulation of heart contraction
2. P GO:0002759 regulation of antimicrobial humoral response
2. P GO:0036444 calcium import into the mitochondrion
2. P GO:0045579 positive regulation of B cell differentiation
2. P GO:1990246 uniplex complex
2. P GO:0016459 myosin complex
2. P GO:0003774 cytoskeletal motor activity
2. P GO:0000913 preprophase band assembly
2. P GO:0051900 regulation of mitochondrial depolarization
2. P GO:1903766 positive regulation of potassium ion export across plasma membrane
2. P GO:0005859 muscle myosin complex
2. P GO:0005267 potassium channel activity
2. P GO:0035303 regulation of dephosphorylation
2. P GO:0008076 voltage-gated potassium channel complex
2. P GO:0032592 integral component of mitochondrial membrane
2. P GO:0005743 mitochondrial inner membrane
2. P GO:0032038 myosin II heavy chain binding
2. P GO:0060048 cardiac muscle contraction
2. P GO:0016461 unconventional myosin complex
2. P GO:0046923 ER retention sequence binding
2. P GO:0055010 ventricular cardiac muscle tissue morphogenesis
2. P GO:0005794 Golgi apparatus
2. P GO:0048536 spleen development
2. P GO:0007120 axial cellular bud site selection
2. P GO:0034705 potassium channel complex
2. P GO:0007121 bipolar cellular bud site selection
2. P GO:0005813 centrosome
2. P GO:1901379 regulation of potassium ion transmembrane transport
2. P GO:0006936 muscle contraction
2. P GO:0086009 membrane repolarization
2. P GO:0006470 protein dephosphorylation
2. P GO:0005739 mitochondrion
2. P GO:0034704 calcium channel complex
2. P GO:0030865 cortical cytoskeleton organization
2. P GO:0047485 protein N-terminus binding
2. P GO:0051560 mitochondrial calcium ion homeostasis
2. P GO:0007519 skeletal muscle tissue development
2. P GO:0006851 mitochondrial calcium ion transmembrane transport
2. P GO:0003400 regulation of COPII vesicle coating
2. P GO:0032147 activation of protein kinase activity
2. P GO:0030427 site of polarized growth
2. P GO:0070509 calcium ion import
2. P GO:0042802 identical protein binding
2. P GO:0046982 protein heterodimerization activity
2. P GO:0003785 actin monomer binding
2. P GO:0072375 medium-term memory

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8N0U7 Uncharacterized protein C1orf87 0 1.49e-163 0.0
1. PB A2AGB2 Uncharacterized protein C1orf87 homolog 2.35e-10 3.33e-52 0.0
2. P Q8BUG5 Calcyphosin-2 9.93e-02 3.73e-04 NA
2. P A8WQT4 Calcium uptake protein 1 homolog, mitochondrial 1.42e-01 4.98e-07 NA
2. P Q9JK24 Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma 4.78e-02 2.14e-04 NA
2. P A2VEI2 Calcium uptake protein 1 homolog, mitochondrial 5.52e-02 1.59e-02 NA
2. P P08590 Myosin light chain 3 2.76e-02 4.03e-02 NA
2. P P30188 Probable calcium-binding protein CML35 9.16e-02 4.85e-02 NA
2. P Q9JM59 Kv channel-interacting protein 2 1.59e-01 2.74e-02 NA
2. P Q969Q6 Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma 3.40e-02 1.54e-04 NA
2. P Q9JJ69 Kv channel-interacting protein 2 1.76e-01 3.87e-02 NA
2. P Q9BPX6 Calcium uptake protein 1, mitochondrial 2.19e-01 6.24e-04 NA
2. P P14649 Myosin light chain 6B 1.98e-02 2.58e-02 NA
2. P Q4R518 Calcium uptake protein 1, mitochondrial 1.99e-01 4.52e-04 NA
2. P Q6DJ05 Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma 4.54e-02 1.25e-03 NA
2. P Q95PZ2 Calcium uptake protein 1 homolog, mitochondrial 3.12e-01 4.02e-06 NA
2. P Q96GE6 Calmodulin-like protein 4 4.04e-02 1.97e-02 NA
2. P Q95Y71 Probable 39S ribosomal protein L45, mitochondrial 5.68e-01 3.37e-02 NA
2. P P53238 Peflin 4.95e-02 1.97e-02 NA
2. P Q8WN03 Kv channel-interacting protein 2 1.80e-01 3.87e-02 NA
2. P Q62082 Myosin regulatory light chain 10 4.95e-02 1.47e-02 NA
2. P Q5E9G1 Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma 4.93e-02 1.17e-04 NA
2. P Q6AXZ3 Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma 4.88e-02 2.88e-04 NA
2. P Q803V3 Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma 3.28e-02 4.22e-04 NA
2. P Q0IIL1 Calcium uptake protein 1, mitochondrial 2.80e-01 2.69e-03 NA
2. P P14725 Plasmodial-specific protein LAV1-2 1.17e-01 2.24e-02 NA
2. P Q9NS61 Kv channel-interacting protein 2 1.85e-01 4.85e-02 NA
2. P Q08925 RNA-binding protein MRN1 3.98e-01 8.23e-04 NA
2. P Q9FEE2 Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 3.91e-02 9.55e-06 NA
2. P Q5R887 Myosin light chain 3 2.67e-02 4.03e-02 NA
2. P D2HZB0 Calcium uptake protein 1, mitochondrial 8.54e-02 4.13e-04 NA
2. P Q9D7J7 Calpain small subunit 2 4.19e-02 3.58e-03 NA
2. P Q9SLI8 Probable serine/threonine protein phosphatase 2A regulatory subunit B''delta 7.32e-02 3.74e-03 NA
2. P Q9XGR4 Serine/threonine protein phosphatase 2A regulatory subunit B''alpha 1.24e-01 6.72e-03 NA
2. P Q8VCX5 Calcium uptake protein 1, mitochondrial 2.56e-02 4.95e-02 NA
2. P Q5UQT3 Uncharacterized protein R347 NA 2.29e-02 NA
2. P Q9BUA6 Myosin regulatory light chain 10 1.29e-01 4.81e-03 NA
2. P O02217 Serine/threonine-protein phosphatase 2A regulatory subunit rsa-1 9.96e-03 6.51e-03 NA