Summary

Q8N123

Homolog: Q4R6N4.
Function: CPX chromosomal region candidate gene 1 protein homolog.

Statistics

Total GO Annotation: 32
Unique PROST Go: 32
Unique BLAST Go: 0

Total Homologs: 19
Unique PROST Homologs: 16
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q4R6N4 (CPX chromosomal region candidate gene 1 protein homolog) with a FATCAT P-Value: 0.00037 and RMSD of 4.46 angstrom. The sequence alignment identity is 77.6%.
Structural alignment shown in left. Query protein Q8N123 colored as red in alignment, homolog Q4R6N4 colored as blue. Query protein Q8N123 is also shown in right top, homolog Q4R6N4 showed in right bottom. They are colored based on secondary structures. 

  Q8N123 MSYPTKEGSDTAGNAHKNSENEPPNDCSTDIESPSADPNMIYQVETNPINREPGTATSQEDVVPQAAENSELETEIQKDQREEDLKEELLLLQTPIPRKL 100
  Q4R6N4 MSSPTKEGSDTAGNAHKNSENEPSNDCTTDIESPSADPNMIYQVETNSINREPGTATSQEDAVPQAAANTELETEIQKDQREEDIKEEPLLLQIPIPRKL 100

  Q8N123 VS--------------------HKPLNDRSRSHSGKVEMKANNFPINHKTRFRLSTSWRVPFINSHEIRSMILHLLCDRYFSQAAGCQNTMWVKRKYIAC 180
  Q4R6N4 ISLMSELGRGNYLRILLVKIDQNKPLNDRSKSHSEKAEMKANNCPVNRKIRFRLSTSWRVPFINNHEIRSMILRLLCERYFSQAEECQDTMWVKQNYIAC 200

  Q8N123 LYHPNSFTHHERAITFRRPSRVHYYRPLTERMTSGKFCKSTDTKGKCRFRAIVRSVLFVSQIQIESIFNIKGFVDILTYIHTMNVMITNTNNGWKYFCPI 280
  Q4R6N4 LYRPNSFTHHERTVIFRRPLRVRYHRPLTERMTSGKFCKSTDMKGKYRFRAIVRSVLFVSHVQLQSLFNRKGFVDILRYNHTRKVMIISTNNGWKYFCPI 300

  Q8N123 CGRLFNTYSELRQHSCSSSGN 301
  Q4R6N4 CGRLFNTYFELRRHSCRSPGN 321

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0005704 polytene chromosome band
2. P GO:0016586 RSC-type complex
2. P GO:0006342
2. P GO:0006337 nucleosome disassembly
2. P GO:0030154 cell differentiation
2. P GO:0006265 DNA topological change
2. P GO:0008283 cell population proliferation
2. P GO:0006368 transcription elongation from RNA polymerase II promoter
2. P GO:0006338 chromatin remodeling
2. P GO:0006325 chromatin organization
2. P GO:0007283 spermatogenesis
2. P GO:0009737 response to abscisic acid
2. P GO:0031490 chromatin DNA binding
2. P GO:0001940 male pronucleus
2. P GO:0001939 female pronucleus
2. P GO:0048096
2. P GO:0051131 chaperone-mediated protein complex assembly
2. P GO:0031011 Ino80 complex
2. P GO:0048813 dendrite morphogenesis
2. P GO:0019731 antibacterial humoral response
2. P GO:0016458 obsolete gene silencing
2. P GO:0005634 nucleus
2. P GO:0043044
2. P GO:0005700 polytene chromosome
2. P GO:1901536 negative regulation of DNA demethylation
2. P GO:0044726 protection of DNA demethylation of female pronucleus
2. P GO:0035064 methylated histone binding
2. P GO:0005703 polytene chromosome puff
2. P GO:2000653 regulation of genetic imprinting
2. P GO:0048366 leaf development
2. P GO:0040016 embryonic cleavage
2. P GO:0031519 PcG protein complex

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q3V0P1 CPX chromosomal region candidate gene 1 protein homolog 2.23e-03 2.52e-18 4.15e-60
1. PB Q4R6N4 CPX chromosomal region candidate gene 1 protein homolog 3.70e-04 2.33e-35 0.0
1. PB Q8N123 CPX chromosomal region candidate gene 1 protein 0 1.26e-160 0.0
2. P Q6IMK0 Developmental pluripotency-associated protein 3 4.11e-01 7.53e-03 NA
2. P P14663 Bactericidin B-3 6.17e-01 1.68e-02 NA
2. P Q5XHX8 Testicular haploid expressed gene protein 1.72e-01 8.87e-03 NA
2. P Q8ST83 Polycomb protein PHO 4.04e-01 6.52e-03 NA
2. P A5HEG9 GRF-interacting factor 10 1.04e-01 1.04e-02 NA
2. P Q8C5L7 RNA-binding protein 34 3.90e-01 4.08e-02 NA
2. P Q8SQW0 Zinc finger C2H2 protein ECU11_0990 8.09e-02 2.69e-03 NA
2. P Q8QZY3 Developmental pluripotency-associated protein 3 4.88e-01 1.41e-02 NA
2. P Q96B54 Zinc finger protein 428 1.67e-01 7.00e-04 NA
2. P Q5JXX7 Transmembrane protein 31 2.19e-01 1.47e-02 NA
2. P O14220 Meiotic expression up-regulated protein 26 3.41e-01 2.75e-03 NA
2. P Q9P2T0 Testicular haploid expressed gene protein 2.96e-01 1.43e-02 NA
2. P P38210 Chromatin structure-remodeling complex protein RSC14 2.90e-01 2.62e-02 NA
2. P Q9D9I1 Testis-expressed protein 43 5.52e-01 1.37e-02 NA
2. P Q8C1M2 Zinc finger protein 428 2.62e-01 2.84e-02 NA
2. P Q6AWT8 Guanine nucleotide-binding protein subunit gamma 3 6.18e-01 1.58e-02 NA