Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q54HW1
(26S proteasome non-ATPase regulatory subunit 10) with a FATCAT P-Value: 6.46e-13 and RMSD of 1.62 angstrom. The sequence alignment identity is 7.9%.
Structural alignment shown in left. Query protein Q8N283 colored as red in alignment, homolog Q54HW1 colored as blue.
Query protein Q8N283 is also shown in right top, homolog Q54HW1 showed in right bottom. They are colored based on secondary structures.
Q8N283 MKRIFSCSSTQVAVER--WNRHDQKLLEAVHRGDVGRVAALASRKSAR-PTKLDSNGQSPFHLAASKGLTECLTILLAN-GADINSKNEDGS-TALHLAT 95 Q54HW1 ------MSGTKF---RTGGTKEDD-LLEFVKVGKLLEVKDLIENQGVKADCK-DEDERTPLHWAAAKGQISVAQYLMDNCKCSPNT-NDDGGWTPLTSAT 88 Q8N283 ISCQPQCVKVLLQHGANEDAV-DAENRSPLHWAASSGCASSVL-LLCDHEAFLDVLDNDGRTPLMIASLGGHAAICSQLLQRG-ARVNVTDKN--DKSAL 190 Q54HW1 SAGHTHMVKLLLEFGADPNTVNDS-KRTPLHYASSKG-RSDIVDLLLTHGA-KNRKDDTGSAPIHRASSNGSVATVERLL-KGEANINSTN-NEGD-TPL 182 Q8N283 ILACEKGSAEVAELLLSHGADAGAV---DS-TGHD-----ALHYALHTQD--KALWRHLQQALSRRRRGGQRLVQHPDLASQASPSEPQAGSPPKSSWRA 279 Q54HW1 HIAAEYNHEDVVECLLKHGADT-TIENKDSKTPIDMSSSQTIKYLI--KEFKK----------------------------------------------- 232 Q8N283 EPEEEQEEKEDEDPCSEEWRWKYEEERRKVVRLEQELVQKTEECKTQAAAYLDLENQIREQAQELGVLLSWEPRASGKQGSSLRPGGDGMEQGCPKDLLA 379 Q54HW1 ---------------------------------------------------------------------------------------------------- 232 Q8N283 ESTQELKKQQQAAATVNPVLAPKKAEDSAPGKIQYEVHGRSQPEEQGPPQSPASETIRKATGQQLTTNGAQTFGPDHADQLPAGQKESSQVLGVEPGGTV 479 Q54HW1 ---------------------------------------------------------------------------------------------------- 232 Q8N283 AEPVGPAAMNQLLLQLREELAAVWREKDAARGALSRPVMEGALGTPRAEAAAAAWEKMEARLERVLARLEWAKAGLQVKPEVPSQESREGALKAAPGSIK 579 Q54HW1 ---------------------------------------------------------------------------------------------------- 232 Q8N283 QDEEKEKRVPGARGEPLGALGGEKALGGLAKGQLEKEMSVLRLSNSNLLEELGELGRERQRLQRELQSLSQRLQREFVPKPEAQVQLQQLRQSVGLLTNE 679 Q54HW1 ---------------------------------------------------------------------------------------------------- 232 Q8N283 LAMEKEATEKLRKLLASQSSGLRGLWDCLPADLVGERSAQSKAAESLEELRACISTLVDRHREAQQVLARLQEENQQLRGSLSPCREPGTSLKAPASPQV 779 Q54HW1 ---------------------------------------------------------------------------------------------------- 232 Q8N283 AALEQDLGKLEEELRAVQATMSGKSQEIGKLKQLLYQATEEVAELRAREAASLRQHEKTRGSLVAQAQAWGQELKALLEKYNTACREVGRLREAVAEERR 879 Q54HW1 ---------------------------------------------------------------------------------------------------- 232 Q8N283 RSGDLAAQAAEQERQASEMRGRSEQFEKTAELLKEKMEHLIGACRDKEAKIKELLKKLEQLSEEVLAIRGENARLALQLQDSQKNHEEIISTYRNHLLNA 979 Q54HW1 ---------------------------------------------------------------------------------------------------- 232 Q8N283 ARGYMEHEVYNILLQILSMEEE 1001 Q54HW1 ---------------------- 232
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0030155 | regulation of cell adhesion |
| 1. PB | GO:0032426 | stereocilium tip |
| 1. PB | GO:1901223 | negative regulation of NIK/NF-kappaB signaling |
| 1. PB | GO:1900383 | regulation of synaptic plasticity by receptor localization to synapse |
| 1. PB | GO:0030054 | cell junction |
| 1. PB | GO:0015629 | actin cytoskeleton |
| 1. PB | GO:0046822 | regulation of nucleocytoplasmic transport |
| 1. PB | GO:0004857 | enzyme inhibitor activity |
| 1. PB | GO:0048013 | ephrin receptor signaling pathway |
| 1. PB | GO:0019901 | protein kinase binding |
| 1. PB | GO:0043197 | dendritic spine |
| 1. PB | GO:0035690 | |
| 1. PB | GO:0072357 | PTW/PP1 phosphatase complex |
| 1. PB | GO:0019208 | phosphatase regulator activity |
| 1. PB | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 1. PB | GO:0007283 | spermatogenesis |
| 1. PB | GO:0043086 | negative regulation of catalytic activity |
| 1. PB | GO:1901187 | regulation of ephrin receptor signaling pathway |
| 1. PB | GO:0070936 | protein K48-linked ubiquitination |
| 1. PB | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 1. PB | GO:0001650 | fibrillar center |
| 1. PB | GO:0006929 | substrate-dependent cell migration |
| 1. PB | GO:0031267 | small GTPase binding |
| 1. PB | GO:0030334 | regulation of cell migration |
| 1. PB | GO:0007605 | sensory perception of sound |
| 1. PB | GO:0051017 | actin filament bundle assembly |
| 1. PB | GO:0031430 | M band |
| 1. PB | GO:2000059 | negative regulation of ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0071889 | 14-3-3 protein binding |
| 1. PB | GO:0097190 | apoptotic signaling pathway |
| 1. PB | GO:0035508 | positive regulation of myosin-light-chain-phosphatase activity |
| 1. PB | GO:0014069 | postsynaptic density |
| 1. PB | GO:0007030 | Golgi organization |
| 1. PB | GO:0031672 | A band |
| 1. PB | GO:2000096 | positive regulation of Wnt signaling pathway, planar cell polarity pathway |
| 1. PB | GO:0005856 | cytoskeleton |
| 1. PB | GO:0046875 | ephrin receptor binding |
| 1. PB | GO:0005929 | cilium |
| 1. PB | GO:0032580 | Golgi cisterna membrane |
| 1. PB | GO:0030018 | Z disc |
| 1. PB | GO:0061025 | membrane fusion |
| 1. PB | GO:0008093 | cytoskeletal anchor activity |
| 1. PB | GO:0099092 | postsynaptic density, intracellular component |
| 1. PB | GO:0043292 | contractile fiber |
| 1. PB | GO:0005938 | cell cortex |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0035507 | regulation of myosin-light-chain-phosphatase activity |
| 1. PB | GO:0005654 | nucleoplasm |
| 2. P | GO:0035840 | old growing cell tip |
| 2. P | GO:0048592 | eye morphogenesis |
| 2. P | GO:0097575 | lateral cell cortex |
| 2. P | GO:0046621 | negative regulation of organ growth |
| 2. P | GO:0051523 | cell growth mode switching, monopolar to bipolar |
| 2. P | GO:0007051 | spindle organization |
| 2. P | GO:0021555 | midbrain-hindbrain boundary morphogenesis |
| 2. P | GO:0097120 | receptor localization to synapse |
| 2. P | GO:1903068 | positive regulation of protein localization to cell tip |
| 2. P | GO:0006937 | regulation of muscle contraction |
| 2. P | GO:0004407 | histone deacetylase activity |
| 2. P | GO:1900825 | regulation of membrane depolarization during cardiac muscle cell action potential |
| 2. P | GO:0007098 | centrosome cycle |
| 2. P | GO:0015030 | Cajal body |
| 2. P | GO:0099523 | presynaptic cytosol |
| 2. P | GO:0005814 | centriole |
| 2. P | GO:0051285 | cell cortex of cell tip |
| 2. P | GO:0071353 | cellular response to interleukin-4 |
| 2. P | GO:0046330 | positive regulation of JNK cascade |
| 2. P | GO:0043231 | intracellular membrane-bounded organelle |
| 2. P | GO:0061246 | establishment or maintenance of bipolar cell polarity regulating cell shape |
| 2. P | GO:0000278 | mitotic cell cycle |
| 2. P | GO:0034451 | centriolar satellite |
| 2. P | GO:1905150 | regulation of voltage-gated sodium channel activity |
| 2. P | GO:1902486 | protein localization to growing cell tip |
| 2. P | GO:0060028 | convergent extension involved in axis elongation |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0043293 | apoptosome |
| 2. P | GO:0006470 | protein dephosphorylation |
| 2. P | GO:0040015 | negative regulation of multicellular organism growth |
| 2. P | GO:1902305 | regulation of sodium ion transmembrane transport |
| 2. P | GO:0070823 | HDA1 complex |
| 2. P | GO:0030950 | establishment or maintenance of actin cytoskeleton polarity |
| 2. P | GO:0070650 | actin filament bundle distribution |
| 2. P | GO:0010633 | negative regulation of epithelial cell migration |
| 2. P | GO:0035371 | microtubule plus-end |
| 2. P | GO:0003779 | actin binding |
| 2. P | GO:0045599 | negative regulation of fat cell differentiation |
| 2. P | GO:1903067 | negative regulation of protein localization to cell tip |
| 2. P | GO:0007099 | centriole replication |
| 2. P | GO:0008631 | intrinsic apoptotic signaling pathway in response to oxidative stress |
| 2. P | GO:0098685 | Schaffer collateral - CA1 synapse |
| 2. P | GO:0060259 | regulation of feeding behavior |
| 2. P | GO:0071963 | establishment or maintenance of cell polarity regulating cell shape |
| 2. P | GO:0035839 | non-growing cell tip |
| 2. P | GO:0099527 | postsynapse to nucleus signaling pathway |
| 2. P | GO:0000776 | kinetochore |
| 2. P | GO:0098686 | hippocampal mossy fiber to CA3 synapse |
| 2. P | GO:2000784 | positive regulation of establishment of cell polarity regulating cell shape |
| 2. P | GO:0033566 | gamma-tubulin complex localization |
| 2. P | GO:0097248 | maintenance of protein location in cell cortex of cell tip |
| 2. P | GO:1904779 | regulation of protein localization to centrosome |
| 2. P | GO:0016322 | neuron remodeling |
| 3. B | GO:1901149 | salicylic acid binding |
| 3. B | GO:0005770 | late endosome |
| 3. B | GO:2000781 | positive regulation of double-strand break repair |
| 3. B | GO:0034765 | regulation of ion transmembrane transport |
| 3. B | GO:0071625 | vocalization behavior |
| 3. B | GO:0042994 | cytoplasmic sequestering of transcription factor |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0035986 | obsolete senescence-associated heterochromatin focus assembly |
| 3. B | GO:0050729 | positive regulation of inflammatory response |
| 3. B | GO:0048337 | positive regulation of mesodermal cell fate specification |
| 3. B | GO:0090037 | positive regulation of protein kinase C signaling |
| 3. B | GO:0051835 | positive regulation of synapse structural plasticity |
| 3. B | GO:0048709 | oligodendrocyte differentiation |
| 3. B | GO:0003215 | cardiac right ventricle morphogenesis |
| 3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 3. B | GO:0043011 | myeloid dendritic cell differentiation |
| 3. B | GO:0035148 | tube formation |
| 3. B | GO:0032456 | endocytic recycling |
| 3. B | GO:0007507 | heart development |
| 3. B | GO:0000079 | regulation of cyclin-dependent protein serine/threonine kinase activity |
| 3. B | GO:0001701 | in utero embryonic development |
| 3. B | GO:0072104 | glomerular capillary formation |
| 3. B | GO:1903779 | regulation of cardiac conduction |
| 3. B | GO:0042088 | T-helper 1 type immune response |
| 3. B | GO:0070563 | negative regulation of vitamin D receptor signaling pathway |
| 3. B | GO:0032421 | stereocilium bundle |
| 3. B | GO:0003270 | Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation |
| 3. B | GO:0010812 | negative regulation of cell-substrate adhesion |
| 3. B | GO:0001756 | somitogenesis |
| 3. B | GO:2001259 | positive regulation of cation channel activity |
| 3. B | GO:0051247 | positive regulation of protein metabolic process |
| 3. B | GO:0021514 | ventral spinal cord interneuron differentiation |
| 3. B | GO:1903522 | regulation of blood circulation |
| 3. B | GO:0070372 | regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0014044 | Schwann cell development |
| 3. B | GO:0006306 | DNA methylation |
| 3. B | GO:0019903 | protein phosphatase binding |
| 3. B | GO:0106310 | protein serine kinase activity |
| 3. B | GO:0003252 | negative regulation of cell proliferation involved in heart valve morphogenesis |
| 3. B | GO:0085020 | protein K6-linked ubiquitination |
| 3. B | GO:0006959 | humoral immune response |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0047499 | calcium-independent phospholipase A2 activity |
| 3. B | GO:0043403 | skeletal muscle tissue regeneration |
| 3. B | GO:0007140 | male meiotic nuclear division |
| 3. B | GO:0001837 | epithelial to mesenchymal transition |
| 3. B | GO:0051494 | negative regulation of cytoskeleton organization |
| 3. B | GO:0048259 | regulation of receptor-mediated endocytosis |
| 3. B | GO:0045070 | positive regulation of viral genome replication |
| 3. B | GO:0003950 | NAD+ ADP-ribosyltransferase activity |
| 3. B | GO:0035264 | multicellular organism growth |
| 3. B | GO:0021519 | spinal cord association neuron specification |
| 3. B | GO:0050885 | neuromuscular process controlling balance |
| 3. B | GO:0015095 | magnesium ion transmembrane transporter activity |
| 3. B | GO:0001726 | ruffle |
| 3. B | GO:0045611 | negative regulation of hemocyte differentiation |
| 3. B | GO:0051489 | regulation of filopodium assembly |
| 3. B | GO:0035622 | intrahepatic bile duct development |
| 3. B | GO:2000822 | regulation of behavioral fear response |
| 3. B | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity |
| 3. B | GO:0045036 | protein targeting to chloroplast |
| 3. B | GO:0033257 | Bcl3/NF-kappaB2 complex |
| 3. B | GO:0016571 | histone methylation |
| 3. B | GO:0043254 | regulation of protein-containing complex assembly |
| 3. B | GO:0045786 | negative regulation of cell cycle |
| 3. B | GO:0070588 | calcium ion transmembrane transport |
| 3. B | GO:0035304 | regulation of protein dephosphorylation |
| 3. B | GO:0010765 | positive regulation of sodium ion transport |
| 3. B | GO:0071546 | pi-body |
| 3. B | GO:0010557 | positive regulation of macromolecule biosynthetic process |
| 3. B | GO:1902367 | negative regulation of Notch signaling pathway involved in somitogenesis |
| 3. B | GO:0003162 | atrioventricular node development |
| 3. B | GO:0007492 | endoderm development |
| 3. B | GO:0033600 | negative regulation of mammary gland epithelial cell proliferation |
| 3. B | GO:0048549 | positive regulation of pinocytosis |
| 3. B | GO:2001214 | positive regulation of vasculogenesis |
| 3. B | GO:0010956 | negative regulation of calcidiol 1-monooxygenase activity |
| 3. B | GO:0030534 | adult behavior |
| 3. B | GO:0086015 | SA node cell action potential |
| 3. B | GO:0032466 | negative regulation of cytokinesis |
| 3. B | GO:1990404 | protein ADP-ribosylase activity |
| 3. B | GO:0005903 | brush border |
| 3. B | GO:0097107 | postsynaptic density assembly |
| 3. B | GO:0061073 | ciliary body morphogenesis |
| 3. B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0036464 | cytoplasmic ribonucleoprotein granule |
| 3. B | GO:1902807 | negative regulation of cell cycle G1/S phase transition |
| 3. B | GO:0003151 | outflow tract morphogenesis |
| 3. B | GO:0007520 | myoblast fusion |
| 3. B | GO:0006913 | nucleocytoplasmic transport |
| 3. B | GO:0072014 | proximal tubule development |
| 3. B | GO:0002437 | inflammatory response to antigenic stimulus |
| 3. B | GO:0002039 | p53 binding |
| 3. B | GO:0002052 | positive regulation of neuroblast proliferation |
| 3. B | GO:0080173 | male-female gamete recognition during double fertilization forming a zygote and endosperm |
| 3. B | GO:0071354 | cellular response to interleukin-6 |
| 3. B | GO:0042734 | presynaptic membrane |
| 3. B | GO:1902309 | negative regulation of peptidyl-serine dephosphorylation |
| 3. B | GO:0031462 | Cul2-RING ubiquitin ligase complex |
| 3. B | GO:0048715 | negative regulation of oligodendrocyte differentiation |
| 3. B | GO:0034142 | toll-like receptor 4 signaling pathway |
| 3. B | GO:0090398 | cellular senescence |
| 3. B | GO:0005123 | death receptor binding |
| 3. B | GO:0008608 | attachment of spindle microtubules to kinetochore |
| 3. B | GO:0043409 | negative regulation of MAPK cascade |
| 3. B | GO:1900273 | positive regulation of long-term synaptic potentiation |
| 3. B | GO:0001886 | endothelial cell morphogenesis |
| 3. B | GO:0043008 | ATP-dependent protein binding |
| 3. B | GO:1900119 | positive regulation of execution phase of apoptosis |
| 3. B | GO:0003160 | endocardium morphogenesis |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0033601 | positive regulation of mammary gland epithelial cell proliferation |
| 3. B | GO:0010313 | phytochrome binding |
| 3. B | GO:0050894 | determination of affect |
| 3. B | GO:0045638 | negative regulation of myeloid cell differentiation |
| 3. B | GO:0001709 | cell fate determination |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:0097546 | ciliary base |
| 3. B | GO:0001947 | heart looping |
| 3. B | GO:0035985 | senescence-associated heterochromatin focus |
| 3. B | GO:0016197 | endosomal transport |
| 3. B | GO:0002027 | regulation of heart rate |
| 3. B | GO:0090201 | negative regulation of release of cytochrome c from mitochondria |
| 3. B | GO:0035116 | embryonic hindlimb morphogenesis |
| 3. B | GO:2000178 | negative regulation of neural precursor cell proliferation |
| 3. B | GO:1904970 | brush border assembly |
| 3. B | GO:0044325 | transmembrane transporter binding |
| 3. B | GO:0008593 | regulation of Notch signaling pathway |
| 3. B | GO:0030496 | midbody |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0072574 | hepatocyte proliferation |
| 3. B | GO:1990760 | osmolarity-sensing cation channel activity |
| 3. B | GO:0010629 | negative regulation of gene expression |
| 3. B | GO:0019888 | protein phosphatase regulator activity |
| 3. B | GO:0001953 | negative regulation of cell-matrix adhesion |
| 3. B | GO:0001763 | morphogenesis of a branching structure |
| 3. B | GO:0030660 | Golgi-associated vesicle membrane |
| 3. B | GO:0002789 | negative regulation of antifungal peptide production |
| 3. B | GO:0072044 | collecting duct development |
| 3. B | GO:0046826 | negative regulation of protein export from nucleus |
| 3. B | GO:1900246 | positive regulation of RIG-I signaling pathway |
| 3. B | GO:1904901 | positive regulation of myosin II filament organization |
| 3. B | GO:0070528 | protein kinase C signaling |
| 3. B | GO:0060999 | positive regulation of dendritic spine development |
| 3. B | GO:0007253 | cytoplasmic sequestering of NF-kappaB |
| 3. B | GO:0097129 | cyclin D2-CDK4 complex |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:0045603 | positive regulation of endothelial cell differentiation |
| 3. B | GO:0010875 | positive regulation of cholesterol efflux |
| 3. B | GO:0045746 | negative regulation of Notch signaling pathway |
| 3. B | GO:0035774 | positive regulation of insulin secretion involved in cellular response to glucose stimulus |
| 3. B | GO:0051289 | protein homotetramerization |
| 3. B | GO:0097604 | temperature-gated cation channel activity |
| 3. B | GO:0070213 | protein auto-ADP-ribosylation |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0046427 | positive regulation of receptor signaling pathway via JAK-STAT |
| 3. B | GO:0043330 | response to exogenous dsRNA |
| 3. B | GO:0055016 | hypochord development |
| 3. B | GO:0031877 | somatostatin receptor binding |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0005769 | early endosome |
| 3. B | GO:0033292 | T-tubule organization |
| 3. B | GO:0071356 | cellular response to tumor necrosis factor |
| 3. B | GO:0002043 | blood vessel endothelial cell proliferation involved in sprouting angiogenesis |
| 3. B | GO:0045665 | negative regulation of neuron differentiation |
| 3. B | GO:0045950 | negative regulation of mitotic recombination |
| 3. B | GO:0055074 | calcium ion homeostasis |
| 3. B | GO:0006816 | calcium ion transport |
| 3. B | GO:0071372 | cellular response to follicle-stimulating hormone stimulus |
| 3. B | GO:0061629 | RNA polymerase II-specific DNA-binding transcription factor binding |
| 3. B | GO:0042405 | nuclear inclusion body |
| 3. B | GO:1904108 | protein localization to ciliary inversin compartment |
| 3. B | GO:0009950 | dorsal/ventral axis specification |
| 3. B | GO:0005525 | GTP binding |
| 3. B | GO:1900245 | positive regulation of MDA-5 signaling pathway |
| 3. B | GO:0045747 | positive regulation of Notch signaling pathway |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0035898 | parathyroid hormone secretion |
| 3. B | GO:0035924 | cellular response to vascular endothelial growth factor stimulus |
| 3. B | GO:0097114 | NMDA glutamate receptor clustering |
| 3. B | GO:0046475 | glycerophospholipid catabolic process |
| 3. B | GO:0106311 | |
| 3. B | GO:0014832 | urinary bladder smooth muscle contraction |
| 3. B | GO:0009644 | response to high light intensity |
| 3. B | GO:1990166 | protein localization to site of double-strand break |
| 3. B | GO:0040028 | regulation of vulval development |
| 3. B | GO:0090521 | glomerular visceral epithelial cell migration |
| 3. B | GO:0031436 | BRCA1-BARD1 complex |
| 3. B | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 3. B | GO:0006469 | negative regulation of protein kinase activity |
| 3. B | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 3. B | GO:0050768 | negative regulation of neurogenesis |
| 3. B | GO:0030307 | positive regulation of cell growth |
| 3. B | GO:0045893 | positive regulation of transcription, DNA-templated |
| 3. B | GO:0005249 | voltage-gated potassium channel activity |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0010838 | positive regulation of keratinocyte proliferation |
| 3. B | GO:0014070 | response to organic cyclic compound |
| 3. B | GO:0010976 | positive regulation of neuron projection development |
| 3. B | GO:0030017 | sarcomere |
| 3. B | GO:0032270 | positive regulation of cellular protein metabolic process |
| 3. B | GO:0045581 | negative regulation of T cell differentiation |
| 3. B | GO:0043491 | protein kinase B signaling |
| 3. B | GO:0005902 | microvillus |
| 3. B | GO:0036336 | dendritic cell migration |
| 3. B | GO:0016055 | Wnt signaling pathway |
| 3. B | GO:0051967 | negative regulation of synaptic transmission, glutamatergic |
| 3. B | GO:0061195 | taste bud formation |
| 3. B | GO:0018345 | protein palmitoylation |
| 3. B | GO:1904106 | protein localization to microvillus |
| 3. B | GO:0032288 | myelin assembly |
| 3. B | GO:0021515 | cell differentiation in spinal cord |
| 3. B | GO:0060058 | positive regulation of apoptotic process involved in mammary gland involution |
| 3. B | GO:1900127 | positive regulation of hyaluronan biosynthetic process |
| 3. B | GO:0002011 | morphogenesis of an epithelial sheet |
| 3. B | GO:0071212 | subsynaptic reticulum |
| 3. B | GO:0014807 | regulation of somitogenesis |
| 3. B | GO:0031670 | cellular response to nutrient |
| 3. B | GO:0030279 | negative regulation of ossification |
| 3. B | GO:0048663 | neuron fate commitment |
| 3. B | GO:0030016 | myofibril |
| 3. B | GO:0006584 | catecholamine metabolic process |
| 3. B | GO:0060743 | epithelial cell maturation involved in prostate gland development |
| 3. B | GO:0003182 | coronary sinus valve morphogenesis |
| 3. B | GO:0055117 | regulation of cardiac muscle contraction |
| 3. B | GO:1902339 | positive regulation of apoptotic process involved in morphogenesis |
| 3. B | GO:0044605 | phosphocholine transferase activity |
| 3. B | GO:0071345 | cellular response to cytokine stimulus |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0051146 | striated muscle cell differentiation |
| 3. B | GO:0045171 | intercellular bridge |
| 3. B | GO:0035255 | ionotropic glutamate receptor binding |
| 3. B | GO:0043069 | negative regulation of programmed cell death |
| 3. B | GO:1902260 | negative regulation of delayed rectifier potassium channel activity |
| 3. B | GO:0031013 | troponin I binding |
| 3. B | GO:0043046 | DNA methylation involved in gamete generation |
| 3. B | GO:0070198 | protein localization to chromosome, telomeric region |
| 3. B | GO:0090238 | positive regulation of arachidonic acid secretion |
| 3. B | GO:0045751 | negative regulation of Toll signaling pathway |
| 3. B | GO:0072576 | liver morphogenesis |
| 3. B | GO:0045838 | positive regulation of membrane potential |
| 3. B | GO:1902263 | apoptotic process involved in embryonic digit morphogenesis |
| 3. B | GO:0036371 | protein localization to T-tubule |
| 3. B | GO:0003344 | pericardium morphogenesis |
| 3. B | GO:0044030 | regulation of DNA methylation |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0070742 | C2H2 zinc finger domain binding |
| 3. B | GO:0140627 | ubiquitin-dependent protein catabolic process via the C-end degron rule pathway |
| 3. B | GO:0003208 | cardiac ventricle morphogenesis |
| 3. B | GO:0003214 | cardiac left ventricle morphogenesis |
| 3. B | GO:0072332 | intrinsic apoptotic signaling pathway by p53 class mediator |
| 3. B | GO:2000812 | regulation of barbed-end actin filament capping |
| 3. B | GO:0010424 | DNA methylation on cytosine within a CG sequence |
| 3. B | GO:0051101 | regulation of DNA binding |
| 3. B | GO:0007613 | memory |
| 3. B | GO:0014731 | spectrin-associated cytoskeleton |
| 3. B | GO:0044309 | neuron spine |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0098978 | glutamatergic synapse |
| 3. B | GO:2000001 | regulation of DNA damage checkpoint |
| 3. B | GO:0055013 | cardiac muscle cell development |
| 3. B | GO:0071560 | cellular response to transforming growth factor beta stimulus |
| 3. B | GO:0061630 | ubiquitin protein ligase activity |
| 3. B | GO:0070534 | protein K63-linked ubiquitination |
| 3. B | GO:0010882 | regulation of cardiac muscle contraction by calcium ion signaling |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0098871 | postsynaptic actin cytoskeleton |
| 3. B | GO:0097435 | supramolecular fiber organization |
| 3. B | GO:1904385 | cellular response to angiotensin |
| 3. B | GO:0046331 | lateral inhibition |
| 3. B | GO:0014704 | intercalated disc |
| 3. B | GO:0097113 | AMPA glutamate receptor clustering |
| 3. B | GO:0042995 | cell projection |
| 3. B | GO:0030308 | negative regulation of cell growth |
| 3. B | GO:2000321 | positive regulation of T-helper 17 cell differentiation |
| 3. B | GO:0046959 | habituation |
| 3. B | GO:0001955 | blood vessel maturation |
| 3. B | GO:0010225 | response to UV-C |
| 3. B | GO:0099519 | dense core granule cytoskeletal transport |
| 3. B | GO:0007219 | Notch signaling pathway |
| 3. B | GO:0035994 | response to muscle stretch |
| 3. B | GO:0038023 | signaling receptor activity |
| 3. B | GO:0060354 | negative regulation of cell adhesion molecule production |
| 3. B | GO:0031441 | negative regulation of mRNA 3'-end processing |
| 3. B | GO:0032232 | negative regulation of actin filament bundle assembly |
| 3. B | GO:0034638 | phosphatidylcholine catabolic process |
| 3. B | GO:0003332 | negative regulation of extracellular matrix constituent secretion |
| 3. B | GO:0033280 | response to vitamin D |
| 3. B | GO:0046976 | histone methyltransferase activity (H3-K27 specific) |
| 3. B | GO:1905274 | regulation of modification of postsynaptic actin cytoskeleton |
| 3. B | GO:0045794 | negative regulation of cell volume |
| 3. B | GO:1904717 | regulation of AMPA glutamate receptor clustering |
| 3. B | GO:0031047 | gene silencing by RNA |
| 3. B | GO:0042048 | olfactory behavior |
| 3. B | GO:0071222 | cellular response to lipopolysaccharide |
| 3. B | GO:0071447 | cellular response to hydroperoxide |
| 3. B | GO:0035914 | skeletal muscle cell differentiation |
| 3. B | GO:0000731 | DNA synthesis involved in DNA repair |
| 3. B | GO:0016529 | sarcoplasmic reticulum |
| 3. B | GO:0071800 | podosome assembly |
| 3. B | GO:0051497 | negative regulation of stress fiber assembly |
| 3. B | GO:0140374 | antiviral innate immune response |
| 3. B | GO:0000082 | G1/S transition of mitotic cell cycle |
| 3. B | GO:0005096 | GTPase activator activity |
| 3. B | GO:0030034 | microvillar actin bundle assembly |
| 3. B | GO:1901222 | regulation of NIK/NF-kappaB signaling |
| 3. B | GO:1904743 | negative regulation of telomeric DNA binding |
| 3. B | GO:0071347 | cellular response to interleukin-1 |
| 3. B | GO:0003241 | growth involved in heart morphogenesis |
| 3. B | GO:0072660 | maintenance of protein location in plasma membrane |
| 3. B | GO:0009967 | positive regulation of signal transduction |
| 3. B | GO:0071359 | cellular response to dsRNA |
| 3. B | GO:0055007 | cardiac muscle cell differentiation |
| 3. B | GO:0060289 | compartment boundary maintenance |
| 3. B | GO:0031674 | I band |
| 3. B | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle |
| 3. B | GO:0005112 | Notch binding |
| 3. B | GO:0003198 | epithelial to mesenchymal transition involved in endocardial cushion formation |
| 3. B | GO:0102991 | myristoyl-CoA hydrolase activity |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0061028 | establishment of endothelial barrier |
| 3. B | GO:0001889 | liver development |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0060674 | placenta blood vessel development |
| 3. B | GO:0039529 | RIG-I signaling pathway |
| 3. B | GO:0033209 | tumor necrosis factor-mediated signaling pathway |
| 3. B | GO:0036309 | protein localization to M-band |
| 3. B | GO:0060317 | cardiac epithelial to mesenchymal transition |
| 3. B | GO:0097117 | guanylate kinase-associated protein clustering |
| 3. B | GO:0086069 | bundle of His cell to Purkinje myocyte communication |
| 3. B | GO:0045732 | positive regulation of protein catabolic process |
| 3. B | GO:0060948 | cardiac vascular smooth muscle cell development |
| 3. B | GO:0098919 | structural constituent of postsynaptic density |
| 3. B | GO:0034446 | substrate adhesion-dependent cell spreading |
| 3. B | GO:0002357 | defense response to tumor cell |
| 3. B | GO:0002070 | epithelial cell maturation |
| 3. B | GO:0031432 | titin binding |
| 3. B | GO:0034112 | positive regulation of homotypic cell-cell adhesion |
| 3. B | GO:0022407 | regulation of cell-cell adhesion |
| 3. B | GO:2000346 | negative regulation of hepatocyte proliferation |
| 3. B | GO:0060442 | branching involved in prostate gland morphogenesis |
| 3. B | GO:0006471 | protein ADP-ribosylation |
| 3. B | GO:0070531 | BRCA1-A complex |
| 3. B | GO:0030154 | cell differentiation |
| 3. B | GO:0060582 | cell fate determination involved in pattern specification |
| 3. B | GO:0060842 | arterial endothelial cell differentiation |
| 3. B | GO:0086070 | SA node cell to atrial cardiac muscle cell communication |
| 3. B | GO:1900452 | regulation of long-term synaptic depression |
| 3. B | GO:0009411 | response to UV |
| 3. B | GO:0003229 | ventricular cardiac muscle tissue development |
| 3. B | GO:0045955 | negative regulation of calcium ion-dependent exocytosis |
| 3. B | GO:0070972 | protein localization to endoplasmic reticulum |
| 3. B | GO:2001027 | negative regulation of endothelial cell chemotaxis |
| 3. B | GO:0043268 | positive regulation of potassium ion transport |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0060035 | notochord cell development |
| 3. B | GO:0002193 | MAML1-RBP-Jkappa- ICN1 complex |
| 3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:2000737 | negative regulation of stem cell differentiation |
| 3. B | GO:0048754 | branching morphogenesis of an epithelial tube |
| 3. B | GO:2001279 | regulation of unsaturated fatty acid biosynthetic process |
| 3. B | GO:0004861 | cyclin-dependent protein serine/threonine kinase inhibitor activity |
| 3. B | GO:0010001 | glial cell differentiation |
| 3. B | GO:0045736 | negative regulation of cyclin-dependent protein serine/threonine kinase activity |
| 3. B | GO:1902531 | regulation of intracellular signal transduction |
| 3. B | GO:0000062 | fatty-acyl-CoA binding |
| 3. B | GO:1900827 | positive regulation of membrane depolarization during cardiac muscle cell action potential |
| 3. B | GO:0031960 | response to corticosteroid |
| 3. B | GO:0060074 | synapse maturation |
| 3. B | GO:0003256 | regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation |
| 3. B | GO:1901201 | regulation of extracellular matrix assembly |
| 3. B | GO:0048892 | lateral line nerve development |
| 3. B | GO:0032049 | cardiolipin biosynthetic process |
| 3. B | GO:0010667 | negative regulation of cardiac muscle cell apoptotic process |
| 3. B | GO:0038061 | NIK/NF-kappaB signaling |
| 3. B | GO:0003170 | heart valve development |
| 3. B | GO:0019730 | antimicrobial humoral response |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0048708 | astrocyte differentiation |
| 3. B | GO:0030674 | protein-macromolecule adaptor activity |
| 3. B | GO:0001708 | cell fate specification |
| 3. B | GO:0034058 | endosomal vesicle fusion |
| 3. B | GO:0003222 | ventricular trabecula myocardium morphogenesis |
| 3. B | GO:0030326 | embryonic limb morphogenesis |
| 3. B | GO:0060740 | prostate gland epithelium morphogenesis |
| 3. B | GO:0030837 | negative regulation of actin filament polymerization |
| 3. B | GO:0071286 | cellular response to magnesium ion |
| 3. B | GO:0090309 | positive regulation of DNA methylation-dependent heterochromatin assembly |
| 3. B | GO:0060411 | cardiac septum morphogenesis |
| 3. B | GO:0097237 | cellular response to toxic substance |
| 3. B | GO:1905938 | positive regulation of germ cell proliferation |
| 3. B | GO:0050775 | positive regulation of dendrite morphogenesis |
| 3. B | GO:0060113 | inner ear receptor cell differentiation |
| 3. B | GO:0045967 | negative regulation of growth rate |
| 3. B | GO:0043034 | costamere |
| 3. B | GO:0021986 | habenula development |
| 3. B | GO:0018230 | peptidyl-L-cysteine S-palmitoylation |
| 3. B | GO:0032791 | lead ion binding |
| 3. B | GO:0031297 | replication fork processing |
| 3. B | GO:0030046 | parallel actin filament bundle assembly |
| 3. B | GO:0046843 | dorsal appendage formation |
| 3. B | GO:0016567 | protein ubiquitination |
| 3. B | GO:0051059 | NF-kappaB binding |
| 3. B | GO:0036166 | phenotypic switching |
| 3. B | GO:0046469 | platelet activating factor metabolic process |
| 3. B | GO:0044877 | protein-containing complex binding |
| 3. B | GO:0070986 | left/right axis specification |
| 3. B | GO:1990416 | cellular response to brain-derived neurotrophic factor stimulus |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0019887 | protein kinase regulator activity |
| 3. B | GO:0046974 | histone methyltransferase activity (H3-K9 specific) |
| 3. B | GO:0098908 | regulation of neuronal action potential |
| 3. B | GO:0018024 | histone-lysine N-methyltransferase activity |
| 3. B | GO:0010468 | regulation of gene expression |
| 3. B | GO:0045814 | negative regulation of gene expression, epigenetic |
| 3. B | GO:0042805 | actinin binding |
| 3. B | GO:0002467 | germinal center formation |
| 3. B | GO:0001569 | branching involved in blood vessel morphogenesis |
| 3. B | GO:0009864 | induced systemic resistance, jasmonic acid mediated signaling pathway |
| 3. B | GO:0036377 | arbuscular mycorrhizal association |
| 3. B | GO:0043063 | intercellular bridge organization |
| 3. B | GO:0061419 | positive regulation of transcription from RNA polymerase II promoter in response to hypoxia |
| 3. B | GO:0007221 | positive regulation of transcription of Notch receptor target |
| 3. B | GO:0046473 | phosphatidic acid metabolic process |
| 3. B | GO:0099612 | protein localization to axon |
| 3. B | GO:1905456 | regulation of lymphoid progenitor cell differentiation |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:1902041 | regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| 3. B | GO:0098703 | calcium ion import across plasma membrane |
| 3. B | GO:0042686 | regulation of cardioblast cell fate specification |
| 3. B | GO:0045669 | positive regulation of osteoblast differentiation |
| 3. B | GO:0046338 | phosphatidylethanolamine catabolic process |
| 3. B | GO:0071260 | cellular response to mechanical stimulus |
| 3. B | GO:0097422 | tubular endosome |
| 3. B | GO:0071316 | cellular response to nicotine |
| 3. B | GO:0018027 | peptidyl-lysine dimethylation |
| 3. B | GO:0035176 | social behavior |
| 3. B | GO:0010960 | magnesium ion homeostasis |
| 3. B | GO:0080085 | signal recognition particle, chloroplast targeting |
| 3. B | GO:2001204 | regulation of osteoclast development |
| 3. B | GO:0048536 | spleen development |
| 3. B | GO:2000114 | regulation of establishment of cell polarity |
| 3. B | GO:0042826 | histone deacetylase binding |
| 3. B | GO:1990090 | cellular response to nerve growth factor stimulus |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0035418 | protein localization to synapse |
| 3. B | GO:0042325 | regulation of phosphorylation |
| 3. B | GO:0010614 | negative regulation of cardiac muscle hypertrophy |
| 3. B | GO:0021675 | nerve development |
| 3. B | GO:0035646 | endosome to melanosome transport |
| 3. B | GO:0044232 | organelle membrane contact site |
| 3. B | GO:0030219 | megakaryocyte differentiation |
| 3. B | GO:0048899 | anterior lateral line development |
| 3. B | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 3. B | GO:0062043 | positive regulation of cardiac epithelial to mesenchymal transition |
| 3. B | GO:0070208 | protein heterotrimerization |
| 3. B | GO:0001222 | transcription corepressor binding |
| 3. B | GO:0045316 | negative regulation of compound eye photoreceptor development |
| 3. B | GO:0010596 | negative regulation of endothelial cell migration |
| 3. B | GO:0010434 | bract formation |
| 3. B | GO:0007009 | plasma membrane organization |
| 3. B | GO:0045607 | regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0032996 | Bcl3-Bcl10 complex |
| 3. B | GO:0043517 | positive regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:0019843 | rRNA binding |
| 3. B | GO:0070212 | protein poly-ADP-ribosylation |
| 3. B | GO:1900271 | regulation of long-term synaptic potentiation |
| 3. B | GO:2000048 | negative regulation of cell-cell adhesion mediated by cadherin |
| 3. B | GO:1904058 | positive regulation of sensory perception of pain |
| 3. B | GO:0060979 | vasculogenesis involved in coronary vascular morphogenesis |
| 3. B | GO:0090399 | replicative senescence |
| 3. B | GO:0000151 | ubiquitin ligase complex |
| 3. B | GO:0030160 | synaptic receptor adaptor activity |
| 3. B | GO:2000209 | regulation of anoikis |
| 3. B | GO:0045662 | negative regulation of myoblast differentiation |
| 3. B | GO:0072017 | distal tubule development |
| 3. B | GO:0007440 | foregut morphogenesis |
| 3. B | GO:0048711 | positive regulation of astrocyte differentiation |
| 3. B | GO:0072073 | kidney epithelium development |
| 3. B | GO:0045859 | regulation of protein kinase activity |
| 3. B | GO:0008360 | regulation of cell shape |
| 3. B | GO:0004622 | lysophospholipase activity |
| 3. B | GO:0035023 | regulation of Rho protein signal transduction |
| 3. B | GO:0007386 | compartment pattern specification |
| 3. B | GO:0070316 | regulation of G0 to G1 transition |
| 3. B | GO:0008022 | protein C-terminus binding |
| 3. B | GO:0010650 | positive regulation of cell communication by electrical coupling |
| 3. B | GO:0003181 | atrioventricular valve morphogenesis |
| 3. B | GO:0090051 | negative regulation of cell migration involved in sprouting angiogenesis |
| 3. B | GO:1903051 | negative regulation of proteolysis involved in cellular protein catabolic process |
| 3. B | GO:0021773 | striatal medium spiny neuron differentiation |
| 3. B | GO:0010638 | positive regulation of organelle organization |
| 3. B | GO:0060768 | regulation of epithelial cell proliferation involved in prostate gland development |
| 3. B | GO:0060998 | regulation of dendritic spine development |
| 3. B | GO:2000811 | negative regulation of anoikis |
| 3. B | GO:0048102 | autophagic cell death |
| 3. B | GO:1901216 | positive regulation of neuron death |
| 3. B | GO:0006897 | endocytosis |
| 3. B | GO:0045608 | negative regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0055008 | cardiac muscle tissue morphogenesis |
| 3. B | GO:1901339 | regulation of store-operated calcium channel activity |
| 3. B | GO:2000630 | positive regulation of miRNA metabolic process |
| 3. B | GO:0014066 | regulation of phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0071314 | cellular response to cocaine |
| 3. B | GO:0000242 | pericentriolar material |
| 3. B | GO:0003197 | endocardial cushion development |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0003723 | RNA binding |
| 3. B | GO:0042665 | regulation of ectodermal cell fate specification |
| 3. B | GO:1903589 | positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis |
| 3. B | GO:0098907 | regulation of SA node cell action potential |
| 3. B | GO:0003203 | endocardial cushion morphogenesis |
| 3. B | GO:0008157 | protein phosphatase 1 binding |
| 3. B | GO:1905667 | negative regulation of protein localization to endosome |
| 3. B | GO:1905383 | protein localization to presynapse |
| 3. B | GO:1905453 | regulation of myeloid progenitor cell differentiation |
| 3. B | GO:1900026 | positive regulation of substrate adhesion-dependent cell spreading |
| 3. B | GO:0035965 | cardiolipin acyl-chain remodeling |
| 3. B | GO:0003677 | DNA binding |
| 3. B | GO:0048471 | perinuclear region of cytoplasm |
| 3. B | GO:0086014 | atrial cardiac muscle cell action potential |
| 3. B | GO:0016409 | palmitoyltransferase activity |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0003184 | pulmonary valve morphogenesis |
| 3. B | GO:0030507 | spectrin binding |
| 3. B | GO:0032695 | negative regulation of interleukin-12 production |
| 3. B | GO:0003169 | coronary vein morphogenesis |
| 3. B | GO:0043518 | negative regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:1904908 | negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric |
| 3. B | GO:0060528 | secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development |
| 3. B | GO:0047389 | glycerophosphocholine phosphodiesterase activity |
| 3. B | GO:0002315 | marginal zone B cell differentiation |
| 3. B | GO:0010832 | negative regulation of myotube differentiation |
| 3. B | GO:2000111 | positive regulation of macrophage apoptotic process |
| 3. B | GO:0071532 | ankyrin repeat binding |
| 3. B | GO:0070682 | proteasome regulatory particle assembly |
| 3. B | GO:0070412 | R-SMAD binding |
| 3. B | GO:0140439 | protein-cysteine S-stearoyltransferase activity |
| 3. B | GO:0051438 | regulation of ubiquitin-protein transferase activity |
| 3. B | GO:0045648 | positive regulation of erythrocyte differentiation |
| 3. B | GO:0031143 | pseudopodium |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0007368 | determination of left/right symmetry |
| 3. B | GO:0071244 | cellular response to carbon dioxide |
| 3. B | GO:0060982 | coronary artery morphogenesis |
| 3. B | GO:0007616 | long-term memory |
| 3. B | GO:0045687 | positive regulation of glial cell differentiation |
| 3. B | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 3. B | GO:0051726 | regulation of cell cycle |
| 3. B | GO:0002268 | follicular dendritic cell differentiation |
| 3. B | GO:0014912 | negative regulation of smooth muscle cell migration |
| 3. B | GO:0031359 | integral component of chloroplast outer membrane |
| 3. B | GO:0010780 | meiotic DNA double-strand break formation involved in reciprocal meiotic recombination |
| 3. B | GO:0071407 | cellular response to organic cyclic compound |
| 3. B | GO:0031867 | EP4 subtype prostaglandin E2 receptor binding |
| 3. B | GO:0015248 | sterol transporter activity |
| 3. B | GO:0048103 | somatic stem cell division |
| 3. B | GO:1902412 | regulation of mitotic cytokinesis |
| 3. B | GO:0043266 | regulation of potassium ion transport |
| 3. B | GO:0050955 | thermoception |
| 3. B | GO:0060843 | venous endothelial cell differentiation |
| 3. B | GO:2000774 | positive regulation of cellular senescence |
| 3. B | GO:0001838 | embryonic epithelial tube formation |
| 3. B | GO:2000651 | positive regulation of sodium ion transmembrane transporter activity |
| 3. B | GO:0006528 | asparagine metabolic process |
| 3. B | GO:0032496 | response to lipopolysaccharide |
| 3. B | GO:0061399 | positive regulation of transcription from RNA polymerase II promoter in response to cobalt ion |
| 3. B | GO:0140031 | phosphorylation-dependent protein binding |
| 3. B | GO:0051306 | mitotic sister chromatid separation |
| 3. B | GO:0050957 | equilibrioception |
| 3. B | GO:0003207 | cardiac chamber formation |
| 3. B | GO:0061384 | heart trabecula morphogenesis |
| 3. B | GO:0048060 | negative gravitaxis |
| 3. B | GO:0072015 | glomerular visceral epithelial cell development |
| 3. B | GO:2000304 | positive regulation of ceramide biosynthetic process |
| 3. B | GO:0035014 | phosphatidylinositol 3-kinase regulator activity |
| 3. B | GO:0030315 | T-tubule |
| 3. B | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 3. B | GO:1905936 | regulation of germ cell proliferation |
| 3. B | GO:0003209 | cardiac atrium morphogenesis |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:0048052 | R1/R6 cell differentiation |
| 3. B | GO:1903670 | regulation of sprouting angiogenesis |
| 3. B | GO:0021531 | spinal cord radial glial cell differentiation |
| 3. B | GO:0032091 | negative regulation of protein binding |
| 3. B | GO:0010888 | negative regulation of lipid storage |
| 3. B | GO:0002091 | negative regulation of receptor internalization |
| 3. B | GO:0010761 | fibroblast migration |
| 3. B | GO:0005262 | calcium channel activity |
| 3. B | GO:2000969 | positive regulation of AMPA receptor activity |
| 3. B | GO:0017020 | myosin phosphatase regulator activity |
| 3. B | GO:0008290 | F-actin capping protein complex |
| 3. B | GO:0102545 | phosphatidyl phospholipase B activity |
| 3. B | GO:0097062 | dendritic spine maintenance |
| 3. B | GO:0031901 | early endosome membrane |
| 3. B | GO:0003213 | cardiac right atrium morphogenesis |
| 3. B | GO:0045602 | negative regulation of endothelial cell differentiation |
| 3. B | GO:0045869 | negative regulation of single stranded viral RNA replication via double stranded DNA intermediate |
| 3. B | GO:0050793 | regulation of developmental process |
| 3. B | GO:0098910 | regulation of atrial cardiac muscle cell action potential |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:0009912 | auditory receptor cell fate commitment |
| 3. B | GO:0030941 | chloroplast targeting sequence binding |
| 3. B | GO:0046849 | bone remodeling |
| 3. B | GO:2000249 | regulation of actin cytoskeleton reorganization |
| 3. B | GO:0048265 | response to pain |
| 3. B | GO:0016279 | protein-lysine N-methyltransferase activity |
| 3. B | GO:0043066 | negative regulation of apoptotic process |
| 3. B | GO:1904355 | positive regulation of telomere capping |
| 3. B | GO:0010745 | negative regulation of macrophage derived foam cell differentiation |
| 3. B | GO:0001895 | retina homeostasis |
| 3. B | GO:0030511 | positive regulation of transforming growth factor beta receptor signaling pathway |
| 3. B | GO:0031466 | Cul5-RING ubiquitin ligase complex |
| 3. B | GO:0097543 | ciliary inversin compartment |
| 3. B | GO:0017124 | SH3 domain binding |
| 3. B | GO:0003847 | 1-alkyl-2-acetylglycerophosphocholine esterase activity |
| 3. B | GO:0048170 | positive regulation of long-term neuronal synaptic plasticity |
| 3. B | GO:0048854 | brain morphogenesis |
| 3. B | GO:0003219 | cardiac right ventricle formation |
| 3. B | GO:0043235 | receptor complex |
| 3. B | GO:0001658 | branching involved in ureteric bud morphogenesis |
| 3. B | GO:0017171 | serine hydrolase activity |
| 3. B | GO:0072144 | glomerular mesangial cell development |
| 3. B | GO:0034393 | positive regulation of smooth muscle cell apoptotic process |
| 3. B | GO:0016235 | aggresome |
| 3. B | GO:0060956 | endocardial cell differentiation |
| 3. B | GO:1904632 | cellular response to glucoside |
| 3. B | GO:1902230 | negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:0140036 | ubiquitin-dependent protein binding |
| 3. B | GO:0071322 | cellular response to carbohydrate stimulus |
| 3. B | GO:1901189 | positive regulation of ephrin receptor signaling pathway |
| 3. B | GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway |
| 3. B | GO:0050931 | pigment cell differentiation |
| 3. B | GO:0034704 | calcium channel complex |
| 3. B | GO:0060038 | cardiac muscle cell proliferation |
| 3. B | GO:0030029 | actin filament-based process |
| 3. B | GO:0032212 | positive regulation of telomere maintenance via telomerase |
| 3. B | GO:0042297 | vocal learning |
| 3. B | GO:0002040 | sprouting angiogenesis |
| 3. B | GO:0007569 | cell aging |
| 3. B | GO:0061001 | regulation of dendritic spine morphogenesis |
| 3. B | GO:0045064 | T-helper 2 cell differentiation |
| 3. B | GO:0060236 | regulation of mitotic spindle organization |
| 3. B | GO:2000279 | negative regulation of DNA biosynthetic process |
| 3. B | GO:0045596 | negative regulation of cell differentiation |
| 3. B | GO:0051386 | regulation of neurotrophin TRK receptor signaling pathway |
| 3. B | GO:0097110 | scaffold protein binding |
| 3. B | GO:1990393 | 3M complex |
| 3. B | GO:0034184 | positive regulation of maintenance of mitotic sister chromatid cohesion |
| 3. B | GO:0060803 | BMP signaling pathway involved in mesodermal cell fate specification |
| 3. B | GO:0045618 | positive regulation of keratinocyte differentiation |
| 3. B | GO:0003180 | aortic valve morphogenesis |
| 3. B | GO:1990705 | cholangiocyte proliferation |
| 3. B | GO:0060013 | righting reflex |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0050968 | detection of chemical stimulus involved in sensory perception of pain |
| 3. B | GO:0042246 | tissue regeneration |
| 3. B | GO:0003157 | endocardium development |
| 3. B | GO:0002455 | humoral immune response mediated by circulating immunoglobulin |
| 3. B | GO:0007229 | integrin-mediated signaling pathway |
| 3. B | GO:1900451 | positive regulation of glutamate receptor signaling pathway |
| 3. B | GO:1903343 | positive regulation of meiotic DNA double-strand break formation |
| 3. B | GO:0090029 | negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 3. B | GO:0046533 | negative regulation of photoreceptor cell differentiation |
| 3. B | GO:0097150 | neuronal stem cell population maintenance |
| 3. B | GO:1901019 | regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:0031625 | ubiquitin protein ligase binding |
| 3. B | GO:0004067 | asparaginase activity |
| 3. B | GO:1903849 | positive regulation of aorta morphogenesis |
| 3. B | GO:0003713 | transcription coactivator activity |
| 3. B | GO:0045162 | clustering of voltage-gated sodium channels |
| 3. B | GO:0042633 | hair cycle |
| 3. B | GO:0060413 | atrial septum morphogenesis |
| 3. B | GO:0051865 | protein autoubiquitination |
| 3. B | GO:0050728 | negative regulation of inflammatory response |
| 3. B | GO:0003192 | mitral valve formation |
| 3. B | GO:0043065 | positive regulation of apoptotic process |
| 3. B | GO:0008139 | nuclear localization sequence binding |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0033268 | node of Ranvier |
| 3. B | GO:0048665 | neuron fate specification |
| 3. B | GO:0090200 | positive regulation of release of cytochrome c from mitochondria |
| 3. B | GO:1904630 | cellular response to diterpene |
| 3. B | GO:0003264 | regulation of cardioblast proliferation |
| 3. B | GO:0019705 | protein-cysteine S-myristoyltransferase activity |
| 3. B | GO:0010613 | positive regulation of cardiac muscle hypertrophy |
| 3. B | GO:0043596 | nuclear replication fork |
| 3. B | GO:0050807 | regulation of synapse organization |
| 3. B | GO:0061314 | Notch signaling involved in heart development |
| 3. B | GO:0008361 | regulation of cell size |
| 3. B | GO:0071709 | membrane assembly |
| 3. B | GO:0015278 | calcium-release channel activity |
| 3. B | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
| 3. B | GO:0060992 | response to fungicide |
| 3. B | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 3. B | GO:0016290 | palmitoyl-CoA hydrolase activity |
| 3. B | GO:0014732 | skeletal muscle atrophy |
| 3. B | GO:0019899 | enzyme binding |
| 3. B | GO:1902647 | negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process |
| 3. B | GO:0099173 | postsynapse organization |
| 3. B | GO:0051570 | regulation of histone H3-K9 methylation |
| 3. B | GO:0034587 | piRNA metabolic process |
| 3. B | GO:2000974 | negative regulation of pro-B cell differentiation |
| 3. B | GO:0060997 | dendritic spine morphogenesis |
| 3. B | GO:0048845 | venous blood vessel morphogenesis |
| 3. B | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity |
| 3. B | GO:0050714 | positive regulation of protein secretion |
| 3. B | GO:0060135 | maternal process involved in female pregnancy |
| 3. B | GO:0031663 | lipopolysaccharide-mediated signaling pathway |
| 3. B | GO:2000311 | regulation of AMPA receptor activity |
| 3. B | GO:0043055 | maintenance of dauer |
| 3. B | GO:0086066 | atrial cardiac muscle cell to AV node cell communication |
| 3. B | GO:1901021 | positive regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0060253 | negative regulation of glial cell proliferation |
| 3. B | GO:0005925 | focal adhesion |
| 3. B | GO:0050966 | detection of mechanical stimulus involved in sensory perception of pain |
| 3. B | GO:0006621 | protein retention in ER lumen |
| 3. B | GO:0021707 | cerebellar granule cell differentiation |
| 3. B | GO:0033256 | I-kappaB/NF-kappaB complex |
| 3. B | GO:0014031 | mesenchymal cell development |
| 3. B | GO:0032991 | protein-containing complex |
| 3. B | GO:0051151 | negative regulation of smooth muscle cell differentiation |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0035544 | negative regulation of SNARE complex assembly |
| 3. B | GO:0097553 | calcium ion transmembrane import into cytosol |
| 3. B | GO:0048871 | multicellular organismal homeostasis |
| 3. B | GO:0031668 | cellular response to extracellular stimulus |
| 3. B | GO:2000821 | regulation of grooming behavior |
| 3. B | GO:0000139 | Golgi membrane |
| 3. B | GO:0060708 | spongiotrophoblast differentiation |
| 3. B | GO:0035556 | intracellular signal transduction |
| 3. B | GO:0042326 | negative regulation of phosphorylation |
| 3. B | GO:0030292 | protein tyrosine kinase inhibitor activity |
| 3. B | GO:0019706 | protein-cysteine S-palmitoyltransferase activity |
| 3. B | GO:0003273 | cell migration involved in endocardial cushion formation |
| 3. B | GO:0030900 | forebrain development |
| 3. B | GO:1903793 | positive regulation of anion transport |
| 3. B | GO:0070168 | negative regulation of biomineral tissue development |
| 3. B | GO:0044354 | macropinosome |
| 3. B | GO:1904357 | negative regulation of telomere maintenance via telomere lengthening |
| 3. B | GO:0031076 | embryonic camera-type eye development |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q6ZW76 | Ankyrin repeat and SAM domain-containing protein 3 | 9.47e-06 | 1.22e-06 | 1.97e-09 |
| 1. PB | A6NC57 | Ankyrin repeat domain-containing protein 62 | 3.22e-06 | 3.78e-27 | 9.18e-13 |
| 1. PB | Q9Y2G4 | Ankyrin repeat domain-containing protein 6 | 8.30e-05 | 1.44e-06 | 6.82e-14 |
| 1. PB | Q5U312 | Ankycorbin | 3.23e-09 | 5.77e-41 | 2.62e-52 |
| 1. PB | P59672 | Ankyrin repeat and SAM domain-containing protein 1A | 2.54e-03 | 1.68e-07 | 1.30e-09 |
| 1. PB | E1C656 | E3 ubiquitin-protein ligase HACE1 | 9.06e-06 | 6.17e-03 | 8.94e-18 |
| 1. PB | Q5VUR7 | Putative ankyrin repeat domain-containing protein 20A3 | 5.19e-07 | 5.62e-25 | 1.32e-21 |
| 1. PB | O14974 | Protein phosphatase 1 regulatory subunit 12A | 3.32e-04 | 6.56e-06 | 2.18e-14 |
| 1. PB | Q8VHK1 | Caskin-2 | 3.16e-02 | 2.52e-02 | 4.73e-13 |
| 1. PB | Q5TYW2 | Ankyrin repeat domain-containing protein 20A1 | 2.62e-06 | 1.60e-25 | 2.26e-21 |
| 1. PB | Q92625 | Ankyrin repeat and SAM domain-containing protein 1A | 6.22e-03 | 6.01e-07 | 5.04e-12 |
| 1. PB | Q69YU3 | Ankyrin repeat domain-containing protein 34A | 1.73e-01 | 4.97e-04 | 0.029 |
| 1. PB | Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 9.51e-08 | 2.07e-13 | 4.37e-49 |
| 1. PB | Q80VM7 | Ankyrin repeat domain-containing protein 24 | 6.65e-06 | 9.13e-24 | 6.95e-50 |
| 1. PB | Q8BIZ1 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 9.86e-03 | 1.22e-08 | 1.17e-11 |
| 1. PB | Q6DD51 | Caskin-2 | 7.90e-04 | 3.58e-02 | 3.73e-13 |
| 1. PB | Q9EP71 | Ankycorbin | 8.66e-11 | 2.53e-40 | 1.23e-54 |
| 1. PB | Q8N283 | Ankyrin repeat domain-containing protein 35 | 0 | 1.10e-159 | 0.0 |
| 1. PB | Q8HYY4 | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein | 1.99e-06 | 2.95e-12 | 2.88e-51 |
| 1. PB | Q8TF21 | Ankyrin repeat domain-containing protein 24 | 3.50e-05 | 1.27e-14 | 2.51e-49 |
| 1. PB | Q4UJ75 | Putative ankyrin repeat domain-containing protein 20A4 | 5.96e-05 | 2.04e-24 | 2.95e-21 |
| 1. PB | Q69ZU8 | Ankyrin repeat domain-containing protein 6 | 4.47e-04 | 1.21e-04 | 8.59e-14 |
| 1. PB | Q8CGB3 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.08e-04 | 2.95e-12 | 8.68e-50 |
| 1. PB | Q90623 | Protein phosphatase 1 regulatory subunit 12A | 3.77e-02 | 2.97e-07 | 6.49e-13 |
| 1. PB | Q5CZ79 | Ankyrin repeat domain-containing protein 20B | 6.88e-06 | 1.08e-24 | 1.87e-20 |
| 1. PB | Q811D2 | Ankyrin repeat domain-containing protein 26 | 4.83e-03 | 3.94e-09 | 2.49e-14 |
| 1. PB | Q9BXX2 | Ankyrin repeat domain-containing protein 30B | 4.47e-02 | 3.80e-03 | 3.07e-14 |
| 1. PB | A5PMU4 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 2.73e-02 | 7.22e-08 | 8.59e-12 |
| 1. PB | P0C6S7 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 1.87e-02 | 1.56e-08 | 7.34e-12 |
| 1. PB | P0C6C1 | Ankyrin repeat domain-containing protein 34C | 1.22e-01 | 7.81e-03 | 1.08e-08 |
| 1. PB | Q9GL21 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 4.72e-08 | 7.61e-11 | 1.62e-51 |
| 1. PB | Q9CZK6 | Ankyrin repeat and SAM domain-containing protein 3 | 6.60e-05 | 5.01e-05 | 1.48e-09 |
| 1. PB | Q9UPS8 | Ankyrin repeat domain-containing protein 26 | 3.32e-02 | 3.21e-05 | 1.54e-12 |
| 1. PB | Q5SQ80 | Putative ankyrin repeat domain-containing protein 20A2 | 1.63e-05 | 2.85e-25 | 1.34e-21 |
| 1. PB | Q9P0K7 | Ankycorbin | 2.75e-06 | 4.89e-38 | 5.53e-53 |
| 1. PB | Q10728 | Protein phosphatase 1 regulatory subunit 12A | 3.87e-02 | 1.37e-05 | 3.20e-14 |
| 1. PB | Q6DRG7 | Protein phosphatase 1 regulatory subunit 12A | 4.04e-02 | 5.50e-07 | 5.52e-14 |
| 1. PB | Q9DBR7 | Protein phosphatase 1 regulatory subunit 12A | 1.17e-02 | 8.16e-06 | 2.84e-14 |
| 1. PB | Q7Z6G8 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 4.44e-03 | 7.12e-08 | 1.54e-11 |
| 1. PB | O60237 | Protein phosphatase 1 regulatory subunit 12B | 5.57e-02 | 1.19e-07 | 4.09e-13 |
| 1. PB | Q3UYR4 | Espin-like protein | 5.87e-03 | 3.37e-05 | 8.99e-10 |
| 1. PB | A2A2Z9 | Ankyrin repeat domain-containing protein 18B | 1.25e-06 | 1.37e-21 | 1.12e-15 |
| 1. PB | Q8BG95 | Protein phosphatase 1 regulatory subunit 12B | 3.05e-03 | 7.03e-08 | 1.05e-12 |
| 1. PB | Q6ZVH7 | Espin-like protein | 7.94e-03 | 1.16e-04 | 5.26e-10 |
| 1. PB | Q5BJT1 | Ankyrin repeat domain-containing protein 34A | 1.20e-01 | 3.28e-03 | 0.041 |
| 1. PB | Q5M9H0 | Ankyrin repeat and SAM domain-containing protein 3 | 4.25e-04 | 2.50e-04 | 1.71e-09 |
| 1. PB | Q6DCL5 | E3 ubiquitin-protein ligase HACE1 | 1.25e-03 | 9.00e-03 | 6.93e-18 |
| 1. PB | Q8IVF6 | Ankyrin repeat domain-containing protein 18A | 2.57e-06 | 1.26e-18 | 5.33e-15 |
| 2. P | O60132 | Tip elongation aberrant protein Tea4 | 9.00e-01 | 3.98e-02 | NA |
| 2. P | Q69ZB0 | Leucine-rich repeat and coiled-coil domain-containing protein 1 | 9.55e-05 | 1.39e-02 | NA |
| 2. P | Q9CR92 | Coiled-coil domain-containing protein 96 | 3.56e-03 | 1.91e-02 | NA |
| 2. P | Q9PY82 | Protein mu-NS | NA | 2.24e-02 | NA |
| 2. P | P23508 | Colorectal mutant cancer protein | 5.10e-03 | 5.68e-03 | NA |
| 2. P | Q758V8 | HDA1 complex subunit 3 | 2.04e-02 | 1.62e-03 | NA |
| 2. P | Q9C099 | Leucine-rich repeat and coiled-coil domain-containing protein 1 | 4.82e-03 | 3.80e-03 | NA |
| 2. P | Q9P209 | Centrosomal protein of 72 kDa | 4.16e-03 | 2.80e-03 | NA |
| 2. P | Q9D3R3 | Centrosomal protein of 72 kDa | 6.44e-02 | 1.35e-03 | NA |
| 2. P | Q6AI12 | Ankyrin repeat domain-containing protein 40 | 1.05e-01 | 7.19e-03 | NA |
| 2. P | Q6NRC9 | Leucine-rich repeat and coiled-coil domain-containing protein 1 | 3.52e-04 | 7.34e-03 | NA |
| 2. P | Q5BQN5 | WPP domain-associated protein (Fragment) | 1.75e-03 | 3.15e-02 | NA |
| 2. P | Q1X8D7 | Leucine-rich repeat-containing protein 36 | 2.29e-01 | 2.72e-03 | NA |
| 2. P | Q3URD3 | Sarcolemmal membrane-associated protein | 1.12e-03 | 2.34e-03 | NA |
| 2. P | Q3MJ40 | Coiled-coil domain-containing protein 144B | 8.79e-02 | 1.80e-02 | NA |
| 2. P | Q3LGD4 | Rab11 family-interacting protein 4A | 2.73e-02 | 1.85e-02 | NA |
| 2. P | Q3TYX8 | RUN and FYVE domain-containing protein 4 | 1.25e-01 | 4.14e-02 | NA |
| 2. P | Q3V0M2 | Leucine-rich repeat-containing protein 36 | 1.78e-01 | 1.95e-02 | NA |
| 3. B | Q9H560 | Putative ankyrin repeat domain-containing protein 19 | 4.00e-12 | NA | 3.35e-16 |
| 3. B | Q7TQI7 | Ankyrin repeat and BTB/POZ domain-containing protein 2 | 3.42e-02 | NA | 0.004 |
| 3. B | Q5I159 | I-Kappa-B like protein C2 | NA | NA | 0.039 |
| 3. B | Q8N9V6 | Ankyrin repeat domain-containing protein 53 | 3.07e-03 | NA | 1.56e-08 |
| 3. B | Q8VHS6 | Ankyrin repeat and SOCS box protein 15 | 5.25e-03 | NA | 3.77e-12 |
| 3. B | Q8BX02 | KN motif and ankyrin repeat domain-containing protein 2 | 1.29e-01 | NA | 4.11e-06 |
| 3. B | Q5URB9 | Putative ankyrin repeat protein R840 | NA | NA | 0.003 |
| 3. B | Q8IZ07 | Ankyrin repeat domain-containing protein 13A | 6.34e-02 | NA | 0.003 |
| 3. B | Q9J5H9 | Putative ankyrin repeat protein FPV022 | NA | NA | 2.94e-06 |
| 3. B | Q8IUH5 | Palmitoyltransferase ZDHHC17 | 8.96e-06 | NA | 2.71e-10 |
| 3. B | Q54KA7 | Ankyrin repeat, PH and SEC7 domain containing protein secG | 1.10e-03 | NA | 3.77e-21 |
| 3. B | Q0V8G2 | GA-binding protein subunit beta-2 | 3.49e-03 | NA | 2.16e-11 |
| 3. B | Q6AFL2 | Putative ankyrin-containing lipoprotein Lxx09580 | 3.14e-10 | NA | 1.09e-04 |
| 3. B | Q99NH0 | Ankyrin repeat domain-containing protein 17 | 1.28e-01 | NA | 5.67e-14 |
| 3. B | Q7ZYD9 | Ankyrin repeat domain-containing protein 13C-B | 2.19e-01 | NA | 0.020 |
| 3. B | Q2QL84 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.40e-03 | NA | 2.11e-05 |
| 3. B | A9JR78 | Tonsoku-like protein | 1.02e-01 | NA | 0.003 |
| 3. B | P57078 | Receptor-interacting serine/threonine-protein kinase 4 | 5.17e-04 | NA | 7.36e-11 |
| 3. B | Q6P9J5 | KN motif and ankyrin repeat domain-containing protein 4 | 3.61e-01 | NA | 4.06e-06 |
| 3. B | Q499M5 | Ankyrin repeat domain-containing protein 16 | 1.73e-06 | NA | 3.82e-10 |
| 3. B | Q3TYL0 | IQ motif and ankyrin repeat domain-containing protein 1 | 4.45e-03 | NA | 0.022 |
| 3. B | Q9Y575 | Ankyrin repeat and SOCS box protein 3 | 4.11e-04 | NA | 1.65e-11 |
| 3. B | Q1LZC5 | Ankyrin repeat domain-containing protein 54 | 6.08e-03 | NA | 1.04e-09 |
| 3. B | Q6S5J6 | Krev interaction trapped protein 1 | 9.61e-02 | NA | 2.77e-05 |
| 3. B | Q2QLB5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.17e-03 | NA | 3.11e-04 |
| 3. B | P0C6P7 | Protein fem-1 homolog B | 2.38e-04 | NA | 4.23e-06 |
| 3. B | Q8CEF1 | Protein fem-1 homolog C | 1.48e-03 | NA | 1.52e-10 |
| 3. B | Q4FE45 | E3 ubiquitin-protein ligase XBAT33 | 3.42e-03 | NA | 1.40e-06 |
| 3. B | Q9WV74 | Ankyrin repeat and SOCS box protein 1 | 2.29e-05 | NA | 0.002 |
| 3. B | Q9J5H8 | Putative ankyrin repeat protein FPV023 | NA | NA | 1.49e-06 |
| 3. B | D3J162 | Protein VAPYRIN | 3.65e-05 | NA | 1.65e-14 |
| 3. B | Q0P5B9 | Ankyrin repeat domain-containing protein 39 | 3.54e-06 | NA | 5.32e-10 |
| 3. B | Q06527 | Ankyrin homolog | 1.43e-07 | NA | 4.50e-13 |
| 3. B | Q9UM47 | Neurogenic locus notch homolog protein 3 | 8.00e-02 | NA | 2.58e-04 |
| 3. B | Q8N7Z5 | Ankyrin repeat domain-containing protein 31 | 2.90e-02 | NA | 1.64e-06 |
| 3. B | Q01317 | Ankyrin repeat protein nuc-2 | 2.23e-02 | NA | 4.99e-13 |
| 3. B | Q641X1 | Ankyrin repeat domain-containing protein 61 | 3.71e-04 | NA | 1.51e-11 |
| 3. B | Q566C8 | Ankyrin repeat domain-containing protein 54 | 3.41e-03 | NA | 5.00e-10 |
| 3. B | P14585 | Protein lin-12 | 1.65e-02 | NA | 0.003 |
| 3. B | Q96T49 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 5.43e-05 | NA | 1.20e-11 |
| 3. B | O14593 | DNA-binding protein RFXANK | 1.26e-04 | NA | 2.88e-08 |
| 3. B | Q8LSQ2 | Probable signal recognition particle 43 kDa protein, chloroplastic | 8.95e-02 | NA | 3.56e-07 |
| 3. B | Q9H1D0 | Transient receptor potential cation channel subfamily V member 6 | 3.16e-04 | NA | 0.049 |
| 3. B | Q9UPQ3 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 | 6.34e-01 | NA | 0.004 |
| 3. B | Q99466 | Neurogenic locus notch homolog protein 4 | 8.83e-02 | NA | 0.002 |
| 3. B | Q8K4M9 | Oxysterol-binding protein-related protein 1 | 2.48e-05 | NA | 9.80e-07 |
| 3. B | Q07E41 | Cortactin-binding protein 2 | 2.56e-02 | NA | 7.79e-11 |
| 3. B | P62774 | Myotrophin | 1.12e-06 | NA | 4.44e-05 |
| 3. B | Q00PJ3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.31e-04 | NA | 1.73e-04 |
| 3. B | Q9Y576 | Ankyrin repeat and SOCS box protein 1 | 1.85e-05 | NA | 0.001 |
| 3. B | Q9Z2X2 | 26S proteasome non-ATPase regulatory subunit 10 | 1.02e-09 | NA | 5.29e-14 |
| 3. B | Q95N27 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 1.06e-03 | NA | 5.01e-11 |
| 3. B | P97819 | 85/88 kDa calcium-independent phospholipase A2 | 1.69e-03 | NA | 6.33e-09 |
| 3. B | Q8N6S4 | Ankyrin repeat domain-containing protein 13C | 1.61e-01 | NA | 0.005 |
| 3. B | Q9WV06 | Ankyrin repeat domain-containing protein 2 | 4.68e-04 | NA | 7.27e-14 |
| 3. B | Q02357 | Ankyrin-1 | 1.85e-02 | NA | 1.78e-19 |
| 3. B | O44997 | Death-associated protein kinase dapk-1 | 1.28e-03 | NA | 5.97e-11 |
| 3. B | Q5FVC7 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 2.45e-03 | NA | 2.86e-04 |
| 3. B | P41412 | Cell division cycle-related protein res2/pct1 | 3.45e-04 | NA | 0.014 |
| 3. B | Q2QLC6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.54e-03 | NA | 3.22e-05 |
| 3. B | Q4ULZ2 | Putative ankyrin repeat protein RF_0580 | 6.94e-05 | NA | 8.14e-12 |
| 3. B | Q8N8A2 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 1.51e-02 | NA | 1.34e-21 |
| 3. B | Q9D504 | Ankyrin repeat domain-containing protein 7 | 9.72e-10 | NA | 1.49e-21 |
| 3. B | Q9NU02 | Ankyrin repeat and EF-hand domain-containing protein 1 | 4.92e-03 | NA | 4.61e-08 |
| 3. B | Q29RM5 | Protein fem-1 homolog A | 3.00e-04 | NA | 1.19e-07 |
| 3. B | Q5ZK62 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 1.64e-03 | NA | 6.70e-05 |
| 3. B | Q5TYM7 | CARD- and ANK-domain containing inflammasome adapter protein | 3.01e-05 | NA | 5.95e-16 |
| 3. B | B2FKA7 | Actin-binding protein Smlt3054 | 8.15e-03 | NA | 1.35e-04 |
| 3. B | Q21920 | Ankyrin repeat and KH domain-containing protein mask-1 | 1.21e-02 | NA | 1.00e-10 |
| 3. B | Q65XV2 | E3 ubiquitin-protein ligase XB3 | 6.16e-05 | NA | 1.02e-06 |
| 3. B | Q5R6D7 | Ankyrin repeat and SOCS box protein 8 | 3.22e-04 | NA | 1.85e-14 |
| 3. B | S0DPL8 | Apicidin F cluster transcription factor apf2 | 1.75e-03 | NA | 1.94e-04 |
| 3. B | Q8WUF5 | RelA-associated inhibitor | 5.16e-01 | NA | 5.08e-04 |
| 3. B | Q8IV38 | Ankyrin repeat and MYND domain-containing protein 2 | 8.43e-03 | NA | 2.64e-10 |
| 3. B | A1ZBY1 | Protein fem-1 homolog B | 1.15e-03 | NA | 3.01e-07 |
| 3. B | Q08353 | NF-kappa-B inhibitor alpha | 1.23e-04 | NA | 4.83e-15 |
| 3. B | Q554E7 | Putative ZDHHC-type palmitoyltransferase 5 | 3.25e-04 | NA | 3.64e-06 |
| 3. B | Q14DN9 | Ankyrin repeat and death domain-containing protein 1B | 8.09e-04 | NA | 1.10e-14 |
| 3. B | A6QL64 | Ankyrin repeat domain-containing protein 36A | 1.49e-01 | NA | 3.86e-12 |
| 3. B | Q4JHE0 | Probable E3 ubiquitin-protein ligase XBOS36 | 4.13e-04 | NA | 9.70e-09 |
| 3. B | Q9VUX2 | E3 ubiquitin-protein ligase mind-bomb | 2.23e-02 | NA | 6.17e-08 |
| 3. B | Q5UQC4 | Putative ankyrin repeat protein R229 | NA | NA | 4.28e-05 |
| 3. B | P53356 | Tyrosine-protein kinase HTK16 | 6.57e-03 | NA | 2.24e-04 |
| 3. B | Q9SQK3 | Ankyrin repeat domain-containing protein EMB506, chloroplastic | 8.24e-05 | NA | 2.06e-11 |
| 3. B | A2RT91 | Ankyrin and armadillo repeat-containing protein | 1.22e-01 | NA | 0.020 |
| 3. B | Q7T0Q1 | Myotrophin | 9.63e-07 | NA | 5.93e-05 |
| 3. B | Q4UL00 | Putative ankyrin repeat protein RF_0922 | 7.86e-07 | NA | 0.001 |
| 3. B | Q6NRD0 | Ankyrin repeat domain-containing protein 13C-A | 3.32e-01 | NA | 0.004 |
| 3. B | Q6P6B7 | Ankyrin repeat domain-containing protein 16 | 2.06e-06 | NA | 6.36e-07 |
| 3. B | A2AQH4 | BCL-6 corepressor-like protein 1 | 5.03e-01 | NA | 4.21e-04 |
| 3. B | O70511 | Ankyrin-3 | 9.23e-02 | NA | 1.93e-20 |
| 3. B | Q3U0D9 | E3 ubiquitin-protein ligase HACE1 | 4.12e-03 | NA | 1.85e-17 |
| 3. B | Q5R8C8 | Ankyrin repeat domain-containing protein 46 | 9.26e-04 | NA | 6.42e-04 |
| 3. B | Q9Z2X3 | 26S proteasome non-ATPase regulatory subunit 10 | 9.92e-10 | NA | 1.78e-14 |
| 3. B | Q9TXQ1 | Poly [ADP-ribose] polymerase tankyrase | 3.23e-01 | NA | 3.11e-08 |
| 3. B | Q7Z8U2 | Palmitoyltransferase akr1 | 3.18e-04 | NA | 1.28e-14 |
| 3. B | Q5UPE2 | Putative ankyrin repeat protein L63 | NA | NA | 0.040 |
| 3. B | Q7T163 | Kinase D-interacting substrate of 220 kDa B | 1.59e-02 | NA | 1.51e-18 |
| 3. B | Q68DC2 | Ankyrin repeat and SAM domain-containing protein 6 | 1.53e-03 | NA | 1.32e-06 |
| 3. B | Q9J505 | Putative ankyrin repeat protein FPV230 | NA | NA | 1.34e-04 |
| 3. B | A1X154 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 8.29e-04 | NA | 2.95e-06 |
| 3. B | Q7XUW4 | Potassium channel KOR2 | 8.52e-02 | NA | 3.40e-12 |
| 3. B | Q6RI86 | Transient receptor potential cation channel subfamily A member 1 | 5.99e-05 | NA | 4.95e-15 |
| 3. B | Q15057 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 2.16e-03 | NA | 1.49e-05 |
| 3. B | Q1RMI3 | GA-binding protein subunit beta-1 | 8.00e-05 | NA | 3.70e-11 |
| 3. B | Q9WV48 | SH3 and multiple ankyrin repeat domains protein 1 | 1.92e-01 | NA | 6.78e-11 |
| 3. B | Q8N2N9 | Ankyrin repeat domain-containing protein 36B | 4.86e-03 | NA | 3.49e-15 |
| 3. B | Q6BP80 | Palmitoyltransferase AKR1 | 8.86e-04 | NA | 2.26e-04 |
| 3. B | Q63369 | Nuclear factor NF-kappa-B p105 subunit (Fragment) | 8.24e-04 | NA | 1.23e-08 |
| 3. B | D3J163 | Protein VAPYRIN-LIKE | 6.37e-06 | NA | 4.15e-10 |
| 3. B | Q28C34 | Ankyrin repeat domain-containing protein 13C | 2.46e-01 | NA | 0.003 |
| 3. B | Q10311 | Ankyrin repeat-containing protein C6C3.08 | 2.89e-09 | NA | 1.49e-05 |
| 3. B | A2A690 | Protein TANC2 | 4.33e-02 | NA | 1.61e-17 |
| 3. B | A5A3E0 | POTE ankyrin domain family member F | 2.21e-03 | NA | 3.39e-13 |
| 3. B | Q07DW4 | Cortactin-binding protein 2 | 3.83e-02 | NA | 5.17e-10 |
| 3. B | Q6KAE5 | Probable E3 ubiquitin-protein ligase XBOS32 | 1.18e-03 | NA | 3.91e-06 |
| 3. B | Q4R3S3 | Ankyrin repeat domain-containing protein 7 | 2.04e-07 | NA | 2.01e-19 |
| 3. B | Q6FJ70 | Palmitoyltransferase AKR1 | 1.24e-05 | NA | 1.93e-05 |
| 3. B | Q38898 | Potassium channel AKT2/3 | 5.03e-02 | NA | 1.63e-07 |
| 3. B | Q61982 | Neurogenic locus notch homolog protein 3 | 1.69e-01 | NA | 4.86e-04 |
| 3. B | Q7T3X9 | Notch-regulated ankyrin repeat-containing protein B | 1.24e-02 | NA | 0.021 |
| 3. B | Q7T3P8 | Protein fem-1 homolog C | 8.95e-05 | NA | 1.19e-11 |
| 3. B | Q5UPX1 | Putative ankyrin repeat protein L289 | NA | NA | 5.80e-04 |
| 3. B | Q9Z2F6 | B-cell lymphoma 3 protein homolog | 2.89e-03 | NA | 1.49e-12 |
| 3. B | P17221 | Sex-determining protein fem-1 | 1.07e-04 | NA | 9.85e-09 |
| 3. B | Q8WXK4 | Ankyrin repeat and SOCS box protein 12 | 3.84e-05 | NA | 1.41e-07 |
| 3. B | Q8BXP5 | Photoreceptor ankyrin repeat protein | 1.66e-02 | NA | 2.47e-05 |
| 3. B | O83515 | Putative ankyrin repeat-containing protein TP_0502 | 8.40e-04 | NA | 3.28e-04 |
| 3. B | A7MB89 | Protein fem-1 homolog C | 2.43e-03 | NA | 3.75e-10 |
| 3. B | Q9WTT2 | Caseinolytic peptidase B protein homolog | 7.87e-02 | NA | 0.007 |
| 3. B | Q80T11 | Usher syndrome type-1G protein homolog | 1.59e-02 | NA | 4.95e-07 |
| 3. B | Q9D2J7 | Ankyrin repeat and EF-hand domain-containing protein 1 | 9.85e-04 | NA | 2.45e-07 |
| 3. B | Q5UPH1 | Putative ankyrin repeat protein L99 | NA | NA | 4.65e-04 |
| 3. B | Q9D119 | Protein phosphatase 1 regulatory subunit 27 | 1.42e-03 | NA | 3.13e-07 |
| 3. B | Q5UQF1 | Putative ankyrin repeat protein L483 | NA | NA | 0.002 |
| 3. B | Q9H2K2 | Poly [ADP-ribose] polymerase tankyrase-2 | 1.78e-02 | NA | 5.26e-17 |
| 3. B | Q9D061 | Acyl-CoA-binding domain-containing protein 6 | 3.40e-03 | NA | 9.19e-06 |
| 3. B | Q2TB02 | NF-kappa-B inhibitor delta | 6.21e-04 | NA | 0.003 |
| 3. B | Q8VHA6 | Ankyrin repeat and SOCS box protein 18 | 1.34e-04 | NA | 1.82e-11 |
| 3. B | Q06547 | GA-binding protein subunit beta-1 | 3.50e-03 | NA | 5.01e-11 |
| 3. B | Q91ZT7 | Ankyrin repeat and SOCS box protein 10 | 1.44e-04 | NA | 8.78e-19 |
| 3. B | A6NHY2 | Ankyrin repeat and death domain-containing protein 1B | 4.45e-05 | NA | 9.30e-13 |
| 3. B | Q0VF96 | Cingulin-like protein 1 | 5.27e-04 | NA | 0.001 |
| 3. B | P55273 | Cyclin-dependent kinase 4 inhibitor D | 4.98e-06 | NA | 3.28e-06 |
| 3. B | Q62415 | Apoptosis-stimulating of p53 protein 1 | 4.85e-02 | NA | 0.008 |
| 3. B | Q5RCK5 | Ankyrin repeat and SOCS box protein 7 | 3.39e-05 | NA | 2.15e-12 |
| 3. B | Q8UVC1 | Inversin | 9.50e-04 | NA | 9.31e-20 |
| 3. B | Q8GSP8 | Zygote-specific protein 3 | 6.23e-02 | NA | 0.003 |
| 3. B | Q2IBD4 | Cortactin-binding protein 2 | 6.85e-02 | NA | 3.63e-09 |
| 3. B | P0CG39 | POTE ankyrin domain family member J | 1.52e-03 | NA | 1.93e-12 |
| 3. B | P46530 | Neurogenic locus notch homolog protein 1 | 9.27e-02 | NA | 0.018 |
| 3. B | Q6ZVZ8 | Ankyrin repeat and SOCS box protein 18 | 6.07e-05 | NA | 3.85e-14 |
| 3. B | Q6TGW5 | Osteoclast-stimulating factor 1 | 1.84e-03 | NA | 0.003 |
| 3. B | Q2IBE3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.27e-04 | NA | 2.20e-05 |
| 3. B | Q63618 | Espin | 6.75e-03 | NA | 1.18e-12 |
| 3. B | B9EJA2 | Cortactin-binding protein 2 | 3.26e-02 | NA | 1.13e-09 |
| 3. B | Q8MJ50 | Osteoclast-stimulating factor 1 | 2.26e-04 | NA | 0.011 |
| 3. B | Q8IWB6 | Inactive serine/threonine-protein kinase TEX14 | 2.46e-01 | NA | 3.98e-04 |
| 3. B | Q3UES3 | Poly [ADP-ribose] polymerase tankyrase-2 | 2.32e-02 | NA | 4.59e-17 |
| 3. B | A5WVX9 | Palmitoyltransferase ZDHHC17 | 6.98e-07 | NA | 1.37e-08 |
| 3. B | Q9J504 | Putative ankyrin repeat protein FPV231 | NA | NA | 2.12e-12 |
| 3. B | Q91ZT9 | Ankyrin repeat and SOCS box protein 8 | 8.45e-04 | NA | 2.03e-14 |
| 3. B | P40578 | Protein MGA2 | 1.19e-01 | NA | 0.009 |
| 3. B | Q58CT0 | Dynein axonemal heavy chain 12 | 1.00e-03 | NA | 3.73e-04 |
| 3. B | F1LTE0 | Protein TANC2 | 2.65e-02 | NA | 1.91e-17 |
| 3. B | O08764 | Ankyrin repeat and BTB/POZ domain-containing protein 2 | 7.81e-02 | NA | 0.008 |
| 3. B | B1AK53 | Espin | 2.54e-03 | NA | 3.67e-11 |
| 3. B | Q495M9 | Usher syndrome type-1G protein | 9.63e-03 | NA | 3.69e-07 |
| 3. B | Q9ERC1 | Unconventional myosin-XVI | 5.91e-02 | NA | 1.18e-10 |
| 3. B | Q9P2R3 | Rabankyrin-5 | 6.46e-02 | NA | 2.46e-15 |
| 3. B | Q8BZ25 | Ankyrin repeat and protein kinase domain-containing protein 1 | 2.91e-07 | NA | 2.92e-17 |
| 3. B | Q8UVC3 | Inversin | 2.09e-03 | NA | 1.97e-16 |
| 3. B | P13508 | Protein glp-1 | 5.06e-02 | NA | 0.010 |
| 3. B | Q9SCX5 | Probable potassium channel AKT5 | 7.45e-02 | NA | 5.32e-07 |
| 3. B | Q2QLG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.01e-03 | NA | 0.006 |
| 3. B | Q05823 | 2-5A-dependent ribonuclease | 7.04e-03 | NA | 4.05e-11 |
| 3. B | P57044 | Integrin-linked protein kinase | 3.29e-03 | NA | 1.13e-08 |
| 3. B | Q8ZWC4 | Putative ankyrin repeat protein PAE1861 | 3.57e-08 | NA | 1.98e-13 |
| 3. B | Q91XL9 | Oxysterol-binding protein-related protein 1 | 1.01e-02 | NA | 1.10e-05 |
| 3. B | O54910 | NF-kappa-B inhibitor epsilon | 5.70e-05 | NA | 2.76e-04 |
| 3. B | Q75HP9 | Potassium channel AKT2 | 5.21e-02 | NA | 4.08e-07 |
| 3. B | Q4X251 | Palmitoyltransferase akr1 | 1.31e-04 | NA | 1.50e-18 |
| 3. B | Q12013 | Probable palmitoyltransferase AKR2 | 8.71e-04 | NA | 1.22e-05 |
| 3. B | Q8WMX7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.35e-04 | NA | 4.95e-05 |
| 3. B | Q08E43 | Ankyrin repeat and SOCS box protein 8 | 8.87e-04 | NA | 1.29e-14 |
| 3. B | Q5UPG6 | Putative ankyrin repeat protein L92 | NA | NA | 0.006 |
| 3. B | Q8VBX0 | Ankyrin repeat and SOCS box protein 13 | 4.90e-07 | NA | 8.77e-09 |
| 3. B | B7WN72 | Protein shank | 1.32e-02 | NA | 3.35e-09 |
| 3. B | Q9Z205 | DNA-binding protein RFXANK | 9.02e-05 | NA | 5.72e-08 |
| 3. B | Q9BXW6 | Oxysterol-binding protein-related protein 1 | 1.06e-02 | NA | 1.67e-06 |
| 3. B | Q14678 | KN motif and ankyrin repeat domain-containing protein 1 | 2.63e-01 | NA | 2.28e-05 |
| 3. B | Q00653 | Nuclear factor NF-kappa-B p100 subunit | 5.96e-02 | NA | 2.41e-06 |
| 3. B | Q6NPP4 | Calmodulin-binding transcription activator 2 | 4.28e-01 | NA | 5.88e-05 |
| 3. B | Q5ZLC8 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 9.57e-02 | NA | 1.35e-16 |
| 3. B | Q9ULT8 | E3 ubiquitin-protein ligase HECTD1 | 7.27e-01 | NA | 6.46e-06 |
| 3. B | Q68LP1 | E3 ubiquitin-protein ligase MIB2 | 7.66e-04 | NA | 4.36e-08 |
| 3. B | Q01484 | Ankyrin-2 | NA | NA | 1.45e-20 |
| 3. B | Q9UK73 | Protein fem-1 homolog B | 3.17e-04 | NA | 4.37e-06 |
| 3. B | F8W2M1 | E3 ubiquitin-protein ligase HACE1 | 3.08e-06 | NA | 4.29e-17 |
| 3. B | Q9WV71 | Ankyrin repeat and SOCS box protein 4 | 3.56e-05 | NA | 1.21e-15 |
| 3. B | Q2QLH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.07e-04 | NA | 4.46e-06 |
| 3. B | Q4R739 | Ankyrin repeat domain-containing protein 53 | 8.18e-03 | NA | 2.87e-08 |
| 3. B | Q9J513 | Putative ankyrin repeat protein FPV222 | NA | NA | 5.31e-12 |
| 3. B | Q9U518 | L-asparaginase | 7.12e-04 | NA | 8.27e-05 |
| 3. B | Q9Y283 | Inversin | 8.28e-03 | NA | 1.03e-17 |
| 3. B | Q9J512 | Putative ankyrin repeat protein FPV223 | NA | NA | 1.56e-05 |
| 3. B | Q495B1 | Ankyrin repeat and death domain-containing protein 1A | 5.16e-06 | NA | 2.08e-17 |
| 3. B | Q9M8S6 | Potassium channel SKOR | 1.25e-02 | NA | 2.66e-08 |
| 3. B | Q9ULH0 | Kinase D-interacting substrate of 220 kDa | 1.24e-02 | NA | 1.28e-18 |
| 3. B | G3I6Z6 | Neurogenic locus notch homolog protein 1 | NA | NA | 0.004 |
| 3. B | Q9BGT9 | Ankyrin repeat and SOCS box protein 7 | 4.01e-05 | NA | 2.38e-12 |
| 3. B | Q5XJ13 | Ankyrin repeat and SAM domain-containing protein 6 | 3.75e-03 | NA | 8.42e-06 |
| 3. B | P14360 | Putative ankyrin repeat protein FPV240 | NA | NA | 6.43e-14 |
| 3. B | O70445 | BRCA1-associated RING domain protein 1 | 8.18e-02 | NA | 5.04e-07 |
| 3. B | Q4UKJ3 | Putative ankyrin repeat protein RF_1087 | 2.94e-03 | NA | 1.07e-08 |
| 3. B | Q3U0L2 | Ankyrin repeat domain-containing protein 33B | 1.45e-03 | NA | 3.55e-04 |
| 3. B | Q09YK6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.22e-04 | NA | 0.006 |
| 3. B | Q86SG2 | Ankyrin repeat domain-containing protein 23 | 1.40e-04 | NA | 1.45e-13 |
| 3. B | Q5UPG5 | Putative ankyrin repeat protein L93 | NA | NA | 4.02e-13 |
| 3. B | Q9WV72 | Ankyrin repeat and SOCS box protein 3 | 2.19e-04 | NA | 7.55e-13 |
| 3. B | Q91WK7 | Ankyrin repeat domain-containing protein 54 | 3.38e-03 | NA | 5.18e-10 |
| 3. B | Q9J502 | Putative ankyrin repeat protein FPV233 | NA | NA | 1.16e-08 |
| 3. B | Q876L4 | Probable palmitoyltransferase AKR2 | 3.24e-04 | NA | 3.51e-07 |
| 3. B | Q5U2S6 | Ankyrin repeat and SOCS box protein 2 | 3.87e-03 | NA | 2.54e-10 |
| 3. B | Q5UPH4 | Putative ankyrin repeat protein R96 | NA | NA | 0.011 |
| 3. B | Q80SY4 | E3 ubiquitin-protein ligase MIB1 | 7.08e-04 | NA | 4.93e-12 |
| 3. B | Q876L5 | Palmitoyltransferase AKR1 | 4.64e-04 | NA | 4.70e-07 |
| 3. B | Q4I8B6 | Palmitoyltransferase AKR1 | 3.34e-04 | NA | 7.87e-14 |
| 3. B | P16157 | Ankyrin-1 | 1.04e-01 | NA | 5.45e-20 |
| 3. B | O88202 | 60 kDa lysophospholipase | 4.37e-03 | NA | 0.004 |
| 3. B | Q502M6 | Ankyrin repeat domain-containing protein 29 | 1.18e-08 | NA | 5.28e-16 |
| 3. B | A4II29 | Notch-regulated ankyrin repeat-containing protein | 5.59e-03 | NA | 0.015 |
| 3. B | Q337A0 | Probable E3 ubiquitin-protein ligase XBOS33 | 7.98e-03 | NA | 2.24e-05 |
| 3. B | Q6S8J3 | POTE ankyrin domain family member E | 3.30e-04 | NA | 2.81e-13 |
| 3. B | Q96I34 | Protein phosphatase 1 regulatory subunit 16A | 1.61e-04 | NA | 3.23e-07 |
| 3. B | Q0VGY8 | Protein TANC1 | 1.65e-02 | NA | 2.44e-15 |
| 3. B | P0C0T2 | Ankyrin repeat and SAM domain-containing protein 6 | 3.36e-03 | NA | 3.34e-07 |
| 3. B | O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | 3.82e-02 | NA | 1.61e-14 |
| 3. B | Q9P2G1 | Ankyrin repeat and IBR domain-containing protein 1 | 3.65e-04 | NA | 0.017 |
| 3. B | G0LXV8 | Alpha-latrotoxin-Lh1a (Fragment) | 2.04e-02 | NA | 8.34e-19 |
| 3. B | Q8WWX0 | Ankyrin repeat and SOCS box protein 5 | 1.32e-04 | NA | 7.85e-09 |
| 3. B | Q15027 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 8.41e-04 | NA | 5.36e-06 |
| 3. B | Q9Y566 | SH3 and multiple ankyrin repeat domains protein 1 | 1.42e-01 | NA | 7.13e-11 |
| 3. B | Q653P0 | Potassium channel KOR1 | 7.37e-02 | NA | 9.55e-09 |
| 3. B | Q6PFX9 | Poly [ADP-ribose] polymerase tankyrase-1 | 6.33e-02 | NA | 1.49e-14 |
| 3. B | Q9J5I3 | Putative ankyrin repeat protein FPV018 | NA | NA | 1.52e-11 |
| 3. B | Q2IBG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.99e-03 | NA | 3.19e-05 |
| 3. B | Q94B55 | Putative E3 ubiquitin-protein ligase XBAT31 | 8.20e-05 | NA | 3.98e-07 |
| 3. B | Q6P1S6 | Myotrophin | 1.15e-06 | NA | 1.84e-05 |
| 3. B | C7B178 | Protein VAPYRIN | 1.38e-03 | NA | 1.48e-16 |
| 3. B | Q9D1A4 | Ankyrin repeat and SOCS box protein 5 | 3.51e-04 | NA | 6.62e-09 |
| 3. B | Q5R4M7 | Ankyrin repeat and SOCS box protein 6 | 7.89e-04 | NA | 8.06e-05 |
| 3. B | Q875M2 | Palmitoyltransferase AKR1 | 1.64e-05 | NA | 4.06e-04 |
| 3. B | Q29Q26 | Ankyrin repeat domain-containing protein 2B | 6.85e-03 | NA | 1.52e-10 |
| 3. B | Q71S21 | Inversin-B | 3.88e-05 | NA | 6.19e-18 |
| 3. B | Q8VHK2 | Caskin-1 | 1.10e-03 | NA | 2.67e-13 |
| 3. B | Q7Z020 | Transient receptor potential cation channel subfamily A member 1 | 2.38e-03 | NA | 1.46e-09 |
| 3. B | Q5JPF3 | Ankyrin repeat domain-containing protein 36C | 7.75e-02 | NA | 9.25e-13 |
| 3. B | Q4P6L3 | Palmitoyltransferase AKR1 | 2.30e-04 | NA | 1.69e-11 |
| 3. B | Q3V096 | Ankyrin repeat domain-containing protein 42 | 2.63e-05 | NA | 5.29e-14 |
| 3. B | Q6DGX3 | Ankyrin repeat domain-containing protein 54 | 4.86e-03 | NA | 8.02e-09 |
| 3. B | Q9R172 | Neurogenic locus notch homolog protein 3 | 4.12e-01 | NA | 3.84e-04 |
| 3. B | O13987 | Ankyrin and IPT/TIG repeat-containing protein C26H5.05 | 4.43e-01 | NA | 8.03e-04 |
| 3. B | Q96AX9 | E3 ubiquitin-protein ligase MIB2 | 1.56e-03 | NA | 1.31e-10 |
| 3. B | Q8R3P9 | SMC5-SMC6 complex localization factor protein 1 | 3.14e-01 | NA | 0.006 |
| 3. B | A0A3L7I2I8 | 85/88 kDa calcium-independent phospholipase A2 | 3.18e-03 | NA | 1.03e-07 |
| 3. B | Q5RFS1 | Ankyrin repeat and SOCS box protein 11 | 2.61e-04 | NA | 2.06e-04 |
| 3. B | Q5DU14 | Unconventional myosin-XVI | 3.38e-02 | NA | 1.80e-11 |
| 3. B | Q5UPH0 | Putative ankyrin repeat protein L100 | NA | NA | 0.041 |
| 3. B | Q86YR6 | POTE ankyrin domain family member D | 8.14e-04 | NA | 2.79e-15 |
| 3. B | Q6NRS1 | Inhibitor of Bruton tyrosine kinase | 5.89e-01 | NA | 0.029 |
| 3. B | Q923M0 | Protein phosphatase 1 regulatory subunit 16A | 1.84e-03 | NA | 1.37e-07 |
| 3. B | Q6F3J0 | Nuclear factor NF-kappa-B p105 subunit | 5.51e-03 | NA | 4.14e-09 |
| 3. B | Q5UQY4 | Putative ankyrin repeat protein R886 (Fragment) | NA | NA | 4.79e-04 |
| 3. B | Q8N9B4 | Ankyrin repeat domain-containing protein 42 | 9.54e-05 | NA | 2.29e-10 |
| 3. B | O77617 | Cyclin-dependent kinase inhibitor 2A | 1.24e-03 | NA | 5.21e-07 |
| 3. B | G5EDE9 | ANK repeat-containing protein nipk-1 | 3.53e-04 | NA | 8.54e-04 |
| 3. B | O00522 | Krev interaction trapped protein 1 | 7.16e-02 | NA | 8.70e-06 |
| 3. B | Q07E28 | Cortactin-binding protein 2 | 9.38e-02 | NA | 4.59e-12 |
| 3. B | Q5H9F3 | BCL-6 corepressor-like protein 1 | 7.66e-01 | NA | 8.66e-04 |
| 3. B | Q8WXK3 | Ankyrin repeat and SOCS box protein 13 | 1.97e-07 | NA | 2.58e-08 |
| 3. B | Q96P64 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 4 | 3.97e-01 | NA | 0.009 |
| 3. B | Q55A55 | Probable serine/threonine-protein kinase DDB_G0272092 | 4.84e-03 | NA | 0.004 |
| 3. B | Q5GIG6 | Serine/threonine-protein kinase TNNI3K | 9.37e-03 | NA | 3.55e-19 |
| 3. B | Q3UUF8 | Ankyrin repeat domain-containing protein 34B | 5.70e-02 | NA | 7.97e-09 |
| 3. B | Q09YI3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 8.92e-05 | NA | 1.28e-06 |
| 3. B | A0M8T5 | Cortactin-binding protein 2 | 3.95e-02 | NA | 8.60e-12 |
| 3. B | Q9J5I9 | Putative ankyrin repeat protein FPV012 | NA | NA | 1.24e-08 |
| 3. B | Q2KI79 | Ankyrin repeat family A protein 2 | 4.34e-04 | NA | 3.34e-08 |
| 3. B | Q5ZM55 | Protein fem-1 homolog B | 3.16e-04 | NA | 9.53e-07 |
| 3. B | Q07E15 | Cortactin-binding protein 2 | 6.00e-02 | NA | 1.44e-10 |
| 3. B | Q6UB98 | Ankyrin repeat domain-containing protein 12 | 6.43e-01 | NA | 3.73e-06 |
| 3. B | A6QPE7 | Ankyrin repeat domain-containing protein 65 | 5.87e-11 | NA | 4.54e-17 |
| 3. B | Q9XZC0 | Alpha-latrocrustotoxin-Lt1a (Fragment) | 4.01e-02 | NA | 2.52e-16 |
| 3. B | P55272 | Cyclin-dependent kinase 4 inhibitor B | 4.71e-05 | NA | 6.33e-05 |
| 3. B | Q94A76 | Potassium channel GORK | 3.77e-03 | NA | 1.04e-08 |
| 3. B | Q9V7A7 | G patch domain and ankyrin repeat-containing protein 1 homolog | 1.60e-01 | NA | 0.005 |
| 3. B | Q80UP5 | Ankyrin repeat domain-containing protein 13A | 1.21e-01 | NA | 0.002 |
| 3. B | Q8Q0U0 | Putative ankyrin repeat protein MM_0045 | 2.80e-06 | NA | 1.75e-15 |
| 3. B | Q8N961 | Ankyrin repeat and BTB/POZ domain-containing protein 2 | 2.86e-02 | NA | 0.003 |
| 3. B | Q54KH3 | Ankyrin repeat domain-containing protein 39 homolog | 1.88e-04 | NA | 3.73e-09 |
| 3. B | Q7EZ44 | Probable E3 ubiquitin-protein ligase XBOS35 | 1.25e-03 | NA | 1.32e-08 |
| 3. B | O35516 | Neurogenic locus notch homolog protein 2 | 8.80e-02 | NA | 3.82e-05 |
| 3. B | A6NCL7 | Ankyrin repeat domain-containing protein 33B | 8.08e-03 | NA | 0.002 |
| 3. B | Q5VYY1 | Ankyrin repeat domain-containing protein 22 | 1.85e-07 | NA | 0.027 |
| 3. B | Q755Y0 | Palmitoyltransferase AKR1 | 1.76e-05 | NA | 3.19e-11 |
| 3. B | Q7XI08 | Probable E3 ubiquitin-protein ligase XBOS34 | 8.48e-02 | NA | 0.004 |
| 3. B | Q6XJU9 | Osteoclast-stimulating factor 1 | 1.68e-04 | NA | 0.039 |
| 3. B | Q3UHD9 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 | 7.07e-01 | NA | 0.040 |
| 3. B | Q9XX14 | Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 | 5.71e-01 | NA | 0.003 |
| 3. B | Q03017 | NF-kappa-B inhibitor cactus | 5.09e-04 | NA | 4.02e-08 |
| 3. B | Q91WD2 | Transient receptor potential cation channel subfamily V member 6 | 7.30e-04 | NA | 0.002 |
| 3. B | B8N0E6 | Ankyrin-repeat domain containing transcription coregulator asaA | 1.84e-02 | NA | 9.21e-06 |
| 3. B | O75762 | Transient receptor potential cation channel subfamily A member 1 | 8.78e-04 | NA | 1.71e-16 |
| 3. B | Q6P686 | Osteoclast-stimulating factor 1 | 2.43e-04 | NA | 0.021 |
| 3. B | Q8VD46 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.09e-04 | NA | 1.07e-04 |
| 3. B | Q9CQM6 | Ankyrin repeat domain-containing protein 61 | 2.64e-04 | NA | 9.11e-11 |
| 3. B | Q5UPA0 | Putative ankyrin repeat protein L25 | NA | NA | 2.16e-08 |
| 3. B | Q6NY19 | KN motif and ankyrin repeat domain-containing protein 3 | 2.45e-01 | NA | 2.87e-06 |
| 3. B | P19838 | Nuclear factor NF-kappa-B p105 subunit | 4.80e-02 | NA | 4.08e-10 |
| 3. B | A0M8S4 | Cortactin-binding protein 2 | 1.17e-01 | NA | 4.46e-09 |
| 3. B | Q9Z1E3 | NF-kappa-B inhibitor alpha | 1.95e-04 | NA | 3.27e-15 |
| 3. B | Q24145 | Tyrosine-protein kinase Shark | 1.41e-01 | NA | 1.82e-05 |
| 3. B | A6NIR3 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 5 | 6.09e-01 | NA | 0.008 |
| 3. B | Q7Z713 | Ankyrin repeat domain-containing protein 37 | 1.36e-02 | NA | 0.006 |
| 3. B | Q9TU71 | Ankyrin repeat domain-containing protein 1 | 5.08e-05 | NA | 2.42e-07 |
| 3. B | Q28FJ2 | Ankyrin repeat domain-containing protein 37 | 1.42e-02 | NA | 0.015 |
| 3. B | Q18297 | Transient receptor potential cation channel subfamily A member 1 homolog | 3.86e-03 | NA | 2.58e-10 |
| 3. B | E9Q4F7 | Ankyrin repeat domain-containing protein 11 | 7.28e-01 | NA | 2.37e-05 |
| 3. B | Q8WWH4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.39e-05 | NA | 2.30e-05 |
| 3. B | Q1RJN6 | Putative ankyrin repeat protein RBE_0347 | 8.02e-03 | NA | 0.001 |
| 3. B | A6QR20 | SMC5-SMC6 complex localization factor protein 1 | 2.29e-01 | NA | 0.001 |
| 3. B | P98150 | Nuclear factor NF-kappa-B p100 subunit | 1.06e-02 | NA | 2.88e-08 |
| 3. B | Q9XSM3 | Transient receptor potential cation channel subfamily V member 5 | 8.09e-03 | NA | 0.016 |
| 3. B | Q5UQZ7 | Putative ankyrin repeat protein R901 | NA | NA | 0.014 |
| 3. B | Q5RF15 | Serine/threonine-protein kinase TNNI3K | 3.90e-04 | NA | 1.89e-17 |
| 3. B | O50999 | Putative ankyrin repeat protein BB_B28 | 1.81e-01 | NA | 0.018 |
| 3. B | Q9VFD5 | Protein fem-1 homolog CG6966 | 4.97e-05 | NA | 9.14e-11 |
| 3. B | Q6P9K8 | Caskin-1 | 3.11e-02 | NA | 5.22e-13 |
| 3. B | Q7ZUV0 | Ankyrin repeat domain-containing protein 13C | 2.45e-01 | NA | 7.33e-04 |
| 3. B | Q2KJD8 | Cyclin-dependent kinase 4 inhibitor B | 1.77e-05 | NA | 0.005 |
| 3. B | Q9BZL4 | Protein phosphatase 1 regulatory subunit 12C | 2.98e-03 | NA | 1.28e-10 |
| 3. B | Q2T9W8 | Ankyrin repeat domain-containing protein 61 | 1.30e-04 | NA | 3.41e-09 |
| 3. B | Q2IBA2 | Cortactin-binding protein 2 | 8.39e-02 | NA | 4.97e-09 |
| 3. B | Q812A3 | Ankyrin repeat domain-containing protein 23 | 1.60e-04 | NA | 1.53e-12 |
| 3. B | Q3SWY2 | Integrin-linked protein kinase | 2.17e-02 | NA | 1.17e-08 |
| 3. B | Q876A6 | Palmitoyltransferase AKR1 | 9.03e-04 | NA | 5.22e-09 |
| 3. B | Q96KQ7 | Histone-lysine N-methyltransferase EHMT2 | 1.64e-02 | NA | 4.54e-14 |
| 3. B | Q9HFE7 | Ankyrin repeat-containing protein P16F5.05c | 1.01e-05 | NA | 0.002 |
| 3. B | P25799 | Nuclear factor NF-kappa-B p105 subunit | 6.56e-03 | NA | 6.50e-08 |
| 3. B | Q92882 | Osteoclast-stimulating factor 1 | 1.33e-03 | NA | 0.016 |
| 3. B | Q99LW0 | Ankyrin repeat domain-containing protein 10 | 5.74e-03 | NA | 5.73e-08 |
| 3. B | Q6GNY1 | E3 ubiquitin-protein ligase mib1 | 3.77e-03 | NA | 1.30e-12 |
| 3. B | Q91ZU0 | Ankyrin repeat and SOCS box protein 7 | 3.80e-05 | NA | 2.75e-12 |
| 3. B | Q91ZT8 | Ankyrin repeat and SOCS box protein 9 | 3.66e-07 | NA | 1.22e-13 |
| 3. B | Q9JLU4 | SH3 and multiple ankyrin repeat domains protein 3 | 1.47e-01 | NA | 1.86e-10 |
| 3. B | Q5UPV1 | Putative ankyrin repeat protein L271 | NA | NA | 4.27e-06 |
| 3. B | Q8NI38 | NF-kappa-B inhibitor delta | 2.82e-04 | NA | 0.003 |
| 3. B | Q5UPU4 | Putative ankyrin repeat protein R267 | NA | NA | 0.004 |
| 3. B | Q9J5H7 | Putative ankyrin repeat protein FPV024 | NA | NA | 4.56e-08 |
| 3. B | Q09701 | Palmitoyltransferase akr1 | 1.51e-04 | NA | 6.54e-11 |
| 3. B | Q8WXI3 | Ankyrin repeat and SOCS box protein 10 | 1.87e-04 | NA | 3.78e-13 |
| 3. B | Q01705 | Neurogenic locus notch homolog protein 1 | 1.07e-01 | NA | 0.005 |
| 3. B | Q9Z2G1 | Protein fem-1 homolog A-A | 2.31e-03 | NA | 2.04e-08 |
| 3. B | P0C550 | Potassium channel AKT1 | 2.55e-02 | NA | 2.54e-12 |
| 3. B | X1WE18 | KN motif and ankyrin repeat domain-containing protein 2 | 2.85e-01 | NA | 1.12e-07 |
| 3. B | G5EGA3 | Ankyrin repeat and LEM domain-containing protein 1 homolog | 2.98e-02 | NA | 0.001 |
| 3. B | Q8TF27 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11 | 5.24e-01 | NA | 0.004 |
| 3. B | Q13625 | Apoptosis-stimulating of p53 protein 2 | 1.12e-01 | NA | 0.004 |
| 3. B | Q5VUJ5 | Putative Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 7 | 5.78e-01 | NA | 0.006 |
| 3. B | Q8WXK1 | Ankyrin repeat and SOCS box protein 15 | 3.95e-03 | NA | 3.06e-12 |
| 3. B | Q2IBF8 | Cortactin-binding protein 2 | 3.84e-02 | NA | 1.87e-11 |
| 3. B | Q2T9K6 | Protein fem-1 homolog C | 4.00e-03 | NA | 1.62e-11 |
| 3. B | Q9ULJ7 | Ankyrin repeat domain-containing protein 50 | 8.40e-03 | NA | 5.70e-21 |
| 3. B | P0C927 | Ankyrin repeat and SOCS box protein 14 | 4.74e-03 | NA | 8.18e-18 |
| 3. B | Q07DX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.16e-04 | NA | 1.42e-05 |
| 3. B | Q9Y6X6 | Unconventional myosin-XVI | 3.23e-02 | NA | 1.45e-11 |
| 3. B | Q9ZCL3 | Putative ankyrin repeat protein RP714 | 2.35e-04 | NA | 2.41e-09 |
| 3. B | A5PK26 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 8.94e-04 | NA | 3.34e-06 |
| 3. B | Q8K2H4 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 9.64e-04 | NA | 9.98e-05 |
| 3. B | P46531 | Neurogenic locus notch homolog protein 1 | 4.93e-02 | NA | 0.006 |
| 3. B | Q2IBE6 | Cortactin-binding protein 2 | 9.48e-03 | NA | 2.08e-09 |
| 3. B | Q3ZBX7 | Ankyrin repeat domain-containing protein 1 | 9.16e-05 | NA | 2.29e-07 |
| 3. B | Q4V869 | Acyl-CoA-binding domain-containing protein 6 | 4.70e-03 | NA | 3.83e-08 |
| 3. B | Q09YG9 | Cortactin-binding protein 2 | 7.59e-02 | NA | 7.40e-10 |
| 3. B | Q8HXA6 | Ankyrin repeat and SOCS box protein 15 | 1.61e-03 | NA | 3.80e-12 |
| 3. B | Q0P5G1 | Tonsoku-like protein | 5.47e-02 | NA | 5.02e-04 |
| 3. B | Q91ZU1 | Ankyrin repeat and SOCS box protein 6 | 9.58e-04 | NA | 1.25e-04 |
| 3. B | Q96NS5 | Ankyrin repeat and SOCS box protein 16 | 8.32e-05 | NA | 1.16e-15 |
| 3. B | Q52T38 | Protein S-acyltransferase 24 | 1.61e-05 | NA | 1.07e-12 |
| 3. B | Q96JP0 | Protein fem-1 homolog C | 3.33e-03 | NA | 3.59e-10 |
| 3. B | Q1RJ94 | Putative ankyrin repeat protein RBE_0489 | 1.56e-02 | NA | 1.01e-04 |
| 3. B | Q5U464 | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 | 3.46e-03 | NA | 0.035 |
| 3. B | F1N6G5 | E3 ubiquitin-protein ligase HACE1 | 1.47e-03 | NA | 1.95e-17 |
| 3. B | Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 | 4.62e-06 | NA | 9.08e-19 |
| 3. B | Q9DF58 | Integrin-linked protein kinase | 2.85e-02 | NA | 5.26e-08 |
| 3. B | Q865U8 | Ankyrin repeat domain-containing protein 1 | 1.05e-04 | NA | 1.41e-05 |
| 3. B | Q3SZE4 | Ankyrin repeat and SOCS box protein 11 | 2.84e-04 | NA | 1.70e-05 |
| 3. B | Q6NZL6 | Tonsoku-like protein | 1.36e-01 | NA | 1.12e-04 |
| 3. B | Q1LZH7 | KN motif and ankyrin repeat domain-containing protein 2 | 4.35e-03 | NA | 5.71e-08 |
| 3. B | Q569N2 | Ankyrin repeat domain-containing protein 37 | 1.77e-02 | NA | 0.013 |
| 3. B | P17442 | Phosphate system positive regulatory protein PHO81 | 4.95e-02 | NA | 1.06e-08 |
| 3. B | Q8WVL7 | Ankyrin repeat domain-containing protein 49 | 2.06e-04 | NA | 1.48e-05 |
| 3. B | Q3UX43 | Ankyrin repeat domain-containing protein 13C | 1.50e-01 | NA | 0.006 |
| 3. B | A2VDR2 | Acyl-CoA-binding domain-containing protein 6 | 5.02e-03 | NA | 8.55e-07 |
| 3. B | Q95RG8 | ARF GTPase-activating protein Git | 8.22e-03 | NA | 0.016 |
| 3. B | Q00PJ1 | Cortactin-binding protein 2 | 6.28e-03 | NA | 2.42e-08 |
| 3. B | Q54BA2 | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 | 1.22e-02 | NA | 3.34e-09 |
| 3. B | Q9VCA8 | Ankyrin repeat and KH domain-containing protein mask | NA | NA | 8.40e-15 |
| 3. B | Q04861 | Nuclear factor NF-kappa-B p105 subunit | 7.02e-03 | NA | 1.99e-10 |
| 3. B | A2ARS0 | Ankyrin repeat domain-containing protein 63 | 3.04e-03 | NA | 4.39e-07 |
| 3. B | F1MJR8 | Inactive serine/threonine-protein kinase TEX14 | 3.02e-01 | NA | 7.20e-06 |
| 3. B | Q25338 | Delta-latroinsectotoxin-Lt1a | 3.59e-02 | NA | 6.38e-12 |
| 3. B | Q15327 | Ankyrin repeat domain-containing protein 1 | 8.59e-05 | NA | 1.58e-05 |
| 3. B | Q5EA33 | Ankyrin repeat domain-containing protein 49 | 4.58e-03 | NA | 1.08e-05 |
| 3. B | Q9BXX3 | Ankyrin repeat domain-containing protein 30A | 1.01e-02 | NA | 3.53e-17 |
| 3. B | Q86YT6 | E3 ubiquitin-protein ligase MIB1 | 1.16e-03 | NA | 6.53e-12 |
| 3. B | Q94CT7 | Probable E3 ubiquitin-protein ligase XBOS31 | 3.90e-04 | NA | 2.21e-06 |
| 3. B | Q9TZC4 | Integrin-linked protein kinase homolog pat-4 | 5.73e-03 | NA | 1.17e-09 |
| 3. B | O89019 | Inversin | 2.82e-03 | NA | 5.84e-17 |
| 3. B | Q66JD7 | Acyl-CoA-binding domain-containing protein 6 | 1.53e-02 | NA | 3.83e-08 |
| 3. B | Q53RE8 | Ankyrin repeat domain-containing protein 39 | 4.88e-06 | NA | 2.93e-09 |
| 3. B | Q54HW1 | 26S proteasome non-ATPase regulatory subunit 10 | 6.46e-13 | NA | 1.53e-18 |
| 3. B | Q8WMX8 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.45e-04 | NA | 1.77e-06 |
| 3. B | Q07DZ7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.93e-05 | NA | 0.009 |
| 3. B | Q0JKV1 | Potassium channel AKT1 | 4.13e-02 | NA | 2.58e-12 |
| 3. B | Q09YH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.89e-04 | NA | 0.005 |
| 3. B | Q60773 | Cyclin-dependent kinase 4 inhibitor D | 1.76e-07 | NA | 3.57e-06 |
| 3. B | Q2IBB2 | Cortactin-binding protein 2 | 3.40e-02 | NA | 2.75e-11 |
| 3. B | Q5UPG7 | Putative ankyrin repeat protein L91 | NA | NA | 2.77e-04 |
| 3. B | Q9EQG6 | Kinase D-interacting substrate of 220 kDa | 1.53e-02 | NA | 1.18e-18 |
| 3. B | Q5ZLC6 | Ankyrin repeat domain-containing protein 10 | 3.74e-02 | NA | 5.32e-09 |
| 3. B | Q6ZPS6 | Ankyrin repeat and IBR domain-containing protein 1 | 2.10e-02 | NA | 0.018 |
| 3. B | P14368 | Putative ankyrin repeat protein FPV234 | NA | NA | 1.97e-07 |
| 3. B | Q4KL97 | Ankyrin repeat domain-containing protein 1 | 4.36e-05 | NA | 4.00e-06 |
| 3. B | Q91955 | Myotrophin | 1.75e-06 | NA | 3.16e-05 |
| 3. B | P58546 | Myotrophin | 1.17e-06 | NA | 4.79e-05 |
| 3. B | Q2QLG9 | Cortactin-binding protein 2 | 4.98e-02 | NA | 4.96e-11 |
| 3. B | Q4R544 | Ankyrin repeat and SOCS box protein 8 | 1.86e-05 | NA | 5.24e-14 |
| 3. B | Q9J4Z6 | Putative ankyrin repeat protein FPV244 | NA | NA | 1.31e-13 |
| 3. B | Q9J5A7 | Putative ankyrin repeat protein FPV115 | NA | NA | 4.50e-06 |
| 3. B | Q5I1X5 | RelA-associated inhibitor | 7.09e-01 | NA | 6.64e-05 |
| 3. B | B2RU33 | POTE ankyrin domain family member C | 2.45e-05 | NA | 3.55e-14 |
| 3. B | Q5ZJJ9 | Osteoclast-stimulating factor 1 | 5.59e-04 | NA | 0.001 |
| 3. B | Q60772 | Cyclin-dependent kinase 4 inhibitor C | 2.43e-08 | NA | 1.92e-07 |
| 3. B | Q9UVH3 | Palmitoyltransferase AKR1 (Fragment) | 1.09e-02 | NA | 1.34e-06 |
| 3. B | Q07E17 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.59e-03 | NA | 7.96e-05 |
| 3. B | Q6NSI1 | Putative ankyrin repeat domain-containing protein 26-like protein | 5.86e-03 | NA | 4.87e-12 |
| 3. B | P0CG38 | POTE ankyrin domain family member I | 2.31e-03 | NA | 2.61e-12 |
| 3. B | A0JP26 | POTE ankyrin domain family member B3 | 1.33e-05 | NA | 6.45e-14 |
| 3. B | Q5UQF0 | Putative ankyrin repeat protein L484 | NA | NA | 0.023 |
| 3. B | Q5UPA2 | Putative ankyrin repeat protein L23 | NA | NA | 5.08e-05 |
| 3. B | O74205 | Transcription factor TOXE | 4.28e-03 | NA | 0.002 |
| 3. B | Q09YJ5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.22e-03 | NA | 9.98e-08 |
| 3. B | Q8WMX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.14e-04 | NA | 2.71e-05 |
| 3. B | Q6S5H5 | POTE ankyrin domain family member G | 5.24e-06 | NA | 6.47e-13 |
| 3. B | P77736 | Putative ankyrin repeat protein YahD | 1.44e-08 | NA | 6.34e-08 |
| 3. B | Q5F478 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 4.39e-02 | NA | 1.59e-21 |
| 3. B | Q8K3X6 | Ankyrin repeat and SAM domain-containing protein 4B | 1.69e-02 | NA | 3.39e-07 |
| 3. B | Q62422 | Osteoclast-stimulating factor 1 | 2.00e-04 | NA | 0.019 |
| 3. B | Q9J507 | Putative ankyrin repeat protein FPV228 | NA | NA | 4.26e-12 |
| 3. B | Q7TQP6 | Serine/threonine-protein kinase TNNI3K | 1.38e-02 | NA | 2.76e-18 |
| 3. B | P0CS67 | Palmitoyltransferase AKR1 | 9.80e-04 | NA | 1.01e-09 |
| 3. B | Q9Z2G0 | Protein fem-1 homolog B | 3.22e-04 | NA | 4.26e-06 |
| 3. B | Q9XXH8 | Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 | 5.10e-03 | NA | 6.16e-05 |
| 3. B | B4E2M5 | Ankyrin repeat domain-containing protein 66 | 3.28e-02 | NA | 0.001 |
| 3. B | P14356 | Ankyrin repeat protein M1 | NA | NA | 2.99e-05 |
| 3. B | G5E8K5 | Ankyrin-3 | 9.35e-02 | NA | 1.77e-20 |
| 3. B | Q8K0L0 | Ankyrin repeat and SOCS box protein 2 | 6.69e-04 | NA | 1.52e-08 |
| 3. B | A0PJZ0 | Putative ankyrin repeat domain-containing protein 20A5 | 4.37e-04 | NA | 4.78e-09 |
| 3. B | V6CLA2 | E3 ubiquitin-protein ligase hecd-1 | 1.15e-01 | NA | 0.001 |
| 3. B | Q5VW22 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 | 4.88e-01 | NA | 0.023 |
| 3. B | Q3TYA6 | M-phase phosphoprotein 8 | 5.91e-03 | NA | 4.67e-09 |
| 3. B | A0A0A6YYL3 | POTE ankyrin domain family member B | 5.02e-04 | NA | 1.88e-14 |
| 3. B | A0A0R4IQZ2 | Putative palmitoyltransferase ZDHHC13 | 6.23e-04 | NA | 2.77e-07 |
| 3. B | Q96HA7 | Tonsoku-like protein | 3.09e-02 | NA | 3.96e-05 |
| 3. B | Q9H765 | Ankyrin repeat and SOCS box protein 8 | 5.19e-04 | NA | 1.78e-14 |
| 3. B | Q3KP44 | Ankyrin repeat domain-containing protein 55 | 7.64e-04 | NA | 2.05e-16 |
| 3. B | Q99549 | M-phase phosphoprotein 8 | 6.22e-03 | NA | 1.53e-08 |
| 3. B | Q9R0Z3 | Cyclin-dependent kinase inhibitor 2A | 7.43e-04 | NA | 0.013 |
| 3. B | Q8NAG6 | Ankyrin repeat and LEM domain-containing protein 1 | 6.05e-02 | NA | 0.001 |
| 3. B | Q1RJR6 | Putative ankyrin repeat protein RBE_0317 | 3.71e-04 | NA | 1.08e-04 |
| 3. B | Q63746 | NF-kappa-B inhibitor alpha | 1.88e-04 | NA | 1.32e-14 |
| 3. B | Q9R186 | Transient receptor potential cation channel subfamily V member 6 | 7.18e-04 | NA | 0.001 |
| 3. B | P07207 | Neurogenic locus Notch protein | NA | NA | 2.83e-06 |
| 3. B | Q07DV1 | Cortactin-binding protein 2 | 8.94e-02 | NA | 3.36e-09 |
| 3. B | Q9W0T5 | Transient receptor potential channel pyrexia | 3.67e-04 | NA | 1.75e-15 |
| 3. B | Q9CWU2 | Palmitoyltransferase ZDHHC13 | 1.19e-04 | NA | 1.09e-10 |
| 3. B | Q9NWX5 | Ankyrin repeat and SOCS box protein 6 | 9.81e-04 | NA | 6.71e-05 |
| 3. B | Q9FNP4 | Phytochrome-interacting ankyrin-repeat protein 2 | 6.82e-04 | NA | 2.79e-06 |
| 3. B | Q5W7F2 | ADP-ribosylation factor GTPase-activating protein AGD3 | 8.63e-03 | NA | 0.013 |
| 3. B | Q9STP8 | Acyl-CoA-binding domain-containing protein 2 | 1.65e-03 | NA | 5.22e-06 |
| 3. B | Q04749 | Target of rapamycin complex 2 subunit AVO2 | 2.63e-03 | NA | 3.86e-04 |
| 3. B | A6NGH8 | Ankyrin repeat domain-containing protein 61 | 4.00e-04 | NA | 2.14e-13 |
| 3. B | P51480 | Cyclin-dependent kinase inhibitor 2A | 2.27e-03 | NA | 0.049 |
| 3. B | Q63ZY3 | KN motif and ankyrin repeat domain-containing protein 2 | 1.55e-01 | NA | 2.36e-07 |
| 3. B | Q07DX4 | Cortactin-binding protein 2 | 1.13e-01 | NA | 1.93e-09 |
| 3. B | Q9CR42 | Ankyrin repeat domain-containing protein 1 | 8.04e-06 | NA | 8.41e-08 |
| 3. B | Q8BTZ5 | Ankyrin repeat domain-containing protein 46 | 4.38e-03 | NA | 2.77e-04 |
| 3. B | A6NK59 | Ankyrin repeat and SOCS box protein 14 | 8.79e-03 | NA | 4.13e-14 |
| 3. B | Q8BLA8 | Transient receptor potential cation channel subfamily A member 1 | 1.37e-04 | NA | 3.25e-14 |
| 3. B | Q8H569 | Potassium channel AKT3 | 2.87e-02 | NA | 1.84e-11 |
| 3. B | A8VU90 | Ankyrin repeat and LEM domain-containing protein 1 | 3.81e-02 | NA | 0.003 |
| 3. B | O73630 | Nuclear factor NF-kappa-B p100 subunit | 6.38e-03 | NA | 7.36e-06 |
| 3. B | A6NI47 | Putative POTE ankyrin domain family member M | 1.06e-05 | NA | 1.42e-12 |
| 3. B | Q5UQV3 | Putative ankyrin repeat protein L371 | NA | NA | 1.45e-10 |
| 3. B | Q6C520 | Palmitoyltransferase AKR1 | 1.40e-04 | NA | 6.82e-10 |
| 3. B | Q2QLA2 | Cortactin-binding protein 2 | 6.17e-02 | NA | 8.26e-11 |
| 3. B | Q74ZH9 | Glycerophosphocholine phosphodiesterase GDE1 | 1.04e-01 | NA | 0.002 |
| 3. B | Q9D2X0 | Ankyrin repeat domain-containing protein 39 | 2.31e-05 | NA | 7.79e-10 |
| 3. B | O75179 | Ankyrin repeat domain-containing protein 17 | 4.79e-02 | NA | 4.51e-14 |
| 3. B | Q86AT8 | Stress-activated protein kinase alpha | 2.84e-03 | NA | 8.24e-08 |
| 3. B | Q9HYV6 | Putative ankyrin repeat protein PA3287 | 1.10e-07 | NA | 4.72e-10 |
| 3. B | Q5ZMD2 | Ankyrin repeat and MYND domain-containing protein 2 | 3.96e-02 | NA | 2.51e-07 |
| 3. B | Q09YM8 | Cortactin-binding protein 2 | 1.69e-02 | NA | 1.18e-08 |
| 3. B | Q9WTK5 | Nuclear factor NF-kappa-B p100 subunit | 4.98e-03 | NA | 6.24e-07 |
| 3. B | Q6GPE5 | Protein fem-1 homolog B | 2.48e-04 | NA | 4.90e-07 |
| 3. B | Q8WXE0 | Caskin-2 | 2.09e-02 | NA | 9.17e-14 |
| 3. B | Q69ZR2 | E3 ubiquitin-protein ligase HECTD1 | 6.52e-01 | NA | 5.89e-06 |
| 3. B | Q8BXK8 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 | 8.19e-01 | NA | 0.003 |
| 3. B | Q4R690 | Palmitoyltransferase ZDHHC13 | 1.51e-06 | NA | 1.08e-08 |
| 3. B | Q07E30 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.37e-05 | NA | 2.20e-05 |
| 3. B | P55271 | Cyclin-dependent kinase 4 inhibitor B | 6.91e-05 | NA | 1.41e-04 |
| 3. B | Q5DW34 | Histone-lysine N-methyltransferase EHMT1 | 2.76e-03 | NA | 1.54e-14 |
| 3. B | Q86YJ7 | Ankyrin repeat domain-containing protein 13B | 1.51e-01 | NA | 2.67e-04 |
| 3. B | Q80YE7 | Death-associated protein kinase 1 | 3.44e-02 | NA | 6.42e-18 |
| 3. B | E9PTT0 | Palmitoyltransferase ZDHHC17 | 1.52e-06 | NA | 8.98e-10 |
| 3. B | P0DJE3 | Alpha-latrotoxin-Lhe1a | 2.62e-02 | NA | 1.56e-16 |
| 3. B | Q5F259 | Ankyrin repeat domain-containing protein 13B | 6.25e-02 | NA | 2.39e-04 |
| 3. B | Q7Z6K4 | Notch-regulated ankyrin repeat-containing protein | 3.78e-02 | NA | 0.009 |
| 3. B | Q978J0 | Putative ankyrin repeat protein TV1425 | 1.14e-07 | NA | 9.71e-10 |
| 3. B | O00221 | NF-kappa-B inhibitor epsilon | 2.72e-05 | NA | 0.001 |
| 3. B | Q2IBF5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.62e-03 | NA | 2.32e-05 |
| 3. B | Q9VSA4 | Tonsoku-like protein | 1.95e-01 | NA | 2.98e-04 |
| 3. B | A2CIR7 | BTB/POZ domain and ankyrin repeat-containing protein NPR5 | 3.35e-02 | NA | 4.79e-04 |
| 3. B | P33825 | Ankyrin repeat protein M1 | NA | NA | 0.003 |
| 3. B | P42772 | Cyclin-dependent kinase 4 inhibitor B | 1.31e-04 | NA | 5.77e-06 |
| 3. B | Q8IWZ3 | Ankyrin repeat and KH domain-containing protein 1 | 2.86e-02 | NA | 5.80e-15 |
| 3. B | Q4V890 | Protein fem-1 homolog A | 1.41e-04 | NA | 3.09e-09 |
| 3. B | Q9J5H5 | Putative ankyrin repeat protein FPV026 | NA | NA | 3.64e-07 |
| 3. B | Q9J4Z4 | Putative ankyrin repeat protein FPV246 | NA | NA | 2.80e-07 |
| 3. B | P20640 | Ankyrin repeat protein M1 | NA | NA | 3.12e-05 |
| 3. B | Q4ACU6 | SH3 and multiple ankyrin repeat domains protein 3 | 1.11e-01 | NA | 1.72e-10 |
| 3. B | Q29RV0 | Cyclin-dependent kinase 4 inhibitor D | 4.03e-06 | NA | 1.55e-04 |
| 3. B | B0G124 | Ankyrin repeat-containing protein DDB_G0279043 | 4.08e-06 | NA | 6.53e-09 |
| 3. B | Q6TNJ1 | Krev interaction trapped protein 1 | 1.89e-01 | NA | 2.48e-05 |
| 3. B | Q8CGU4 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 | 7.71e-01 | NA | 0.037 |
| 3. B | Q8C6Y6 | Ankyrin repeat and SOCS box protein 14 | 2.04e-03 | NA | 2.20e-17 |
| 3. B | Q5UPJ9 | Putative ankyrin repeat protein L122 | NA | NA | 6.89e-07 |
| 3. B | Q91974 | NF-kappa-B inhibitor alpha | 4.18e-05 | NA | 4.40e-14 |
| 3. B | Q5AL27 | Palmitoyltransferase AKR1 | 1.58e-04 | NA | 1.69e-06 |
| 3. B | Q54F46 | Homeobox protein Wariai | 3.34e-04 | NA | 7.40e-20 |
| 3. B | Q108T9 | Cortactin-binding protein 2 | 8.24e-02 | NA | 8.69e-10 |
| 3. B | Q9H672 | Ankyrin repeat and SOCS box protein 7 | 3.97e-05 | NA | 2.31e-12 |
| 3. B | Q9ET47 | Espin | 1.26e-03 | NA | 2.24e-12 |
| 3. B | Q9GKW8 | Ankyrin repeat and death domain-containing protein 1A (Fragment) | 1.76e-05 | NA | 1.33e-15 |
| 3. B | Q05921 | 2-5A-dependent ribonuclease | 2.18e-03 | NA | 7.58e-13 |
| 3. B | Q5ZIJ9 | E3 ubiquitin-protein ligase MIB2 | 2.94e-03 | NA | 1.33e-10 |
| 3. B | Q9FY74 | Calmodulin-binding transcription activator 1 | 1.78e-02 | NA | 2.59e-04 |
| 3. B | Q8CG79 | Apoptosis-stimulating of p53 protein 2 | 4.03e-02 | NA | 0.003 |
| 3. B | Q07DV3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.07e-03 | NA | 0.007 |
| 3. B | Q99490 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 | 6.71e-01 | NA | 0.017 |
| 3. B | P50086 | Probable 26S proteasome regulatory subunit p28 | 3.44e-10 | NA | 5.51e-08 |
| 3. B | Q5UQY9 | Putative ankyrin repeat protein R896 | NA | NA | 3.48e-08 |
| 3. B | P42771 | Cyclin-dependent kinase inhibitor 2A | 1.82e-05 | NA | 0.005 |
| 3. B | Q1RHT6 | Putative ankyrin repeat protein RBE_0997 | 2.01e-03 | NA | 1.03e-07 |
| 3. B | Q02979 | Glycerophosphocholine phosphodiesterase GDE1 | 3.14e-01 | NA | 0.004 |
| 3. B | Q505D1 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 2.16e-02 | NA | 2.73e-22 |
| 3. B | O90760 | Putative ankyrin repeat protein FPV031 | NA | NA | 1.49e-05 |
| 3. B | Q8IUH4 | Palmitoyltransferase ZDHHC13 | 1.29e-04 | NA | 2.58e-10 |
| 3. B | P81069 | GA-binding protein subunit beta-2 | 7.14e-05 | NA | 1.51e-10 |
| 3. B | Q54GC8 | Acyl-CoA-binding domain-containing protein 6 homolog | 1.18e-02 | NA | 8.75e-04 |
| 3. B | Q9VUW9 | Palmitoyltransferase Hip14 | 1.54e-05 | NA | 3.42e-13 |
| 3. B | Q9NXR5 | Ankyrin repeat domain-containing protein 10 | 4.49e-03 | NA | 5.16e-08 |
| 3. B | Q96Q27 | Ankyrin repeat and SOCS box protein 2 | 4.27e-03 | NA | 1.97e-13 |
| 3. B | Q00420 | GA-binding protein subunit beta-1 | 2.64e-03 | NA | 1.43e-10 |
| 3. B | Q6NLQ8 | E3 ubiquitin-protein ligase XBAT32 | 4.47e-03 | NA | 1.61e-07 |
| 3. B | Q86WC6 | Protein phosphatase 1 regulatory subunit 27 | 1.66e-03 | NA | 3.61e-07 |
| 3. B | Q9J508 | Putative ankyrin repeat protein FPV227 | NA | NA | 5.98e-07 |
| 3. B | Q5UP39 | Putative ankyrin repeat protein R873 | NA | NA | 2.68e-04 |
| 3. B | Q1RI12 | Putative ankyrin repeat protein RBE_0921 | 4.88e-03 | NA | 2.44e-06 |
| 3. B | Q9Y6H5 | Synphilin-1 | 7.78e-03 | NA | 3.09e-04 |
| 3. B | A4D7T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.45e-05 | NA | 4.70e-05 |
| 3. B | Q5ZXN6 | Phosphocholine transferase AnkX | 6.65e-04 | NA | 4.22e-07 |
| 3. B | Q8R516 | E3 ubiquitin-protein ligase MIB2 | 8.01e-04 | NA | 8.05e-07 |
| 3. B | Q13418 | Integrin-linked protein kinase | 2.18e-02 | NA | 1.20e-08 |
| 3. B | P83757 | NF-kappa-B inhibitor cactus | NA | NA | 4.58e-04 |
| 3. B | Q9FF09 | Phytochrome-interacting ankyrin-repeat protein 1 | 1.98e-03 | NA | 0.014 |
| 3. B | F1REV3 | Krev interaction trapped protein 1 | 5.73e-02 | NA | 2.44e-04 |
| 3. B | Q9C0D5 | Protein TANC1 | 8.50e-03 | NA | 2.22e-15 |
| 3. B | Q5UNU1 | Putative ankyrin repeat protein L675 | NA | NA | 0.015 |
| 3. B | Q9Z1P7 | KN motif and ankyrin repeat domain-containing protein 3 | 3.51e-01 | NA | 6.11e-08 |
| 3. B | Q5BKI6 | Ankyrin repeat domain-containing protein 1 | 7.91e-05 | NA | 1.06e-07 |
| 3. B | Q9J516 | Putative ankyrin repeat protein FPV219 | NA | NA | 2.32e-06 |
| 3. B | Q6ZQK5 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 1.01e-03 | NA | 2.52e-04 |
| 3. B | Q9D738 | Ankyrin repeat and SOCS box protein 12 | 1.62e-05 | NA | 4.01e-05 |
| 3. B | Q07DZ5 | Cortactin-binding protein 2 | 3.14e-02 | NA | 3.74e-12 |
| 3. B | Q09YN0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.20e-04 | NA | 1.04e-06 |
| 3. B | Q2TXF6 | Ankyrin repeat domain-containing protein oryK | 8.73e-03 | NA | 0.006 |
| 3. B | D3YZU1 | SH3 and multiple ankyrin repeat domains protein 1 | 1.94e-01 | NA | 8.81e-11 |
| 3. B | Q92527 | Ankyrin repeat domain-containing protein 7 | 1.44e-08 | NA | 1.97e-18 |
| 3. B | Q02989 | Alpha-latroinsectotoxin-Lt1a (Fragment) | 4.64e-02 | NA | 6.38e-13 |
| 3. B | Q60J38 | Ankyrin repeat and KH domain-containing protein CBG24701 | 1.24e-01 | NA | 6.95e-13 |
| 3. B | D3ZD05 | KN motif and ankyrin repeat domain-containing protein 2 | 1.36e-01 | NA | 2.18e-05 |
| 3. B | Q8T2Q0 | Putative ZDHHC-type palmitoyltransferase 6 | 1.05e-03 | NA | 3.64e-07 |
| 3. B | B2RXR6 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 2.31e-02 | NA | 1.10e-21 |
| 3. B | Q502K3 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 1.09e-02 | NA | 3.31e-19 |
| 3. B | Q862Z2 | Ankyrin repeat and SOCS box protein 5 | 1.61e-04 | NA | 1.21e-09 |
| 3. B | Q66H07 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 2.35e-11 | NA | 8.39e-23 |
| 3. B | Q3TPE9 | Ankyrin repeat and MYND domain-containing protein 2 | 5.29e-03 | NA | 4.10e-08 |
| 3. B | Q9C104 | Glycerophosphocholine phosphodiesterase gde1 | 6.34e-02 | NA | 2.39e-05 |
| 3. B | Q7M6U3 | Inactive serine/threonine-protein kinase TEX14 | 1.53e-01 | NA | 0.003 |
| 3. B | Q20500 | Intracellular phospholipase A2 | 3.04e-02 | NA | 0.032 |
| 3. B | Q9FIT8 | ADP-ribosylation factor GTPase-activating protein AGD1 | 1.05e-02 | NA | 0.001 |
| 3. B | Q5PQ89 | Ankyrin repeat domain-containing protein 34B | 1.70e-01 | NA | 1.67e-09 |
| 3. B | Q05753 | Ankyrin repeat domain-containing protein, chloroplastic | 1.81e-04 | NA | 2.75e-11 |
| 3. B | Q2QLB3 | Cortactin-binding protein 2 | 1.01e-01 | NA | 8.48e-09 |
| 3. B | Q6UB99 | Ankyrin repeat domain-containing protein 11 | 7.26e-01 | NA | 1.17e-05 |
| 3. B | O22265 | Signal recognition particle 43 kDa protein, chloroplastic | 2.65e-02 | NA | 0.012 |
| 3. B | Q9JIA3 | NF-kappa-B inhibitor beta | 1.53e-03 | NA | 0.025 |
| 3. B | O55222 | Integrin-linked protein kinase | 2.73e-02 | NA | 1.20e-08 |
| 3. B | Q9J569 | Putative ankyrin repeat protein FPV162 | NA | NA | 2.93e-11 |
| 3. B | Q3SX45 | Ankyrin repeat and SOCS box protein 2 | 6.05e-03 | NA | 8.40e-13 |
| 3. B | Q8MJ49 | Osteoclast-stimulating factor 1 | 1.56e-03 | NA | 0.009 |
| 3. B | Q08DV6 | Ankyrin repeat and SOCS box protein 3 | 2.77e-04 | NA | 3.61e-12 |
| 3. B | Q9SAR5 | Ankyrin repeat domain-containing protein 2A | 1.25e-02 | NA | 4.49e-10 |
| 3. B | Q76K24 | Ankyrin repeat domain-containing protein 46 | 1.72e-04 | NA | 3.09e-04 |
| 3. B | Q09103 | Eye-specific diacylglycerol kinase | 7.59e-01 | NA | 0.009 |
| 3. B | Q4V8X4 | Acyl-CoA-binding domain-containing protein 6 | 1.32e-02 | NA | 4.61e-08 |
| 3. B | Q04721 | Neurogenic locus notch homolog protein 2 | 1.49e-01 | NA | 3.09e-05 |
| 3. B | Q3UMT1 | Protein phosphatase 1 regulatory subunit 12C | 5.35e-03 | NA | 1.07e-10 |
| 3. B | Q9C7A2 | Ankyrin repeat-containing protein ITN1 | 2.62e-07 | NA | 6.92e-12 |
| 3. B | Q09YI1 | Cortactin-binding protein 2 | 1.09e-01 | NA | 1.90e-11 |
| 3. B | Q8N6D5 | Ankyrin repeat domain-containing protein 29 | 3.54e-07 | NA | 9.42e-14 |
| 3. B | O15084 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 3.19e-02 | NA | 3.47e-22 |
| 3. B | Q5NVB9 | Palmitoyltransferase ZDHHC13 | 1.23e-06 | NA | 2.14e-10 |
| 3. B | Q7T2B9 | Myotrophin | 5.40e-06 | NA | 2.57e-08 |
| 3. B | Q9J4Z5 | Putative ankyrin repeat protein FPV245 | NA | NA | 2.71e-13 |
| 3. B | Q8BTI7 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 3.52e-02 | NA | 6.28e-16 |
| 3. B | E5RJM6 | Ankyrin repeat domain-containing protein 65 | 9.30e-07 | NA | 3.01e-14 |
| 3. B | Q6P9Z4 | Protein fem-1 homolog A | 4.27e-05 | NA | 2.29e-11 |
| 3. B | Q9GZV1 | Ankyrin repeat domain-containing protein 2 | 1.48e-04 | NA | 4.08e-12 |
| 3. B | Q6GQX6 | Ankyrin repeat and SAM domain-containing protein 6 | 5.04e-03 | NA | 1.55e-07 |
| 3. B | Q9QW30 | Neurogenic locus notch homolog protein 2 | 6.51e-02 | NA | 3.17e-05 |
| 3. B | Q108U1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.77e-05 | NA | 6.58e-05 |
| 3. B | Q86U10 | 60 kDa lysophospholipase | 1.34e-02 | NA | 8.22e-07 |
| 3. B | Q60649 | Caseinolytic peptidase B protein homolog | 8.70e-02 | NA | 1.21e-04 |
| 3. B | Q6IVG4 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 2.48e-03 | NA | 1.44e-05 |
| 3. B | Q2IBB1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.91e-04 | NA | 5.17e-05 |
| 3. B | Q3SX00 | Ankyrin repeat domain-containing protein 46 | 8.37e-04 | NA | 6.48e-04 |
| 3. B | Q59H18 | Serine/threonine-protein kinase TNNI3K | 1.02e-02 | NA | 5.20e-18 |
| 3. B | Q8VHQ3 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 4.58e-03 | NA | 1.81e-11 |
| 3. B | Q9SM23 | Acyl-CoA-binding domain-containing protein 1 | 7.18e-03 | NA | 1.72e-04 |
| 3. B | Q99PE2 | Ankyrin repeat family A protein 2 | 3.23e-04 | NA | 3.63e-08 |
| 3. B | Q7ZYG4 | Osteoclast-stimulating factor 1 | 3.63e-04 | NA | 0.033 |
| 3. B | Q0VC93 | Ankyrin repeat domain-containing protein 37 | 7.15e-03 | NA | 0.001 |
| 3. B | Q9BSK4 | Protein fem-1 homolog A | 2.69e-03 | NA | 1.52e-07 |
| 3. B | Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 | 9.34e-03 | NA | 1.00e-14 |
| 3. B | P42773 | Cyclin-dependent kinase 4 inhibitor C | 6.28e-08 | NA | 2.89e-07 |
| 3. B | A0JNU3 | 60 kDa lysophospholipase | 1.31e-02 | NA | 2.64e-04 |
| 3. B | Q28BK1 | E3 ubiquitin-protein ligase HACE1 | 1.33e-07 | NA | 6.99e-18 |
| 3. B | D4A615 | Tonsoku-like protein | 5.36e-02 | NA | 1.57e-04 |
| 3. B | Q9J5I7 | Putative ankyrin repeat protein FPV014 | NA | NA | 2.84e-09 |
| 3. B | H3BUK9 | POTE ankyrin domain family member B2 | 4.90e-06 | NA | 1.88e-14 |
| 3. B | Q96KQ4 | Apoptosis-stimulating of p53 protein 1 | 6.09e-02 | NA | 0.010 |
| 3. B | Q9DAM9 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 2.34e-12 | NA | 1.84e-22 |
| 3. B | Q8WXH4 | Ankyrin repeat and SOCS box protein 11 | 2.82e-04 | NA | 1.55e-04 |
| 3. B | O60733 | 85/88 kDa calcium-independent phospholipase A2 | 1.45e-03 | NA | 3.39e-09 |
| 3. B | Q8BLB8 | Ankyrin repeat domain-containing protein 34C | 2.08e-01 | NA | 8.58e-09 |
| 3. B | Q810B6 | Rabankyrin-5 | 3.73e-02 | NA | 2.44e-15 |
| 3. B | Q9ERK0 | Receptor-interacting serine/threonine-protein kinase 4 | 1.98e-04 | NA | 4.73e-11 |
| 3. B | A0A1D8PNZ7 | Glycerophosphocholine phosphodiesterase GDE1 | 5.95e-02 | NA | 1.08e-05 |
| 3. B | Q9J517 | Putative ankyrin repeat protein FPV218 | NA | NA | 1.31e-11 |
| 3. B | Q8VHS5 | Ankyrin repeat and SOCS box protein 16 | 2.63e-04 | NA | 1.68e-16 |
| 3. B | Q12955 | Ankyrin-3 | NA | NA | 3.83e-21 |
| 3. B | Q09YJ3 | Cortactin-binding protein 2 | 9.46e-03 | NA | 2.22e-10 |
| 3. B | Q6TNT2 | Ankyrin repeat domain-containing protein 46 | 2.79e-03 | NA | 0.001 |
| 3. B | Q8C0T1 | Protein fem-1 homolog A-B | 1.72e-03 | NA | 7.10e-09 |
| 3. B | A2RUV0 | Neurogenic locus notch homolog protein 1 | 2.67e-02 | NA | 0.028 |
| 3. B | Q38998 | Potassium channel AKT1 | 7.25e-03 | NA | 1.58e-09 |
| 3. B | Q80TN5 | Palmitoyltransferase ZDHHC17 | 2.71e-06 | NA | 5.57e-10 |
| 3. B | Q54LF0 | NAD-dependent deacetylase sir2B | 1.03e-03 | NA | 3.54e-06 |
| 3. B | C9JTQ0 | Ankyrin repeat domain-containing protein 63 | 4.51e-03 | NA | 1.05e-06 |
| 3. B | P20749 | B-cell lymphoma 3 protein | 1.09e-02 | NA | 7.54e-10 |
| 3. B | Q7S3M5 | Palmitoyltransferase akr1 | 3.68e-04 | NA | 1.31e-13 |
| 3. B | Q3V0J4 | Ankyrin repeat domain-containing protein 53 | 1.53e-02 | NA | 2.96e-09 |
| 3. B | Q9BQI6 | SMC5-SMC6 complex localization factor protein 1 | 2.16e-01 | NA | 0.004 |
| 3. B | A5PLL1 | Ankyrin repeat domain-containing protein 34B | 1.40e-02 | NA | 3.13e-08 |
| 3. B | Q5R5V4 | Integrin-linked protein kinase | 2.14e-02 | NA | 1.39e-08 |
| 3. B | Q4UKX2 | Putative ankyrin repeat protein RF_0950 | 1.94e-04 | NA | 8.74e-08 |
| 3. B | Q5ICL9 | Regulatory protein NPR4 | 1.49e-02 | NA | 0.030 |
| 3. B | O75832 | 26S proteasome non-ATPase regulatory subunit 10 | 2.21e-12 | NA | 1.80e-14 |
| 3. B | P62775 | Myotrophin | 9.68e-07 | NA | 4.44e-05 |
| 3. B | F1M5M3 | Inactive serine/threonine-protein kinase TEX14 | NA | NA | 0.005 |
| 3. B | Q5UPP7 | Putative ankyrin repeat protein R760 | NA | NA | 0.033 |
| 3. B | Q2IBB4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.22e-05 | NA | 1.93e-05 |
| 3. B | Q9BYB0 | SH3 and multiple ankyrin repeat domains protein 3 | 8.69e-02 | NA | 3.66e-12 |
| 3. B | Q9TZM3 | Leucine-rich repeat serine/threonine-protein kinase 1 | 2.75e-01 | NA | 6.48e-05 |
| 3. B | Q1RHU9 | Putative ankyrin repeat protein RBE_0984 | 3.19e-04 | NA | 0.003 |
| 3. B | P31695 | Neurogenic locus notch homolog protein 4 | 2.47e-02 | NA | 1.47e-04 |
| 3. B | Q8GXE6 | Potassium channel AKT6 | 2.40e-01 | NA | 1.49e-09 |
| 3. B | A0A140LI88 | Ankyrin repeat domain-containing protein 31 | 1.55e-01 | NA | 1.49e-06 |
| 3. B | Q5E9N5 | Caseinolytic peptidase B protein homolog | 5.87e-02 | NA | 0.033 |
| 3. B | Q09YK4 | Cortactin-binding protein 2 | 3.84e-03 | NA | 4.65e-10 |
| 3. B | Q8C8R3 | Ankyrin-2 | NA | NA | 1.92e-20 |
| 3. B | Q6F6B3 | Protein TANC1 | 2.26e-02 | NA | 2.26e-15 |
| 3. B | Q17QS6 | Ankyrin repeat and SOCS box protein 5 | 2.60e-04 | NA | 2.86e-08 |
| 3. B | Q86W74 | Ankyrin repeat domain-containing protein 46 | 8.82e-04 | NA | 6.48e-04 |
| 3. B | Q8N8V4 | Ankyrin repeat and SAM domain-containing protein 4B | 1.52e-02 | NA | 1.81e-07 |
| 3. B | Q07DY6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.30e-04 | NA | 6.99e-05 |
| 3. B | Q7T3Y0 | Notch-regulated ankyrin repeat-containing protein A | 2.78e-02 | NA | 0.007 |
| 3. B | Q6ZPR6 | Inhibitor of Bruton tyrosine kinase | 4.90e-01 | NA | 8.04e-04 |
| 3. B | Q9Y574 | Ankyrin repeat and SOCS box protein 4 | 2.52e-05 | NA | 5.16e-16 |
| 3. B | P40480 | Protein HOS4 | 1.16e-03 | NA | 5.06e-04 |
| 3. B | Q9UU77 | Ankyrin repeat-containing protein P1E11.10 | 1.61e-02 | NA | 0.003 |
| 3. B | Q9H9E1 | Ankyrin repeat family A protein 2 | 1.90e-04 | NA | 4.71e-09 |
| 3. B | Q6NXT1 | Ankyrin repeat domain-containing protein 54 | 6.75e-03 | NA | 5.84e-10 |
| 3. B | Q4FE47 | Putative E3 ubiquitin-protein ligase XBAT35 | 8.04e-02 | NA | 0.004 |
| 3. B | Q55FM5 | Myotrophin homolog | 5.54e-05 | NA | 0.004 |
| 3. B | Q5T7N3 | KN motif and ankyrin repeat domain-containing protein 4 | 1.09e-01 | NA | 6.12e-07 |
| 3. B | Q9QZH2 | BRCA1-associated RING domain protein 1 | 9.18e-02 | NA | 2.77e-08 |
| 3. B | Q6AWW5 | Ankyrin repeat-containing protein At5g02620 | 1.98e-08 | NA | 1.66e-06 |
| 3. B | Q8TDY4 | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 | 2.14e-02 | NA | 0.024 |
| 3. B | Q7ZT11 | Ankyrin repeat domain-containing protein 1 | 1.25e-05 | NA | 7.60e-07 |
| 3. B | Q07E43 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.82e-03 | NA | 3.51e-06 |
| 3. B | Q8TC84 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 2.25e-08 | NA | 6.78e-24 |
| 3. B | Q54HT1 | Protein tirA | 8.41e-02 | NA | 0.031 |
| 3. B | Q96P50 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 | 1.94e-03 | NA | 9.14e-05 |
| 3. B | Q91ZA8 | Notch-regulated ankyrin repeat-containing protein | 3.31e-02 | NA | 0.009 |
| 3. B | Q9J503 | Putative ankyrin repeat protein FPV232 | NA | NA | 4.71e-06 |
| 3. B | Q99728 | BRCA1-associated RING domain protein 1 | 1.28e-01 | NA | 9.77e-07 |
| 3. B | P97570 | 85/88 kDa calcium-independent phospholipase A2 | 2.89e-03 | NA | 1.69e-08 |
| 3. B | Q6S8J7 | POTE ankyrin domain family member A | 1.34e-04 | NA | 1.12e-14 |
| 3. B | Q3UMR0 | Ankyrin repeat domain-containing protein 27 | 7.69e-02 | NA | 8.58e-14 |
| 3. B | A3AYR1 | Acyl-CoA-binding domain-containing protein 4 | 9.56e-03 | NA | 3.12e-04 |
| 3. B | Q07008 | Neurogenic locus notch homolog protein 1 | 1.65e-01 | NA | 0.004 |
| 3. B | Q3T0F7 | Myotrophin | 1.04e-06 | NA | 4.79e-05 |
| 3. B | Q07DY4 | Cortactin-binding protein 2 | 7.23e-02 | NA | 4.61e-09 |
| 3. B | Q9VL06 | E3 ubiquitin-protein ligase Ufd4 | NA | NA | 0.032 |
| 3. B | Q9HCD6 | Protein TANC2 | 1.28e-02 | NA | 7.52e-18 |
| 3. B | A1X157 | Cortactin-binding protein 2 | 5.40e-02 | NA | 2.82e-10 |
| 3. B | Q9D3J5 | Ankyrin repeat domain-containing protein 22 | 6.30e-07 | NA | 0.013 |
| 3. B | Q9Z148 | Histone-lysine N-methyltransferase EHMT2 | 7.42e-03 | NA | 7.24e-14 |
| 3. B | Q6S545 | POTE ankyrin domain family member H | 8.11e-04 | NA | 2.52e-12 |
| 3. B | Q1RK13 | Putative ankyrin repeat protein RBE_0220 | 2.54e-03 | NA | 4.98e-18 |
| 3. B | Q54XX5 | Probable serine/threonine-protein kinase DDB_G0278535 | 8.02e-04 | NA | 6.99e-09 |
| 3. B | Q5UPF8 | Putative ankyrin repeat protein L88 | NA | NA | 2.07e-11 |
| 3. B | Q8TAK5 | GA-binding protein subunit beta-2 | 6.45e-03 | NA | 2.59e-11 |
| 3. B | Q99J82 | Integrin-linked protein kinase | 2.08e-02 | NA | 1.20e-08 |
| 3. B | Q2IBF7 | Cortactin-binding protein 2 | 7.73e-02 | NA | 1.25e-09 |
| 3. B | Q2QLF8 | Cortactin-binding protein 2 | 9.32e-02 | NA | 4.34e-09 |
| 3. B | P18954 | Protein PhlB | 5.01e-04 | NA | 0.040 |
| 3. B | Q71S22 | Inversin-A | 6.65e-04 | NA | 8.79e-19 |
| 3. B | Q9BZ19 | Ankyrin repeat domain-containing protein 60 | 4.42e-02 | NA | 2.59e-04 |
| 3. B | A0M8T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.56e-05 | NA | 9.95e-06 |
| 3. B | Q4UMH6 | Putative ankyrin repeat protein RF_0381 | 1.48e-04 | NA | 6.32e-17 |
| 3. B | P53355 | Death-associated protein kinase 1 | 6.98e-03 | NA | 7.45e-16 |
| 3. B | Q804S5 | E3 ubiquitin-protein ligase mib1 | 3.10e-04 | NA | 5.80e-12 |
| 3. B | Q8IYU2 | E3 ubiquitin-protein ligase HACE1 | 2.53e-03 | NA | 1.56e-17 |
| 3. B | Q875S9 | Palmitoyltransferase AKR1 | 3.03e-05 | NA | 6.78e-08 |
| 3. B | P0CS66 | Palmitoyltransferase AKR1 | 2.04e-04 | NA | 1.01e-09 |
| 3. B | Q9HLN1 | Putative ankyrin repeat protein Ta0196 | 1.81e-06 | NA | 9.93e-08 |
| 3. B | Q6B858 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 1.30e-08 | NA | 6.14e-21 |
| 3. B | Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 7.67e-02 | NA | 1.34e-16 |
| 3. B | Q0VCS9 | Ankyrin repeat and MYND domain-containing protein 2 | 6.64e-03 | NA | 8.72e-10 |
| 3. B | P25963 | NF-kappa-B inhibitor alpha | 1.30e-04 | NA | 2.10e-14 |
| 3. B | Q5REW9 | Ankyrin repeat domain-containing protein 27 | 1.12e-02 | NA | 1.96e-15 |
| 3. B | Q863Z4 | Myotrophin | 1.03e-06 | NA | 4.79e-05 |
| 3. B | Q9CQ31 | Ankyrin repeat and SOCS box protein 11 | 2.93e-04 | NA | 1.22e-04 |
| 3. B | Q6JAN1 | Inversin | 4.58e-04 | NA | 1.44e-17 |
| 3. B | G3V8T1 | M-phase phosphoprotein 8 | 1.59e-03 | NA | 6.43e-09 |
| 3. B | F4IS56 | Integrin-linked protein kinase 1 | 1.61e-01 | NA | 0.001 |
| 3. B | Q5RJK8 | Acyl-CoA-binding domain-containing protein 6 | 5.42e-03 | NA | 1.89e-04 |
| 3. B | D3ZBM7 | E3 ubiquitin-protein ligase HACE1 | 3.01e-03 | NA | 3.28e-17 |
| 3. B | A2AS55 | Ankyrin repeat domain-containing protein 16 | 2.28e-08 | NA | 1.43e-08 |
| 3. B | Q9J5G9 | Putative ankyrin repeat protein FPV034 | NA | NA | 1.54e-04 |
| 3. B | Q9ZVC2 | Regulatory protein NPR5 | 6.78e-02 | NA | 0.009 |
| 3. B | Q2QLA4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.65e-04 | NA | 7.62e-05 |
| 3. B | P23631 | Alpha-latrotoxin-Lt1a | 2.57e-02 | NA | 9.63e-17 |
| 3. B | P39010 | Palmitoyltransferase AKR1 | 2.94e-04 | NA | 3.15e-08 |
| 3. B | Q8WXD9 | Caskin-1 | 4.06e-02 | NA | 2.56e-13 |
| 3. B | Q8R560 | Ankyrin repeat domain-containing protein 1 | 1.67e-04 | NA | 4.41e-07 |
| 3. B | Q60778 | NF-kappa-B inhibitor beta | 1.42e-04 | NA | 0.016 |
| 3. B | Q9FY48 | E3 ubiquitin-protein ligase KEG | 5.32e-02 | NA | 2.86e-08 |
| 3. B | Q54XY6 | Probable serine/threonine-protein kinase DDB_G0278521 | 4.33e-02 | NA | 4.86e-06 |
| 3. B | A0A084B9Z8 | Ankyrin repeat domain-containing protein SAT10 | 9.42e-02 | NA | 1.00e-07 |
| 3. B | Q8WZ74 | Cortactin-binding protein 2 | 1.03e-01 | NA | 1.17e-09 |
| 3. B | Q3EC11 | Probable protein S-acyltransferase 23 | 2.74e-06 | NA | 3.58e-14 |
| 3. B | Q5B0V6 | Palmitoyltransferase akr1 | 3.92e-04 | NA | 7.42e-15 |
| 3. B | Q8BLD6 | Ankyrin repeat domain-containing protein 55 | 1.99e-03 | NA | 2.62e-14 |
| 3. B | Q9VBP3 | Poly [ADP-ribose] polymerase tankyrase | 5.31e-02 | NA | 5.42e-11 |
| 3. B | Q96DX5 | Ankyrin repeat and SOCS box protein 9 | 2.10e-06 | NA | 1.44e-10 |
| 3. B | Q9P2D0 | Inhibitor of Bruton tyrosine kinase | 5.19e-01 | NA | 0.009 |
| 3. B | Q9BR61 | Acyl-CoA-binding domain-containing protein 6 | 4.79e-03 | NA | 4.05e-06 |
| 3. B | Q2QL82 | Cortactin-binding protein 2 | 1.28e-02 | NA | 3.75e-10 |
| 3. B | Q96NW4 | Ankyrin repeat domain-containing protein 27 | 4.51e-02 | NA | 5.05e-16 |
| 3. B | A7E2S9 | Putative ankyrin repeat domain-containing protein 30B-like | 3.51e-04 | NA | 1.40e-09 |
| 3. B | Q8VE42 | Ankyrin repeat domain-containing protein 49 | 9.30e-05 | NA | 3.60e-06 |