Summary

Q8N2A0

Homolog: P16531.
Function: Seminal vesicle protein SVP-2 (Fragment).

Statistics

Total GO Annotation: 137
Unique PROST Go: 42
Unique BLAST Go: 94

Total Homologs: 114
Unique PROST Homologs: 73
Unique BLAST Homologs: 40

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P16531 (Seminal vesicle protein SVP-2 (Fragment)) with a FATCAT P-Value: 0.0418 and RMSD of 3.15 angstrom. The sequence alignment identity is 21.5%.
Structural alignment shown in left. Query protein Q8N2A0 colored as red in alignment, homolog P16531 colored as blue. Query protein Q8N2A0 is also shown in right top, homolog P16531 showed in right bottom. They are colored based on secondary structures. 

  Q8N2A0 MPKSLEIYKGSCNWEESG--LLGSCFSQGLALLPRVEWSGAILAH--CIVDLPSS------------SDPPTSASHFSGLQAH--TTTARWSLTLLPRLE 82
  P16531 ---HLALLLILEN-QASGRRLRGSARAQD-PVVSRV-W------HKEEVEESESSRGQDFDKRRFWEKDDPTGE-HVSVRHEHLEKSHIRFK---EDSID 84

  Q8N2A0 CSGTISAHYNLRLLGSSNSPVSASQVAETTEACHHT--RLIFVFSVETGFHHVGQAGLKLLTSG-DPPASASQSAGITGVSHSARPKSCFLQLLG 174
  P16531 DSG--SA-------GGLN-P-SKGHL-RLKR--HDAMEELV---SVE------DQA----LANGADPGKSNMQRV-------------------- 132

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005829 cytosol
2. P GO:0007276 gamete generation
2. P GO:0045735 nutrient reservoir activity
2. P GO:0005509 calcium ion binding
2. P GO:0090729 toxin activity
2. P GO:0030216 keratinocyte differentiation
2. P GO:0030246 carbohydrate binding
2. P GO:0030430 host cell cytoplasm
2. P GO:0008217 regulation of blood pressure
2. P GO:0008437 thyrotropin-releasing hormone activity
2. P GO:0009631 cold acclimation
2. P GO:0044163 host cytoskeleton
2. P GO:0009538 photosystem I reaction center
2. P GO:0045095 keratin filament
2. P GO:0010921 regulation of phosphatase activity
2. P GO:0033172 gas vesicle shell
2. P GO:0031424 keratinization
2. P GO:0004867 serine-type endopeptidase inhibitor activity
2. P GO:0043023 ribosomal large subunit binding
2. P GO:0046871 N-acetylgalactosamine binding
2. P GO:0042302 structural constituent of cuticle
2. P GO:0042273 ribosomal large subunit biogenesis
2. P GO:0040014 regulation of multicellular organism growth
2. P GO:0009755 hormone-mediated signaling pathway
2. P GO:0005576 extracellular region
2. P GO:0000054 ribosomal subunit export from nucleus
2. P GO:0005179 hormone activity
2. P GO:0042256 mature ribosome assembly
2. P GO:0032355 response to estradiol
2. P GO:0004864 protein phosphatase inhibitor activity
2. P GO:0005882 intermediate filament
2. P GO:0005537 mannose binding
2. P GO:0008544 epidermis development
2. P GO:0032095 regulation of response to food
2. P GO:0046870 cadmium ion binding
2. P GO:0019212 phosphatase inhibitor activity
2. P GO:0042311 vasodilation
2. P GO:0035064 methylated histone binding
2. P GO:0005536 glucose binding
2. P GO:0031412 gas vesicle organization
2. P GO:0004865 protein serine/threonine phosphatase inhibitor activity
2. P GO:0003785 actin monomer binding
2. P GO:0001533 cornified envelope
3. B GO:0045236 CXCR chemokine receptor binding
3. B GO:0048642 negative regulation of skeletal muscle tissue development
3. B GO:0018026 peptidyl-lysine monomethylation
3. B GO:0044389 ubiquitin-like protein ligase binding
3. B GO:0031083 BLOC-1 complex
3. B GO:0005654 nucleoplasm
3. B GO:0046548 retinal rod cell development
3. B GO:0072015 glomerular visceral epithelial cell development
3. B GO:0031870 thromboxane A2 receptor binding
3. B GO:0015820 leucine transport
3. B GO:2001020 regulation of response to DNA damage stimulus
3. B GO:0090068 positive regulation of cell cycle process
3. B GO:2000646 positive regulation of receptor catabolic process
3. B GO:0035116 embryonic hindlimb morphogenesis
3. B GO:0015175 neutral amino acid transmembrane transporter activity
3. B GO:1902036 regulation of hematopoietic stem cell differentiation
3. B GO:0001736 establishment of planar polarity
3. B GO:0044666 MLL3/4 complex
3. B GO:0043947 obsolete positive regulation by host of symbiont catalytic activity
3. B GO:0015173 aromatic amino acid transmembrane transporter activity
3. B GO:0036064 ciliary basal body
3. B GO:0031647 regulation of protein stability
3. B GO:0046329 negative regulation of JNK cascade
3. B GO:0072175 epithelial tube formation
3. B GO:0043584 nose development
3. B GO:1990763 arrestin family protein binding
3. B GO:0008466 glycogenin glucosyltransferase activity
3. B GO:0002669 positive regulation of T cell anergy
3. B GO:0016279 protein-lysine N-methyltransferase activity
3. B GO:0051879 Hsp90 protein binding
3. B GO:0044225 apical pole of neuron
3. B GO:0070423 nucleotide-binding oligomerization domain containing signaling pathway
3. B GO:0005432 calcium:sodium antiporter activity
3. B GO:1903801 L-leucine import across plasma membrane
3. B GO:0000185 obsolete activation of MAPKKK activity
3. B GO:0060039 pericardium development
3. B GO:1990184 amino acid transport complex
3. B GO:0050687 negative regulation of defense response to virus
3. B GO:1904292 regulation of ERAD pathway
3. B GO:0033634 positive regulation of cell-cell adhesion mediated by integrin
3. B GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
3. B GO:0070062 extracellular exosome
3. B GO:0018022 peptidyl-lysine methylation
3. B GO:0005667 transcription regulator complex
3. B GO:0043330 response to exogenous dsRNA
3. B GO:0031528 microvillus membrane
3. B GO:0102751 UDP-alpha-D-glucose:glucosyl-glycogenin alpha-D-glucosyltransferase activity
3. B GO:0018027 peptidyl-lysine dimethylation
3. B GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
3. B GO:1900037 regulation of cellular response to hypoxia
3. B GO:0021532 neural tube patterning
3. B GO:0006479 protein methylation
3. B GO:0021670 lateral ventricle development
3. B GO:0043231 intracellular membrane-bounded organelle
3. B GO:0008589 regulation of smoothened signaling pathway
3. B GO:0022408 negative regulation of cell-cell adhesion
3. B GO:0021772 olfactory bulb development
3. B GO:0000278 mitotic cell cycle
3. B GO:0015827 tryptophan transport
3. B GO:0005879 axonemal microtubule
3. B GO:0032391 photoreceptor connecting cilium
3. B GO:0015180 L-alanine transmembrane transporter activity
3. B GO:0036057 slit diaphragm
3. B GO:0097014 ciliary plasm
3. B GO:0090085 regulation of protein deubiquitination
3. B GO:0019787 ubiquitin-like protein transferase activity
3. B GO:0071558 histone H3-tri/di-methyl-lysine-27 demethylase activity
3. B GO:0002177 manchette
3. B GO:0046642 negative regulation of alpha-beta T cell proliferation
3. B GO:0035610 protein side chain deglutamylation
3. B GO:0035115 embryonic forelimb morphogenesis
3. B GO:0098713 leucine import across plasma membrane
3. B GO:0090102 cochlea development
3. B GO:0045744 negative regulation of G protein-coupled receptor signaling pathway
3. B GO:1990380 Lys48-specific deubiquitinase activity
3. B GO:0007257 obsolete activation of JUN kinase activity
3. B GO:0008349 MAP kinase kinase kinase kinase activity
3. B GO:0032688 negative regulation of interferon-beta production
3. B GO:1901799 negative regulation of proteasomal protein catabolic process
3. B GO:0035519 protein K29-linked ubiquitination
3. B GO:0032480 negative regulation of type I interferon production
3. B GO:0032050 clathrin heavy chain binding
3. B GO:0035253 ciliary rootlet
3. B GO:0015823 phenylalanine transport
3. B GO:0032534 regulation of microvillus assembly
3. B GO:0035869 ciliary transition zone
3. B GO:0070899 mitochondrial tRNA wobble uridine modification
3. B GO:0022038 corpus callosum development
3. B GO:0038061 NIK/NF-kappaB signaling
3. B GO:1904628 cellular response to phorbol 13-acetate 12-myristate
3. B GO:0015190 L-leucine transmembrane transporter activity
3. B GO:2000772 regulation of cellular senescence
3. B GO:0071557 histone H3-K27 demethylation
3. B GO:1904273 L-alanine import across plasma membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8N2A0 Putative uncharacterized protein encoded by LINC00269 0 1.67e-178 3.83e-124
2. P O70557 Small proline-rich protein 2F 1.36e-01 2.16e-02 NA
2. P Q4W7G7 Keratin-associated protein 13-4 2.29e-01 3.51e-03 NA
2. P Q9PR55 Uncharacterized protein UU089.1 9.20e-01 4.45e-05 NA
2. P Q9CQK8 Small proline-rich protein 2A1 4.27e-01 8.48e-04 NA
2. P Q8BGJ3 Uncharacterized protein C17orf100 homolog 3.95e-01 2.16e-03 NA
2. P P42758 Dehydrin Xero 2 1.51e-01 3.27e-02 NA
2. P Q8WSW3 Cadmium metallothionein 9.90e-01 3.07e-02 NA
2. P P08688 Albumin-2 9.90e-01 2.76e-03 NA
2. P D0NRP3 RxLR effector protein PITG_15110 9.83e-01 2.72e-02 NA
2. P B7WFQ1 Uncharacterized skeletal organic matrix protein 2 9.33e-01 3.34e-02 NA
2. P A0SIF1 Short neuropeptide F 2.67e-01 1.29e-03 NA
2. P Q99401 Putative uncharacterized protein YPL238C 5.57e-01 1.02e-02 NA
2. P P52743 Putative zinc finger protein 137 9.42e-01 7.20e-03 NA
2. P A0A023W157 U-scoloptoxin(08)-Er5b 8.65e-01 4.84e-05 NA
2. P Q4W7G8 Keratin-associated protein 13-4 3.22e-01 3.51e-03 NA
2. P P81584 Cuticle protein CP1876 3.49e-01 2.11e-03 NA
2. P Q5SPV6 Uncharacterized protein C2orf73 homolog 2.27e-01 9.72e-03 NA
2. P Q4W7H0 Keratin-associated protein 13-4 3.68e-01 3.33e-04 NA
2. P P39564 Uncharacterized protein YAR068W 2.59e-01 6.97e-03 NA
2. P P23507 Protein XA-1 1.36e-01 7.79e-05 NA
2. P A0A023W163 U-scoloptoxin-Er5e 7.99e-01 2.66e-02 NA
2. P A0A023W0V9 U-scoloptoxin-Er5c 9.15e-01 1.35e-03 NA
2. P Q8BV84 Proline-rich protein 9 7.20e-01 1.19e-03 NA
2. P D4AEP7 Albumin-2 9.85e-01 9.61e-03 NA
2. P Q6JHY2 Submandibular gland protein C 8.75e-01 1.63e-02 NA
2. P P16531 Seminal vesicle protein SVP-2 (Fragment) 4.18e-02 1.28e-08 NA
2. P Q8WY50 Placenta-specific protein 4 4.05e-01 2.36e-03 NA
2. P P13675 Y-linked testis-specific protein 1 8.22e-01 1.32e-02 NA
2. P A0A023W0B6 U-scoloptoxin(08)-Er5a 8.39e-01 1.00e-04 NA
2. P Q7NF26 Photosystem I reaction center subunit II 7.54e-01 1.95e-02 NA
2. P Q5UP52 Uncharacterized protein L586 NA 1.53e-02 NA
2. P Q9BYQ0 Keratin-associated protein 9-8 8.66e-01 2.25e-02 NA
2. P Q4W7G9 Keratin-associated protein 13-4 2.95e-01 3.51e-03 NA
2. P O31794 Uncharacterized protein YmaF 7.41e-01 3.81e-06 NA
2. P P25561 Putative uncharacterized protein YCL021W 3.83e-01 1.63e-02 NA
2. P P0DKP2 Turripeptide OL55-like 9.27e-01 6.47e-03 NA
2. P Q6ZQT7 Putative uncharacterized protein FLJ44672 2.45e-01 1.95e-07 NA
2. P Q3SY46 Keratin-associated protein 13-3 2.15e-01 2.63e-04 NA
2. P Q6PGQ1 Aspartate-rich protein 1 8.38e-02 2.53e-02 NA
2. P P37801 Calponin homolog OV9M 8.71e-01 3.24e-02 NA
2. P A0A023W0C3 U-scoloptoxin-Er5d 8.38e-01 1.56e-03 NA
2. P Q3LI77 Keratin-associated protein 13-4 3.94e-01 3.02e-07 NA
2. P Q8NC38 Putative uncharacterized protein ZNF436-AS1 3.73e-02 2.08e-04 NA
2. P P0CV46 Secreted RxLR effector protein 115 4.00e-01 4.14e-02 NA
2. P Q27084 Tachylectin-2 8.72e-01 1.46e-03 NA
2. P P81583 Cuticle protein CP1499 6.16e-01 3.94e-08 NA
2. P P20514 Uncharacterized 18.2 kDa protein NA 6.97e-03 NA
2. P A0A023VZR2 U-scoloptoxin(08)-Cw1a 9.24e-01 1.18e-02 NA
2. P Q11108 Uncharacterized protein C03B1.1 9.63e-01 2.34e-04 NA
2. P O96001 Protein phosphatase 1 regulatory subunit 17 2.30e-01 2.93e-10 NA
2. P P0DMD5 Natriuretic peptide BM026 4.16e-01 1.73e-03 NA
2. P O17389 Thymosin beta 4.68e-01 4.11e-08 NA
2. P Q8QFQ9 Pro-thyrotropin-releasing hormone-A 7.21e-01 2.23e-02 NA
2. P Q9Z2E4 Protein phosphatase 1 regulatory subunit 17 3.64e-01 6.15e-04 NA
2. P P75318 Uncharacterized protein MPN_465 3.87e-01 1.16e-02 NA
2. P P84801 Griffithsin NA 1.67e-02 NA
2. P Q1PFS7 Uncharacterized protein At1g24060 6.22e-01 2.10e-02 NA
2. P A0A172M4N0 Secreted RxLR effector protein 28 4.28e-01 5.90e-06 NA
2. P P12940 Bowman-Birk type trypsin inhibitor 9.48e-01 1.09e-03 NA
2. P Q40561 Proteinase inhibitor type-2 9.33e-01 1.39e-02 NA
2. P Q8T0W2 Pacifastin-like protease inhibitor cvp4 6.88e-01 3.74e-04 NA
2. P Q4W7H1 Keratin-associated protein 13-4 4.06e-01 3.33e-04 NA
2. P D9IX98 Natriuretic peptide Oh-NP 2.74e-01 1.73e-03 NA
2. P Q8SS47 Eukaryotic translation initiation factor 6 9.70e-01 1.28e-02 NA
2. P Q8IUC0 Keratin-associated protein 13-1 3.09e-01 2.83e-02 NA
2. P Q6GZU1 Uncharacterized protein 035L NA 3.04e-02 NA
2. P Q4KL71 Small proline-rich protein 2A3 3.88e-01 8.48e-04 NA
2. P P09485 Calcium-binding protein LPS1-alpha 9.50e-01 6.40e-03 NA
2. P P08041 Gas vesicle protein C 8.68e-01 2.77e-02 NA
2. P P34626 Uncharacterized protein ZK353.3 2.05e-01 4.94e-04 NA
2. P P02967 Development-specific protein S homolog 9.72e-01 4.09e-02 NA
2. P Q43502 Proteinase inhibitor type-2 CEVI57 8.88e-01 4.77e-03 NA
2. P O67204 Uncharacterized protein aq_1127 9.23e-01 2.92e-02 NA
3. B O00592 Podocalyxin 9.07e-01 NA 1.50e-06
3. B A6NJG6 Arginine-fifty homeobox 4.52e-01 NA 2.34e-05
3. B Q8IV13 Cyclin-J-like protein 8.07e-01 NA 0.021
3. B Q04864 Proto-oncogene c-Rel 7.77e-01 NA 4.14e-09
3. B Q96MD7 Uncharacterized protein C9orf85 8.16e-01 NA 8.61e-27
3. B Q9Y2Z0 Protein SGT1 homolog 9.72e-01 NA 1.05e-09
3. B Q8N9N2 Activating signal cointegrator 1 complex subunit 1 6.96e-01 NA 2.24e-05
3. B Q09FC8 Zinc finger protein 415 8.83e-01 NA 1.62e-04
3. B Q8N976 Putative uncharacterized protein FLJ38264 3.00e-01 NA 2.48e-29
3. B Q96ET8 Golgi apparatus membrane protein TVP23 homolog C 6.14e-01 NA 2.13e-06
3. B Q5JPI9 EEF1A lysine methyltransferase 2 7.04e-01 NA 1.79e-06
3. B O15488 Glycogenin-2 8.18e-01 NA 8.39e-04
3. B F2Z398 LMO7 downstream neighbor protein 3.24e-01 NA 0.002
3. B Q8N769 Uncharacterized protein C14orf178 4.56e-01 NA 7.71e-10
3. B Q5T7P6 Transmembrane protein 78 4.19e-01 NA 5.07e-07
3. B Q5H9K5 Zinc finger matrin-type protein 1 8.12e-01 NA 5.23e-07
3. B A0A096LPI5 Putative uncharacterized protein CCDC28A-AS1 2.05e-01 NA 6.04e-10
3. B Q58FG0 Putative heat shock protein HSP 90-alpha A5 5.75e-01 NA 0.022
3. B O14628 Zinc finger protein 195 9.73e-01 NA 5.42e-09
3. B Q9NV72 Zinc finger protein 701 5.20e-01 NA 4.00e-11
3. B Q96J02 E3 ubiquitin-protein ligase Itchy homolog 9.73e-01 NA 2.25e-05
3. B Q9Y2Z2 Protein MTO1 homolog, mitochondrial 9.58e-01 NA 8.01e-05
3. B Q68CZ1 Protein fantom 9.87e-01 NA 2.74e-09
3. B P51957 Serine/threonine-protein kinase Nek4 9.43e-01 NA 2.40e-12
3. B Q5SR53 Putative uncharacterized protein PIK3CD-AS1 1.02e-01 NA 0.048
3. B P08195 4F2 cell-surface antigen heavy chain 9.06e-01 NA 3.96e-04
3. B A6NIU2 Putative uncharacterized protein encoded by LINC01549 6.13e-01 NA 4.89e-05
3. B Q6ZUF6 Putative uncharacterized protein encoded by LINC00336 3.74e-02 NA 2.75e-07
3. B Q6B4Z3 Histone demethylase UTY 9.41e-01 NA 6.36e-11
3. B Q8TDM0 Breast carcinoma-amplified sequence 4 4.18e-01 NA 2.34e-05
3. B Q96M98 Parkin coregulated gene protein 7.11e-01 NA 3.21e-05
3. B Q3ZCU0 Protein GVQW3 5.03e-01 NA 1.90e-07
3. B Q9H2J1 Uncharacterized protein ARRDC1-AS1 5.42e-02 NA 4.34e-08
3. B O94966 Ubiquitin carboxyl-terminal hydrolase 19 9.93e-01 NA 2.17e-05
3. B Q5VW38 Protein GPR107 7.85e-01 NA 0.012
3. B Q8WTZ3 Zinc finger protein ENSP00000375192 7.32e-01 NA 2.11e-31
3. B Q6UX73 UPF0764 protein C16orf89 6.96e-01 NA 1.94e-07
3. B Q92918 Mitogen-activated protein kinase kinase kinase kinase 1 8.34e-01 NA 4.69e-06
3. B Q8NEM8 Cytosolic carboxypeptidase 3 9.66e-01 NA 7.36e-07
3. B Q9BUA6 Myosin regulatory light chain 10 9.56e-01 NA 1.33e-05