Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P0C7W3
(Prosalusin) with a FATCAT P-Value: 0.0 and RMSD of 1.80 angstrom. The sequence alignment identity is 79.3%.
Structural alignment shown in left. Query protein Q8N2E6 colored as red in alignment, homolog P0C7W3 colored as blue.
Query protein Q8N2E6 is also shown in right top, homolog P0C7W3 showed in right bottom. They are colored based on secondary structures.
Q8N2E6 MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPGLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS 100 P0C7W3 MAVARHGYRPWGSILGLLGLALAAAAAWDVASLRCTFGSFCECDFWPDLPGLECDLAQHLAGQHLAKALVVKSLKAFVQDPAPSKPLVLSLHGWTGTGKS 100 Q8N2E6 YVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKKDLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYRKAIFIFIRWL 200 P0C7W3 YVSSLLAQHLFRDGLRSPHVHHFSPIIHFPHPSRTEQYKKELKSWVQGNLTACGRSLFLFDEMDKLPPGLMEVLQPFLGPSWVVYGTNYRKAIFIFIRWL 200 Q8N2E6 LKLGHHGRAPPRRSGALPPAPAAPRPALRAQRAGPAGPGAKG 242 P0C7W3 LAVWHHGGAPAGRCGALPPAPAASRAPLRTQ----------- 231
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0006998 | nuclear envelope organization |
| 1. PB | GO:0051584 | regulation of dopamine uptake involved in synaptic transmission |
| 1. PB | GO:0030659 | cytoplasmic vesicle membrane |
| 1. PB | GO:0042406 | extrinsic component of endoplasmic reticulum membrane |
| 1. PB | GO:0008057 | eye pigment granule organization |
| 1. PB | GO:0071763 | nuclear membrane organization |
| 1. PB | GO:0042053 | regulation of dopamine metabolic process |
| 1. PB | GO:0070050 | neuron cellular homeostasis |
| 1. PB | GO:0005524 | ATP binding |
| 1. PB | GO:0044319 | wound healing, spreading of cells |
| 1. PB | GO:0048489 | synaptic vesicle transport |
| 1. PB | GO:0044255 | cellular lipid metabolic process |
| 1. PB | GO:0070062 | extracellular exosome |
| 1. PB | GO:0010883 | regulation of lipid storage |
| 1. PB | GO:0007504 | larval fat body development |
| 1. PB | GO:0051787 | misfolded protein binding |
| 1. PB | GO:0005818 | aster |
| 1. PB | GO:0046467 | membrane lipid biosynthetic process |
| 1. PB | GO:0051082 | unfolded protein binding |
| 1. PB | GO:0045104 | intermediate filament cytoskeleton organization |
| 1. PB | GO:0140591 | nuclear envelope budding |
| 1. PB | GO:0140603 | obsolete ATP hydrolysis activity |
| 1. PB | GO:0007029 | endoplasmic reticulum organization |
| 1. PB | GO:0043231 | intracellular membrane-bounded organelle |
| 1. PB | GO:0061077 | chaperone-mediated protein folding |
| 1. PB | GO:2000008 | regulation of protein localization to cell surface |
| 1. PB | GO:0071426 | obsolete ribonucleoprotein complex export from nucleus |
| 1. PB | GO:0043104 | positive regulation of GTP cyclohydrolase I activity |
| 1. PB | GO:0031965 | nuclear membrane |
| 1. PB | GO:0071712 | ER-associated misfolded protein catabolic process |
| 1. PB | GO:0070328 | triglyceride homeostasis |
| 1. PB | GO:0031175 | neuron projection development |
| 1. PB | GO:0005783 | endoplasmic reticulum |
| 1. PB | GO:0030104 | water homeostasis |
| 1. PB | GO:0019894 | kinesin binding |
| 1. PB | GO:1904427 | positive regulation of calcium ion transmembrane transport |
| 1. PB | GO:0030426 | growth cone |
| 1. PB | GO:0043950 | positive regulation of cAMP-mediated signaling |
| 1. PB | GO:0005179 | hormone activity |
| 1. PB | GO:0006996 | organelle organization |
| 1. PB | GO:0099050 | vesicle scission |
| 1. PB | GO:1903741 | negative regulation of phosphatidate phosphatase activity |
| 1. PB | GO:0030141 | secretory granule |
| 1. PB | GO:0051673 | membrane disruption in another organism |
| 1. PB | GO:1900244 | positive regulation of synaptic vesicle endocytosis |
| 1. PB | GO:0048499 | synaptic vesicle membrane organization |
| 1. PB | GO:0006979 | response to oxidative stress |
| 1. PB | GO:0005856 | cytoskeleton |
| 1. PB | GO:0008092 | cytoskeletal protein binding |
| 1. PB | GO:0040011 | locomotion |
| 1. PB | GO:0030103 | vasopressin secretion |
| 1. PB | GO:0008021 | synaptic vesicle |
| 1. PB | GO:0048085 | adult chitin-containing cuticle pigmentation |
| 1. PB | GO:0005788 | endoplasmic reticulum lumen |
| 1. PB | GO:0071218 | cellular response to misfolded protein |
| 1. PB | GO:0000338 | protein deneddylation |
| 1. PB | GO:0007155 | cell adhesion |
| 1. PB | GO:0034504 | protein localization to nucleus |
| 1. PB | GO:0042802 | identical protein binding |
| 1. PB | GO:0061992 | obsolete ATP-dependent chaperone mediated protein folding |
| 1. PB | GO:0005635 | nuclear envelope |
| 1. PB | GO:0051085 | chaperone cofactor-dependent protein refolding |
| 2. P | GO:0016887 | ATP hydrolysis activity |
| 2. P | GO:0006986 | response to unfolded protein |
| 2. P | GO:0006271 | DNA strand elongation involved in DNA replication |
| 3. B | GO:0014701 | junctional sarcoplasmic reticulum membrane |
| 3. B | GO:0031093 | platelet alpha granule lumen |
| 3. B | GO:0086036 | regulation of cardiac muscle cell membrane potential |
| 3. B | GO:1901846 | positive regulation of cell communication by electrical coupling involved in cardiac conduction |
| 3. B | GO:0060047 | heart contraction |
| 3. B | GO:0060316 | positive regulation of ryanodine-sensitive calcium-release channel activity |
| 3. B | GO:0010880 | regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q5JU69 | Torsin-2A | 1.22e-12 | 2.50e-10 | 3.32e-143 |
| 1. PB | A4FUH1 | Torsin-2A | 1.11e-16 | 4.27e-09 | 2.91e-127 |
| 1. PB | O14657 | Torsin-1B | 2.70e-12 | 4.68e-10 | 2.80e-48 |
| 1. PB | O77277 | Torsin-like protein | 5.02e-11 | 5.53e-08 | 6.43e-28 |
| 1. PB | Q9H497 | Torsin-3A | 3.19e-10 | 7.62e-14 | 7.32e-34 |
| 1. PB | Q8N2E6 | Prosalusin | 0 | 2.54e-126 | 9.93e-176 |
| 1. PB | Q3KQ18 | Torsin-4A-B | 2.13e-06 | 2.88e-03 | 5.08e-09 |
| 1. PB | Q8R1J9 | Torsin-2A | 7.33e-14 | 8.68e-09 | 5.61e-115 |
| 1. PB | Q6AYR4 | Torsin-2A | 7.32e-14 | 3.73e-09 | 1.88e-115 |
| 1. PB | Q68F68 | Torsin-2A | 0.00e+00 | 2.25e-04 | 1.80e-76 |
| 1. PB | Q5M936 | Torsin-3A | 3.50e-07 | 3.94e-14 | 2.07e-30 |
| 1. PB | Q95NU5 | Torsin-like protein | 5.34e-13 | 4.78e-06 | 1.15e-38 |
| 1. PB | Q9ER41 | Torsin-1B | 2.56e-12 | 1.67e-07 | 9.38e-49 |
| 1. PB | Q9ER38 | Torsin-3A | 2.58e-08 | 2.19e-16 | 1.98e-29 |
| 1. PB | Q9ER39 | Torsin-1A | 2.14e-12 | 1.30e-05 | 1.52e-51 |
| 1. PB | Q8BH02 | Torsin-4A | 3.94e-06 | 2.16e-04 | 5.85e-08 |
| 1. PB | P0C7W3 | Prosalusin | 0.00e+00 | 1.42e-59 | 2.80e-122 |
| 1. PB | Q60HG2 | Torsin-1A | 9.23e-12 | 1.69e-06 | 3.33e-52 |
| 1. PB | O14656 | Torsin-1A | 3.44e-13 | 2.16e-06 | 5.01e-52 |
| 1. PB | Q0IHC5 | Torsin-4A-A | 3.22e-07 | 7.54e-04 | 5.05e-09 |
| 1. PB | P0C7W2 | Prosalusin | 0.00e+00 | 5.74e-63 | 4.10e-121 |
| 1. PB | Q68G38 | Torsin-1A | 2.05e-10 | 4.15e-06 | 7.78e-51 |
| 1. PB | P0C7W1 | Prosalusin | 1.11e-16 | 1.12e-84 | 4.26e-145 |
| 1. PB | Q568B8 | Torsin-4A | 9.90e-06 | 1.59e-02 | 2.58e-12 |
| 2. P | Q89621 | Uncharacterized protein ORF2 | NA | 1.18e-04 | NA |
| 2. P | Q50701 | Putative ATP-binding protein Rv3427c in insertion sequence | 4.16e-02 | 9.00e-03 | NA |
| 3. B | Q5BKJ7 | Torsin-4A | 4.14e-07 | NA | 4.64e-09 |
| 3. B | P82179 | Triadin | 5.62e-01 | NA | 0.038 |
| 3. B | Q9NXH8 | Torsin-4A | 5.24e-06 | NA | 9.79e-07 |
| 3. B | Q9ERA9 | Torsin-1A (Fragment) | 0.00e+00 | NA | 1.48e-51 |