Summary

Q8N309

Homolog: Q95JT3.
Function: Leucine-rich repeat-containing protein 43.

Statistics

Total GO Annotation: 258
Unique PROST Go: 153
Unique BLAST Go: 62

Total Homologs: 164
Unique PROST Homologs: 108
Unique BLAST Homologs: 36

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q95JT3 (Leucine-rich repeat-containing protein 43) with a FATCAT P-Value: 0.0 and RMSD of 2.21 angstrom. The sequence alignment identity is 93.6%.
Structural alignment shown in left. Query protein Q8N309 colored as red in alignment, homolog Q95JT3 colored as blue. Query protein Q8N309 is also shown in right top, homolog Q95JT3 showed in right bottom. They are colored based on secondary structures. 

  Q8N309 MEASYESESESESEAGPGTQRPGTGTVSAAVREHLRKLCLREFPCGAGSWNKSRFLPQTWRTWRELVPREEDVVSPGEETVEALLGLVRSRHSPWALLNN 100
  Q95JT3 MEASY--KSESESEAWPGTQRPGTGTVSTAVREHLRKLCLREFPCGAGSWNKSRFLPQTWRTWRELVPKEEDVVSPGEETVEALLGLVRSPHSPWALLND 98

  Q8N309 SNAEDSFLRELAIRNPLTITDTFFYSYFRSLRVIDKKVTLVDKDLLKFLKLEELVLSANRIKEVDATNLPPTLKVLELYGNEISSMECLCAHPPAGLQHL 200
  Q95JT3 SNAEDSFLRELAIRNPLMITDTFFYSYFRSLRVVDKEVTLVDKDLLKFLKLEELVLSANRIKEVDATNLPPTLKVLELYGNEISSMECLCAHPPAGLQHL 198

  Q8N309 GLGHNKLLGPLESLYVTANHWPNLVSLDLGFNDLTDLQSMVTSLRTLRHLRLLVLQGNPLALVPYYRGLTIDSLAQLCVLDDITVSPNEKHLFRGLSLNG 300
  Q95JT3 GLGHNKLLGPLESLYVTADHWPNLVSLDLGFNDLTDLQSMVASLRTLRHLRLLVLQGNPLALVPYYRGLTIDSLAQLCVLDDITVSPNEKHLFRGLSLNG 298

  Q8N309 DLLAQEAQFVVTIGNIRGVLDTSVLDPEPRPEGPFITYNYYVTYDFVKDEEGEMNESAGVLAEIVKPSPSLELLVEESPEEVVEDVIEDIVEEVTEEVEG 400
  Q95JT3 DLLAQEAQFVVTIGNIRGVLDTSVLDPEPGPEGPFVAYSYYVTYDFVRDEEGEAVEDTGELAEIVKPSPSSELLVDESPEEVGEDVIKDIVGGVTEEVEG 398

  Q8N309 SLESEVEESGESELSVISGPSTILQMPRASAEELAKLRLRIDPRLCPSPGTVLFSTAHKPWAEVIPCSYEMQHSLRDLVPLKAFLLAGTTVTIVEEKILS 500
  Q95JT3 SLESEVEESGESELSVISGPSTVLQTPRASAEELAKLRLRIDPRLCPSPGTVLFNTTHKPWAEVIPCGYEMQHSLRDLVPLKAFLLAGTTVTIVEEKILS 498

  Q8N309 WPVVLPAVDSPLSAKKGKGEKDKKGKEKDRTGKGEKEPAKEWKVLKKKKEPPKELRQDPPILQVLGRGLVILEPLLAGEPLVSTVCNFGVVRTLTSDRLT 600
  Q95JT3 WPVVLPAVDSPLSAKRGKGEKDKKGKEKDRKGQGEKEPAKEWKVPKKKKELPKELRQDPPILQVLGRGLVILEPLLAGEPLVSTVCNFGMVRTLTSDRLT 598

  Q8N309 LARDSKKIKKVAKKEKPKAVIPIYEGDYHPEPLTVEVQIQLNQCRSAEEALRMFAV 656
  Q95JT3 LARDSKKIKKVAKKEKPKAVNPIYESDYHPEPLTVEVQIQLNQCRSAEEALRMFAV 654

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0098978 glutamatergic synapse
1. PB GO:0035082 axoneme assembly
1. PB GO:0044300 cerebellar mossy fiber
1. PB GO:0099560 synaptic membrane adhesion
1. PB GO:0005114 type II transforming growth factor beta receptor binding
1. PB GO:0034713 type I transforming growth factor beta receptor binding
1. PB GO:0003341 cilium movement
1. PB GO:0003305 cell migration involved in heart jogging
1. PB GO:0003314 heart rudiment morphogenesis
1. PB GO:0070286 axonemal dynein complex assembly
1. PB GO:0003143 embryonic heart tube morphogenesis
1. PB GO:0071910 determination of liver left/right asymmetry
1. PB GO:0042661 regulation of mesodermal cell fate specification
1. PB GO:0036158 outer dynein arm assembly
1. PB GO:0030324 lung development
1. PB GO:0010378 temperature compensation of the circadian clock
1. PB GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
1. PB GO:0060271 cilium assembly
1. PB GO:0001947 heart looping
1. PB GO:0031514 motile cilium
1. PB GO:0070840 dynein complex binding
1. PB GO:0060285 cilium-dependent cell motility
1. PB GO:0051965 positive regulation of synapse assembly
1. PB GO:0060972 left/right pattern formation
1. PB GO:0043069 negative regulation of programmed cell death
1. PB GO:0120229 protein localization to motile cilium
1. PB GO:0003356 regulation of cilium beat frequency
1. PB GO:0045433 male courtship behavior, veined wing generated song production
1. PB GO:0005813 centrosome
1. PB GO:0002177 manchette
1. PB GO:0036159 inner dynein arm assembly
1. PB GO:0071907 determination of digestive tract left/right asymmetry
1. PB GO:0031012 extracellular matrix
1. PB GO:0099151 regulation of postsynaptic density assembly
1. PB GO:0044458 motile cilium assembly
1. PB GO:0051649 establishment of localization in cell
1. PB GO:0005929 cilium
1. PB GO:0005930 axoneme
1. PB GO:0035469 determination of pancreatic left/right asymmetry
1. PB GO:0042734 presynaptic membrane
1. PB GO:0003146 heart jogging
1. PB GO:0005615 extracellular space
1. PB GO:0099061 integral component of postsynaptic density membrane
2. P GO:0003345 proepicardium cell migration involved in pericardium morphogenesis
2. P GO:0050772 positive regulation of axonogenesis
2. P GO:0016973 poly(A)+ mRNA export from nucleus
2. P GO:0016055 Wnt signaling pathway
2. P GO:0032922 circadian regulation of gene expression
2. P GO:0007156 homophilic cell adhesion via plasma membrane adhesion molecules
2. P GO:0005643 nuclear pore
2. P GO:2001013 epithelial cell proliferation involved in renal tubule morphogenesis
2. P GO:0005686 U2 snRNP
2. P GO:0002718 regulation of cytokine production involved in immune response
2. P GO:0030539 male genitalia development
2. P GO:0007409 axonogenesis
2. P GO:0090263 positive regulation of canonical Wnt signaling pathway
2. P GO:0051168 nuclear export
2. P GO:0000389 mRNA 3'-splice site recognition
2. P GO:0030623 U5 snRNA binding
2. P GO:0015459 potassium channel regulator activity
2. P GO:0007021 tubulin complex assembly
2. P GO:0099054 presynapse assembly
2. P GO:0007190 activation of adenylate cyclase activity
2. P GO:0008543 fibroblast growth factor receptor signaling pathway
2. P GO:0004864 protein phosphatase inhibitor activity
2. P GO:0016500 protein-hormone receptor activity
2. P GO:1904861 excitatory synapse assembly
2. P GO:0042127 regulation of cell population proliferation
2. P GO:0048495 Roundabout binding
2. P GO:0030620 U2 snRNA binding
2. P GO:0008330 protein tyrosine/threonine phosphatase activity
2. P GO:0046849 bone remodeling
2. P GO:1990030 pericellular basket
2. P GO:0001942 hair follicle development
2. P GO:0051270 regulation of cellular component movement
2. P GO:0044309 neuron spine
2. P GO:0050808 synapse organization
2. P GO:0050919 negative chemotaxis
2. P GO:0072282 metanephric nephron tubule morphogenesis
2. P GO:1901381 positive regulation of potassium ion transmembrane transport
2. P GO:0090630 activation of GTPase activity
2. P GO:0007416 synapse assembly
2. P GO:0007157 heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
2. P GO:0005524 ATP binding
2. P GO:0007420 brain development
2. P GO:0052083 suppression by symbiont of host cell-mediated immune response
2. P GO:0001750 photoreceptor outer segment
2. P GO:0046822 regulation of nucleocytoplasmic transport
2. P GO:0106030 neuron projection fasciculation
2. P GO:0008076 voltage-gated potassium channel complex
2. P GO:1990723 cytoplasmic periphery of the nuclear pore complex
2. P GO:1990523 bone regeneration
2. P GO:0097113 AMPA glutamate receptor clustering
2. P GO:0007283 spermatogenesis
2. P GO:2000405 negative regulation of T cell migration
2. P GO:0004385 guanylate kinase activity
2. P GO:0034055 effector-mediated induction of programmed cell death in host
2. P GO:0016235 aggresome
2. P GO:0097060 synaptic membrane
2. P GO:0098742 cell-cell adhesion via plasma-membrane adhesion molecules
2. P GO:0071005 U2-type precatalytic spliceosome
2. P GO:1990869 cellular response to chemokine
2. P GO:0009755 hormone-mediated signaling pathway
2. P GO:0030030 cell projection organization
2. P GO:0001649 osteoblast differentiation
2. P GO:0048565 digestive tract development
2. P GO:0045087 innate immune response
2. P GO:0071013 catalytic step 2 spliceosome
2. P GO:0040022 feminization of hermaphroditic germ-line
2. P GO:0120163 negative regulation of cold-induced thermogenesis
2. P GO:0005856 cytoskeleton
2. P GO:0032588 trans-Golgi network membrane
2. P GO:1905232 cellular response to L-glutamate
2. P GO:0030282 bone mineralization
2. P GO:0051729 germline cell cycle switching, mitotic to meiotic cell cycle
2. P GO:0097119 postsynaptic density protein 95 clustering
2. P GO:0044074 negative regulation by symbiont of host translation
2. P GO:0048839 inner ear development
2. P GO:0007411 axon guidance
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0005096 GTPase activator activity
2. P GO:0034122 negative regulation of toll-like receptor signaling pathway
2. P GO:0030177 positive regulation of Wnt signaling pathway
2. P GO:1902004 positive regulation of amyloid-beta formation
2. P GO:0048598 embryonic morphogenesis
2. P GO:0048678 response to axon injury
2. P GO:1990138 neuron projection extension
2. P GO:0007023 post-chaperonin tubulin folding pathway
2. P GO:0044295 axonal growth cone
2. P GO:0005887 integral component of plasma membrane
2. P GO:1903818 positive regulation of voltage-gated potassium channel activity
2. P GO:0032281 AMPA glutamate receptor complex
2. P GO:0010165 response to X-ray
2. P GO:2000155 positive regulation of cilium-dependent cell motility
2. P GO:0032185 septin cytoskeleton organization
2. P GO:0044614 nuclear pore cytoplasmic filaments
2. P GO:0030425 dendrite
2. P GO:0090190 positive regulation of branching involved in ureteric bud morphogenesis
2. P GO:0097733 photoreceptor cell cilium
2. P GO:0008201 heparin binding
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0036064 ciliary basal body
2. P GO:0072578 neurotransmitter-gated ion channel clustering
2. P GO:0099055 integral component of postsynaptic membrane
2. P GO:0016604 nuclear body
2. P GO:0046826 negative regulation of protein export from nucleus
2. P GO:0007010 cytoskeleton organization
2. P GO:0001530 lipopolysaccharide binding
2. P GO:0072202 cell differentiation involved in metanephros development
2. P GO:0043395 heparan sulfate proteoglycan binding
2. P GO:0032584 growth cone membrane
2. P GO:0043204 perikaryon
2. P GO:0072224 metanephric glomerulus development
2. P GO:0005681 spliceosomal complex
2. P GO:0042272 nuclear RNA export factor complex
2. P GO:0043014 alpha-tubulin binding
2. P GO:0009994 oocyte differentiation
2. P GO:0043679 axon terminus
2. P GO:0060322 head development
2. P GO:0000398 mRNA splicing, via spliceosome
2. P GO:0051963 regulation of synapse assembly
2. P GO:0008528 G protein-coupled peptide receptor activity
2. P GO:0005814 centriole
2. P GO:0046696 lipopolysaccharide receptor complex
2. P GO:0005104 fibroblast growth factor receptor binding
2. P GO:0052170 suppression by symbiont of host innate immune response
2. P GO:0042769 obsolete DNA damage response, detection of DNA damage
2. P GO:0032391 photoreceptor connecting cilium
2. P GO:1904115 axon cytoplasm
2. P GO:0030532 small nuclear ribonucleoprotein complex
2. P GO:0071007 U2-type catalytic step 2 spliceosome
2. P GO:0045499 chemorepellent activity
2. P GO:1901629 regulation of presynaptic membrane organization
2. P GO:0061290 canonical Wnt signaling pathway involved in metanephric kidney development
2. P GO:0007186 G protein-coupled receptor signaling pathway
2. P GO:0032809 neuronal cell body membrane
2. P GO:0034260 negative regulation of GTPase activity
2. P GO:0007413 axonal fasciculation
2. P GO:0030621 U4 snRNA binding
2. P GO:0042552 myelination
2. P GO:0050673 epithelial cell proliferation
2. P GO:0001669 acrosomal vesicle
2. P GO:0001818 negative regulation of cytokine production
2. P GO:0007224 smoothened signaling pathway
2. P GO:0016607 nuclear speck
2. P GO:0004888 transmembrane signaling receptor activity
2. P GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
2. P GO:0015631 tubulin binding
2. P GO:0000776 kinetochore
2. P GO:0044782 cilium organization
2. P GO:0036335 intestinal stem cell homeostasis
2. P GO:0045211 postsynaptic membrane
2. P GO:1904117 cellular response to vasopressin
2. P GO:0035239 tube morphogenesis
2. P GO:0010976 positive regulation of neuron projection development
2. P GO:0005654 nucleoplasm
3. B GO:0048132 female germ-line stem cell asymmetric division
3. B GO:0030511 positive regulation of transforming growth factor beta receptor signaling pathway
3. B GO:0005815 microtubule organizing center
3. B GO:0090651 apical cytoplasm
3. B GO:0043393 regulation of protein binding
3. B GO:0030336 negative regulation of cell migration
3. B GO:0007527 adult somatic muscle development
3. B GO:0030239 myofibril assembly
3. B GO:0008584 male gonad development
3. B GO:0035904 aorta development
3. B GO:0061512 protein localization to cilium
3. B GO:0060027 convergent extension involved in gastrulation
3. B GO:0008217 regulation of blood pressure
3. B GO:0010004 gastrulation involving germ band extension
3. B GO:0005769 early endosome
3. B GO:0019901 protein kinase binding
3. B GO:0003351 epithelial cilium movement involved in extracellular fluid movement
3. B GO:0030036 actin cytoskeleton organization
3. B GO:0048793 pronephros development
3. B GO:0017151 DEAD/H-box RNA helicase binding
3. B GO:0001822 kidney development
3. B GO:0005102 signaling receptor binding
3. B GO:0003279 cardiac septum development
3. B GO:0061458 reproductive system development
3. B GO:0072687 meiotic spindle
3. B GO:0055037 recycling endosome
3. B GO:0090660 cerebrospinal fluid circulation
3. B GO:0035091 phosphatidylinositol binding
3. B GO:0004016 adenylate cyclase activity
3. B GO:0061975 articular cartilage development
3. B GO:0045171 intercellular bridge
3. B GO:0030317 flagellated sperm motility
3. B GO:0030254 protein secretion by the type III secretion system
3. B GO:0016601 Rac protein signal transduction
3. B GO:0006006 glucose metabolic process
3. B GO:0006915 apoptotic process
3. B GO:0007605 sensory perception of sound
3. B GO:0005178 integrin binding
3. B GO:0044165 host cell endoplasmic reticulum
3. B GO:0031430 M band
3. B GO:0015630 microtubule cytoskeleton
3. B GO:0061371 determination of heart left/right asymmetry
3. B GO:0005829 cytosol
3. B GO:1905606 regulation of presynapse assembly
3. B GO:0090619 meiotic spindle pole
3. B GO:0051014 actin filament severing
3. B GO:0018996 molting cycle, collagen and cuticulin-based cuticle
3. B GO:0051493 regulation of cytoskeleton organization
3. B GO:0045202 synapse
3. B GO:0008092 cytoskeletal protein binding
3. B GO:0090543 Flemming body
3. B GO:0120103 centriolar subdistal appendage
3. B GO:0120293 dynein axonemal particle
3. B GO:0060976 coronary vasculature development
3. B GO:0048243 norepinephrine secretion
3. B GO:0032228 regulation of synaptic transmission, GABAergic
3. B GO:0097431 mitotic spindle pole
3. B GO:0003281 ventricular septum development
3. B GO:0007268 chemical synaptic transmission
3. B GO:0006171 cAMP biosynthetic process
3. B GO:0004722 protein serine/threonine phosphatase activity
3. B GO:0008154 actin polymerization or depolymerization

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q965M2 Leucine-rich repeats and immunoglobulin-like domains protein sma-10 2.08e-01 1.36e-02 0.010
1. PB Q91YK0 Leucine-rich repeat-containing protein 49 1.37e-02 1.10e-09 4.95e-05
1. PB A8IVX2 Dynein regulatory complex subunit 3 2.08e-04 3.24e-08 7.41e-04
1. PB B6D5P6 Dynein axonemal assembly factor 1 4.68e-03 2.25e-22 1.74e-05
1. PB Q8N309 Leucine-rich repeat-containing protein 43 0 1.09e-155 0.0
1. PB Q3V0L5 Leucine-rich repeat-containing protein 43 6.33e-15 6.96e-80 0.0
1. PB A6H759 Leucine-rich repeat-containing protein 72 7.11e-03 5.74e-03 0.009
1. PB Q95JT3 Leucine-rich repeat-containing protein 43 0.00e+00 1.67e-107 0.0
1. PB B6D5P1 Dynein axonemal assembly factor 1 4.91e-03 1.32e-21 1.63e-04
1. PB A6NJI9 Leucine-rich repeat-containing protein 72 1.06e-03 9.12e-04 0.011
1. PB P0CC10 Leucine-rich repeat-containing protein 4B 1.11e-01 4.82e-02 0.028
1. PB Q7ZV84 Dynein axonemal assembly factor 1 4.94e-03 6.33e-20 3.09e-07
1. PB Q9D2H9 Dynein axonemal assembly factor 1 1.31e-03 9.11e-21 4.80e-04
1. PB Q8IUZ0 Leucine-rich repeat-containing protein 49 3.79e-02 4.42e-10 9.59e-05
1. PB Q9D5S7 Leucine-rich repeat and guanylate kinase domain-containing protein 8.22e-02 9.12e-04 0.018
1. PB B6D5P3 Dynein axonemal assembly factor 1 3.09e-03 1.65e-20 1.64e-04
1. PB Q3SYS4 Dynein axonemal assembly factor 1 1.97e-03 6.58e-20 1.11e-04
1. PB Q80ZD9 Amphoterin-induced protein 2 3.66e-02 1.13e-02 0.024
1. PB Q9VR52 Protein tilB 1.10e-02 1.69e-02 1.91e-06
1. PB Q8NEP3 Dynein axonemal assembly factor 1 7.22e-02 1.87e-21 2.53e-04
2. P Q95LL2 X-ray radiation resistance-associated protein 1 (Fragment) 1.85e-01 2.96e-02 NA
2. P Q8IYG6 Leucine-rich repeat-containing protein 56 2.50e-02 2.95e-12 NA
2. P Q6IRU7 Centrosomal protein of 78 kDa 3.07e-01 2.85e-04 NA
2. P Q99PH1 Leucine-rich repeat-containing protein 4 2.42e-02 3.04e-02 NA
2. P Q6FV04 U2 small nuclear ribonucleoprotein A' 6.67e-04 1.29e-03 NA
2. P A8Y3R9 Protein phosphatase 1 regulatory subunit 37 homolog 2.64e-01 3.81e-08 NA
2. P Q7TNJ4 Amphoterin-induced protein 2 4.49e-01 3.07e-02 NA
2. P Q387Y5 Leucine-rich repeat-containing protein 56 homolog 1.27e-01 1.27e-10 NA
2. P Q8BGT1 Leucine-rich repeat transmembrane protein FLRT3 4.06e-02 2.70e-02 NA
2. P Q9VFH6 Protein Cep78 homolog 2.45e-01 1.62e-03 NA
2. P Q4P5F9 U2 small nuclear ribonucleoprotein A' 2.57e-04 1.93e-02 NA
2. P B2RYF1 Protein phosphatase 1 regulatory subunit 37 4.37e-02 4.77e-02 NA
2. P O75427 Leucine-rich repeat and calponin homology domain-containing protein 4 4.05e-02 2.76e-05 NA
2. P Q5VUJ6 Leucine-rich repeat and calponin homology domain-containing protein 2 3.69e-03 8.91e-07 NA
2. P Q4R747 Leucine-rich repeat-containing protein 46 1.02e-02 2.26e-05 NA
2. P Q5QJ74 Tubulin-specific chaperone cofactor E-like protein 2.19e-02 2.26e-05 NA
2. P Q6K7R2 Plant intracellular Ras-group-related LRR protein 6 9.78e-03 1.04e-02 NA
2. P Q3UMG5 Leucine-rich repeat and calponin homology domain-containing protein 2 1.65e-01 2.07e-07 NA
2. P Q80YS5 Leucine-rich repeat-containing protein 27 2.26e-01 1.27e-05 NA
2. P Q8K375 Leucine-rich repeat-containing protein 56 2.19e-02 2.14e-19 NA
2. P B0BLW3 Leucine-rich repeat-containing G-protein coupled receptor 4 3.60e-01 2.35e-02 NA
2. P B1H234 Leucine-rich repeat transmembrane protein FLRT3 2.38e-02 1.69e-02 NA
2. P Q80ZD7 Amphoterin-induced protein 1 5.54e-01 3.37e-03 NA
2. P Q5XI54 Dynein regulatory complex subunit 3 3.70e-05 5.98e-09 NA
2. P Q86WK6 Amphoterin-induced protein 1 1.07e-01 1.60e-03 NA
2. P Q9Z1P4 Leucine-rich repeat-containing G-protein coupled receptor 5 1.74e-01 2.62e-03 NA
2. P Q9NJE9 Dynein axonemal assembly factor 11 6.37e-04 3.91e-03 NA
2. P Q55CS7 MAP kinase phosphatase with leucine-rich repeats protein 1 4.39e-02 3.20e-03 NA
2. P P90920 Leucine-rich repeat-containing protein egg-6 9.77e-02 9.37e-07 NA
2. P D3ZAL8 Leucine-rich repeat transmembrane neuronal protein 3 3.25e-02 3.10e-03 NA
2. P Q8C5W3 Tubulin-specific chaperone cofactor E-like protein 3.61e-03 1.25e-05 NA
2. P P46061 Ran GTPase-activating protein 1 5.46e-02 6.79e-04 NA
2. P Q9VIW3 Ran GTPase-activating protein 4.63e-02 5.35e-05 NA
2. P Q960C5 Leucine-rich repeat and calponin homology domain-containing protein 6.75e-02 6.37e-05 NA
2. P Q5Y2C3 Histone H2A.Y 1.36e-02 4.23e-06 NA
2. P P09661 U2 small nuclear ribonucleoprotein A' 2.82e-03 7.50e-05 NA
2. P Q19857 Protein phosphatase 1 regulatory subunit 37 homolog 1.57e-01 9.89e-11 NA
2. P Q6AYH9 Dynein axonemal assembly factor 1 1.00e-03 2.86e-24 NA
2. P F1MLX5 Leucine-rich repeat-containing G-protein coupled receptor 4 3.55e-01 7.51e-03 NA
2. P Q86VH5 Leucine-rich repeat transmembrane neuronal protein 3 1.15e-01 6.37e-03 NA
2. P Q4R803 Protein phosphatase 1 regulatory subunit 42 2.71e-03 2.97e-03 NA
2. P Q5PPX0 Protein phosphatase 1 regulatory subunit 42 1.78e-04 2.26e-02 NA
2. P Q8ND23 Capping protein, Arp2/3 and myosin-I linker protein 3 7.79e-01 3.74e-02 NA
2. P Q9Y2L9 Leucine-rich repeat and calponin homology domain-containing protein 1 4.46e-02 9.33e-04 NA
2. P Q8BVU0 DISP complex protein LRCH3 1.74e-02 1.08e-06 NA
2. P P34390 Uncharacterized protein F09G8.5 3.26e-03 1.17e-02 NA
2. P O75473 Leucine-rich repeat-containing G-protein coupled receptor 5 2.70e-01 7.33e-04 NA
2. P Q96M69 Leucine-rich repeat and guanylate kinase domain-containing protein 3.10e-02 2.01e-03 NA
2. P Q5R7M3 Amphoterin-induced protein 2 2.85e-01 1.66e-02 NA
2. P Q06479 F-box protein YLR352W 4.00e-01 5.82e-04 NA
2. P Q80ZD8 Amphoterin-induced protein 1 1.71e-02 1.33e-03 NA
2. P Q9BXB1 Leucine-rich repeat-containing G-protein coupled receptor 4 2.12e-01 2.55e-02 NA
2. P E5DHB5 Leucine-rich repeat-containing G-protein coupled receptor 5A 2.87e-01 1.80e-03 NA
2. P Q505F5 Leucine-rich repeat-containing protein 47 1.32e-01 1.86e-09 NA
2. P P18009 Probable E3 ubiquitin-protein ligase ipaH4.5 2.20e-01 1.07e-04 NA
2. P A2ARI4 Leucine-rich repeat-containing G-protein coupled receptor 4 2.12e-01 2.87e-02 NA
2. P Q9C0I9 Leucine-rich repeat-containing protein 27 1.29e-01 3.41e-04 NA
2. P Q9DAP0 Leucine-rich repeat-containing protein 46 5.38e-03 9.61e-06 NA
2. P P43333 U2 small nuclear ribonucleoprotein A' 1.88e-04 4.20e-03 NA
2. P Q9XVS8 Nuclear RNA export factor 2 4.00e-01 8.09e-04 NA
2. P P18014 Probable E3 ubiquitin-protein ligase ipaH7.8 1.25e-01 3.60e-02 NA
2. P Q7S9P4 U2 small nuclear ribonucleoprotein A' 3.75e-04 2.54e-03 NA
2. P Q8BZ81 Leucine-rich repeat transmembrane neuronal protein 3 3.01e-02 2.94e-03 NA
2. P Q4R6X9 Dynein regulatory complex subunit 3 3.17e-05 1.44e-09 NA
2. P A7Z026 Protein phosphatase 1 regulatory subunit 37 5.53e-02 2.01e-02 NA
2. P P62046 Leucine-rich repeat and calponin homology domain-containing protein 1 2.88e-02 5.07e-07 NA
2. P Q7L0X0 TLR4 interactor with leucine rich repeats 4.14e-02 1.84e-03 NA
2. P F1MT22 Leucine-rich repeat-containing G-protein coupled receptor 5 8.54e-02 2.38e-03 NA
2. P Q9BLB6 Probable U2 small nuclear ribonucleoprotein A' 8.34e-06 6.30e-05 NA
2. P Q8N1G4 Leucine-rich repeat-containing protein 47 8.20e-02 1.45e-10 NA
2. P Q86SJ2 Amphoterin-induced protein 2 4.53e-02 3.14e-02 NA
2. P Q4WV66 U2 small nuclear ribonucleoprotein A' 2.42e-04 2.51e-03 NA
2. P P57784 U2 small nuclear ribonucleoprotein A' 1.00e-03 8.23e-05 NA
2. P Q9V4Q8 Probable U2 small nuclear ribonucleoprotein A' 8.94e-06 6.12e-06 NA
2. P Q80XG9 Leucine-rich repeat transmembrane neuronal protein 4 2.02e-02 8.73e-04 NA
2. P Q9DBY4 TLR4 interactor with leucine rich repeats 2.19e-01 1.41e-03 NA
2. P Q3U3V8 X-ray radiation resistance-associated protein 1 1.79e-01 8.60e-21 NA
2. P Q6AXZ2 Leucine-rich repeat-containing protein 46 7.63e-03 3.62e-07 NA
2. P Q921G6 Leucine-rich repeat and calponin homology domain-containing protein 4 1.85e-02 2.03e-06 NA
2. P P46060 Ran GTPase-activating protein 1 4.43e-02 5.88e-04 NA
2. P Q6PGX3 Leucine-rich repeat and fibronectin type III domain-containing protein 1 6.44e-02 1.17e-02 NA
2. P F7D3V9 Leucine-rich repeat-containing G-protein coupled receptor 5 1.55e-01 8.64e-04 NA
2. P O13066 Ran GTPase-activating protein 1 9.25e-02 2.03e-03 NA
2. P Q4V8C9 Leucine-rich repeat-containing protein 56 9.51e-03 4.07e-15 NA
2. P Q09JZ4 Leucine-rich repeat-containing protein ODA7 1.94e-03 2.92e-09 NA
2. P Q8BKR5 Protein phosphatase 1 regulatory subunit 37 1.63e-01 2.03e-02 NA
2. P O43822 Cilia- and flagella-associated protein 410 1.73e-03 2.57e-06 NA
2. P Q5JTW2 Centrosomal protein of 78 kDa 4.14e-01 1.49e-03 NA
2. P Q2T9T5 Leucine-rich repeat-containing protein 61 1.00e-02 1.80e-04 NA
2. P Q96FV0 Leucine-rich repeat-containing protein 46 3.47e-03 8.94e-09 NA
2. P Q3UVD5 Leucine-rich repeat-containing G-protein coupled receptor 6 2.22e-01 2.96e-02 NA
2. P Q496Z2 TLR4 interactor with leucine rich repeats 4.18e-02 1.21e-03 NA
2. P Q9HBX8 Leucine-rich repeat-containing G-protein coupled receptor 6 2.42e-01 1.85e-02 NA
2. P D4AC13 Leucine-rich repeat-containing G-protein coupled receptor 5 9.88e-02 6.24e-03 NA
2. P Q9Z2H4 Leucine-rich repeat-containing G-protein coupled receptor 4 2.93e-01 3.23e-02 NA
2. P Q9D5E4 Dynein regulatory complex subunit 3 3.65e-05 3.37e-09 NA
2. P P0DM44 Leucine-rich repeat-containing G-protein coupled receptor 6 8.49e-01 2.52e-04 NA
2. P Q4R8Y8 U2 small nuclear ribonucleoprotein A' 8.29e-04 7.50e-05 NA
2. P Q9H069 Dynein regulatory complex subunit 3 3.19e-05 2.14e-09 NA
2. P Q5PQJ7 Tubulin-specific chaperone cofactor E-like protein 3.25e-03 1.84e-05 NA
2. P Q8C6G1 Cilia- and flagella-associated protein 410 2.67e-03 7.59e-05 NA
2. P B4F7C5 Leucine-rich repeat transmembrane neuronal protein 4 1.85e-02 1.38e-03 NA
2. P Q96II8 DISP complex protein LRCH3 6.79e-02 3.30e-05 NA
2. P Q6P2D8 X-ray radiation resistance-associated protein 1 3.29e-02 2.55e-21 NA
2. P Q9BGP6 Leucine-rich repeat transmembrane neuronal protein 3 1.36e-02 6.37e-03 NA
2. P Q99257 mRNA export factor MEX67 1.57e-01 3.74e-02 NA
2. P O75325 Leucine-rich repeat neuronal protein 2 1.82e-01 5.12e-03 NA
2. P Q86VH4 Leucine-rich repeat transmembrane neuronal protein 4 2.49e-02 2.70e-03 NA
3. B Q8ZQQ2 E3 ubiquitin-protein ligase SlrP 6.32e-02 NA 0.019
3. B Q1RMR5 Dynein axonemal assembly factor 11 1.34e-02 NA 0.018
3. B A2AL36 Centriolin 5.19e-01 NA 0.008
3. B Q0P5X1 Leucine-rich repeat and IQ domain-containing protein 1 2.55e-01 NA 0.039
3. B B3NLX1 Dynein axonemal assembly factor 1 homolog 1.71e-01 NA 0.002
3. B Q9NT99 Leucine-rich repeat-containing protein 4B 1.89e-01 NA 0.040
3. B Q32Q07 Leucine-rich repeat neuronal protein 1 3.70e-02 NA 5.60e-04
3. B Q6IRN0 Serine/threonine-protein kinase 11-interacting protein 4.68e-02 NA 5.50e-08
3. B O88978 Dynein axonemal assembly factor 11 3.80e-02 NA 0.017
3. B Q24020 Protein flightless-1 3.02e-01 NA 0.004
3. B Q9U3A0 P-granule-associated novel protein 1 2.15e-02 NA 0.021
3. B Q6ZRR7 Leucine-rich repeat-containing protein 9 7.17e-02 NA 0.026
3. B A0N0X6 Leucine-rich repeat neuronal protein 1 1.10e-01 NA 0.002
3. B Q9C8M9 Protein STRUBBELIG-RECEPTOR FAMILY 6 5.65e-02 NA 1.11e-04
3. B Q9VJ07 Protein phosphatase PHLPP-like protein 3.82e-01 NA 0.007
3. B Q4G017 Nischarin 1.65e-01 NA 0.016
3. B Q61809 Leucine-rich repeat neuronal protein 1 7.72e-02 NA 4.29e-04
3. B Q96JM4 Leucine-rich repeat and IQ domain-containing protein 1 6.06e-01 NA 0.031
3. B A0A1L8G016 Dynein axonemal assembly factor 11 3.58e-02 NA 0.042
3. B Q69ZB0 Leucine-rich repeat and coiled-coil domain-containing protein 1 1.17e-01 NA 7.41e-04
3. B P0C7U0 Protein ELFN1 3.09e-02 NA 0.002
3. B Q80TM9 Nischarin 8.91e-02 NA 0.006
3. B Q3ZC49 Leucine-rich repeat-containing protein 39 1.06e-02 NA 0.007
3. B Q6P3Y9 Podocan-like protein 1 6.67e-02 NA 0.017
3. B Q86X45 Dynein axonemal assembly factor 11 1.63e-02 NA 0.001
3. B Q7Z7A1 Centriolin 7.19e-01 NA 0.024
3. B Q01513 Adenylate cyclase 8.12e-01 NA 0.050
3. B Q6P4K6 Serine/threonine-protein kinase 11-interacting protein 1.45e-01 NA 2.74e-07
3. B Q8INT5 Dynein axonemal assembly factor 1 homolog 7.77e-02 NA 0.001
3. B B4P6W7 Dynein axonemal assembly factor 1 homolog 4.35e-01 NA 0.001
3. B Q8L899 Systemin receptor SR160 5.18e-01 NA 0.029
3. B Q4R3F0 Protein tilB homolog 1.36e-02 NA 2.16e-04
3. B Q90944 Epiphycan 4.07e-02 NA 0.033
3. B Q6UXK5 Leucine-rich repeat neuronal protein 1 7.70e-02 NA 0.003
3. B Q9Y2I1 Nischarin 9.24e-02 NA 0.005
3. B P0C192 Leucine-rich repeat-containing protein 4B 7.32e-02 NA 0.030