Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q95JT3
(Leucine-rich repeat-containing protein 43) with a FATCAT P-Value: 0.0 and RMSD of 2.21 angstrom. The sequence alignment identity is 93.6%.
Structural alignment shown in left. Query protein Q8N309 colored as red in alignment, homolog Q95JT3 colored as blue.
Query protein Q8N309 is also shown in right top, homolog Q95JT3 showed in right bottom. They are colored based on secondary structures.
Q8N309 MEASYESESESESEAGPGTQRPGTGTVSAAVREHLRKLCLREFPCGAGSWNKSRFLPQTWRTWRELVPREEDVVSPGEETVEALLGLVRSRHSPWALLNN 100 Q95JT3 MEASY--KSESESEAWPGTQRPGTGTVSTAVREHLRKLCLREFPCGAGSWNKSRFLPQTWRTWRELVPKEEDVVSPGEETVEALLGLVRSPHSPWALLND 98 Q8N309 SNAEDSFLRELAIRNPLTITDTFFYSYFRSLRVIDKKVTLVDKDLLKFLKLEELVLSANRIKEVDATNLPPTLKVLELYGNEISSMECLCAHPPAGLQHL 200 Q95JT3 SNAEDSFLRELAIRNPLMITDTFFYSYFRSLRVVDKEVTLVDKDLLKFLKLEELVLSANRIKEVDATNLPPTLKVLELYGNEISSMECLCAHPPAGLQHL 198 Q8N309 GLGHNKLLGPLESLYVTANHWPNLVSLDLGFNDLTDLQSMVTSLRTLRHLRLLVLQGNPLALVPYYRGLTIDSLAQLCVLDDITVSPNEKHLFRGLSLNG 300 Q95JT3 GLGHNKLLGPLESLYVTADHWPNLVSLDLGFNDLTDLQSMVASLRTLRHLRLLVLQGNPLALVPYYRGLTIDSLAQLCVLDDITVSPNEKHLFRGLSLNG 298 Q8N309 DLLAQEAQFVVTIGNIRGVLDTSVLDPEPRPEGPFITYNYYVTYDFVKDEEGEMNESAGVLAEIVKPSPSLELLVEESPEEVVEDVIEDIVEEVTEEVEG 400 Q95JT3 DLLAQEAQFVVTIGNIRGVLDTSVLDPEPGPEGPFVAYSYYVTYDFVRDEEGEAVEDTGELAEIVKPSPSSELLVDESPEEVGEDVIKDIVGGVTEEVEG 398 Q8N309 SLESEVEESGESELSVISGPSTILQMPRASAEELAKLRLRIDPRLCPSPGTVLFSTAHKPWAEVIPCSYEMQHSLRDLVPLKAFLLAGTTVTIVEEKILS 500 Q95JT3 SLESEVEESGESELSVISGPSTVLQTPRASAEELAKLRLRIDPRLCPSPGTVLFNTTHKPWAEVIPCGYEMQHSLRDLVPLKAFLLAGTTVTIVEEKILS 498 Q8N309 WPVVLPAVDSPLSAKKGKGEKDKKGKEKDRTGKGEKEPAKEWKVLKKKKEPPKELRQDPPILQVLGRGLVILEPLLAGEPLVSTVCNFGVVRTLTSDRLT 600 Q95JT3 WPVVLPAVDSPLSAKRGKGEKDKKGKEKDRKGQGEKEPAKEWKVPKKKKELPKELRQDPPILQVLGRGLVILEPLLAGEPLVSTVCNFGMVRTLTSDRLT 598 Q8N309 LARDSKKIKKVAKKEKPKAVIPIYEGDYHPEPLTVEVQIQLNQCRSAEEALRMFAV 656 Q95JT3 LARDSKKIKKVAKKEKPKAVNPIYESDYHPEPLTVEVQIQLNQCRSAEEALRMFAV 654
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0098978 | glutamatergic synapse |
| 1. PB | GO:0035082 | axoneme assembly |
| 1. PB | GO:0044300 | cerebellar mossy fiber |
| 1. PB | GO:0099560 | synaptic membrane adhesion |
| 1. PB | GO:0005114 | type II transforming growth factor beta receptor binding |
| 1. PB | GO:0034713 | type I transforming growth factor beta receptor binding |
| 1. PB | GO:0003341 | cilium movement |
| 1. PB | GO:0003305 | cell migration involved in heart jogging |
| 1. PB | GO:0003314 | heart rudiment morphogenesis |
| 1. PB | GO:0070286 | axonemal dynein complex assembly |
| 1. PB | GO:0003143 | embryonic heart tube morphogenesis |
| 1. PB | GO:0071910 | determination of liver left/right asymmetry |
| 1. PB | GO:0042661 | regulation of mesodermal cell fate specification |
| 1. PB | GO:0036158 | outer dynein arm assembly |
| 1. PB | GO:0030324 | lung development |
| 1. PB | GO:0010378 | temperature compensation of the circadian clock |
| 1. PB | GO:0060287 | epithelial cilium movement involved in determination of left/right asymmetry |
| 1. PB | GO:0060271 | cilium assembly |
| 1. PB | GO:0001947 | heart looping |
| 1. PB | GO:0031514 | motile cilium |
| 1. PB | GO:0070840 | dynein complex binding |
| 1. PB | GO:0060285 | cilium-dependent cell motility |
| 1. PB | GO:0051965 | positive regulation of synapse assembly |
| 1. PB | GO:0060972 | left/right pattern formation |
| 1. PB | GO:0043069 | negative regulation of programmed cell death |
| 1. PB | GO:0120229 | protein localization to motile cilium |
| 1. PB | GO:0003356 | regulation of cilium beat frequency |
| 1. PB | GO:0045433 | male courtship behavior, veined wing generated song production |
| 1. PB | GO:0005813 | centrosome |
| 1. PB | GO:0002177 | manchette |
| 1. PB | GO:0036159 | inner dynein arm assembly |
| 1. PB | GO:0071907 | determination of digestive tract left/right asymmetry |
| 1. PB | GO:0031012 | extracellular matrix |
| 1. PB | GO:0099151 | regulation of postsynaptic density assembly |
| 1. PB | GO:0044458 | motile cilium assembly |
| 1. PB | GO:0051649 | establishment of localization in cell |
| 1. PB | GO:0005929 | cilium |
| 1. PB | GO:0005930 | axoneme |
| 1. PB | GO:0035469 | determination of pancreatic left/right asymmetry |
| 1. PB | GO:0042734 | presynaptic membrane |
| 1. PB | GO:0003146 | heart jogging |
| 1. PB | GO:0005615 | extracellular space |
| 1. PB | GO:0099061 | integral component of postsynaptic density membrane |
| 2. P | GO:0003345 | proepicardium cell migration involved in pericardium morphogenesis |
| 2. P | GO:0050772 | positive regulation of axonogenesis |
| 2. P | GO:0016973 | poly(A)+ mRNA export from nucleus |
| 2. P | GO:0016055 | Wnt signaling pathway |
| 2. P | GO:0032922 | circadian regulation of gene expression |
| 2. P | GO:0007156 | homophilic cell adhesion via plasma membrane adhesion molecules |
| 2. P | GO:0005643 | nuclear pore |
| 2. P | GO:2001013 | epithelial cell proliferation involved in renal tubule morphogenesis |
| 2. P | GO:0005686 | U2 snRNP |
| 2. P | GO:0002718 | regulation of cytokine production involved in immune response |
| 2. P | GO:0030539 | male genitalia development |
| 2. P | GO:0007409 | axonogenesis |
| 2. P | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 2. P | GO:0051168 | nuclear export |
| 2. P | GO:0000389 | mRNA 3'-splice site recognition |
| 2. P | GO:0030623 | U5 snRNA binding |
| 2. P | GO:0015459 | potassium channel regulator activity |
| 2. P | GO:0007021 | tubulin complex assembly |
| 2. P | GO:0099054 | presynapse assembly |
| 2. P | GO:0007190 | activation of adenylate cyclase activity |
| 2. P | GO:0008543 | fibroblast growth factor receptor signaling pathway |
| 2. P | GO:0004864 | protein phosphatase inhibitor activity |
| 2. P | GO:0016500 | protein-hormone receptor activity |
| 2. P | GO:1904861 | excitatory synapse assembly |
| 2. P | GO:0042127 | regulation of cell population proliferation |
| 2. P | GO:0048495 | Roundabout binding |
| 2. P | GO:0030620 | U2 snRNA binding |
| 2. P | GO:0008330 | protein tyrosine/threonine phosphatase activity |
| 2. P | GO:0046849 | bone remodeling |
| 2. P | GO:1990030 | pericellular basket |
| 2. P | GO:0001942 | hair follicle development |
| 2. P | GO:0051270 | regulation of cellular component movement |
| 2. P | GO:0044309 | neuron spine |
| 2. P | GO:0050808 | synapse organization |
| 2. P | GO:0050919 | negative chemotaxis |
| 2. P | GO:0072282 | metanephric nephron tubule morphogenesis |
| 2. P | GO:1901381 | positive regulation of potassium ion transmembrane transport |
| 2. P | GO:0090630 | activation of GTPase activity |
| 2. P | GO:0007416 | synapse assembly |
| 2. P | GO:0007157 | heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules |
| 2. P | GO:0005524 | ATP binding |
| 2. P | GO:0007420 | brain development |
| 2. P | GO:0052083 | suppression by symbiont of host cell-mediated immune response |
| 2. P | GO:0001750 | photoreceptor outer segment |
| 2. P | GO:0046822 | regulation of nucleocytoplasmic transport |
| 2. P | GO:0106030 | neuron projection fasciculation |
| 2. P | GO:0008076 | voltage-gated potassium channel complex |
| 2. P | GO:1990723 | cytoplasmic periphery of the nuclear pore complex |
| 2. P | GO:1990523 | bone regeneration |
| 2. P | GO:0097113 | AMPA glutamate receptor clustering |
| 2. P | GO:0007283 | spermatogenesis |
| 2. P | GO:2000405 | negative regulation of T cell migration |
| 2. P | GO:0004385 | guanylate kinase activity |
| 2. P | GO:0034055 | effector-mediated induction of programmed cell death in host |
| 2. P | GO:0016235 | aggresome |
| 2. P | GO:0097060 | synaptic membrane |
| 2. P | GO:0098742 | cell-cell adhesion via plasma-membrane adhesion molecules |
| 2. P | GO:0071005 | U2-type precatalytic spliceosome |
| 2. P | GO:1990869 | cellular response to chemokine |
| 2. P | GO:0009755 | hormone-mediated signaling pathway |
| 2. P | GO:0030030 | cell projection organization |
| 2. P | GO:0001649 | osteoblast differentiation |
| 2. P | GO:0048565 | digestive tract development |
| 2. P | GO:0045087 | innate immune response |
| 2. P | GO:0071013 | catalytic step 2 spliceosome |
| 2. P | GO:0040022 | feminization of hermaphroditic germ-line |
| 2. P | GO:0120163 | negative regulation of cold-induced thermogenesis |
| 2. P | GO:0005856 | cytoskeleton |
| 2. P | GO:0032588 | trans-Golgi network membrane |
| 2. P | GO:1905232 | cellular response to L-glutamate |
| 2. P | GO:0030282 | bone mineralization |
| 2. P | GO:0051729 | germline cell cycle switching, mitotic to meiotic cell cycle |
| 2. P | GO:0097119 | postsynaptic density protein 95 clustering |
| 2. P | GO:0044074 | negative regulation by symbiont of host translation |
| 2. P | GO:0048839 | inner ear development |
| 2. P | GO:0007411 | axon guidance |
| 2. P | GO:0034142 | toll-like receptor 4 signaling pathway |
| 2. P | GO:0005096 | GTPase activator activity |
| 2. P | GO:0034122 | negative regulation of toll-like receptor signaling pathway |
| 2. P | GO:0030177 | positive regulation of Wnt signaling pathway |
| 2. P | GO:1902004 | positive regulation of amyloid-beta formation |
| 2. P | GO:0048598 | embryonic morphogenesis |
| 2. P | GO:0048678 | response to axon injury |
| 2. P | GO:1990138 | neuron projection extension |
| 2. P | GO:0007023 | post-chaperonin tubulin folding pathway |
| 2. P | GO:0044295 | axonal growth cone |
| 2. P | GO:0005887 | integral component of plasma membrane |
| 2. P | GO:1903818 | positive regulation of voltage-gated potassium channel activity |
| 2. P | GO:0032281 | AMPA glutamate receptor complex |
| 2. P | GO:0010165 | response to X-ray |
| 2. P | GO:2000155 | positive regulation of cilium-dependent cell motility |
| 2. P | GO:0032185 | septin cytoskeleton organization |
| 2. P | GO:0044614 | nuclear pore cytoplasmic filaments |
| 2. P | GO:0030425 | dendrite |
| 2. P | GO:0090190 | positive regulation of branching involved in ureteric bud morphogenesis |
| 2. P | GO:0097733 | photoreceptor cell cilium |
| 2. P | GO:0008201 | heparin binding |
| 2. P | GO:0000226 | microtubule cytoskeleton organization |
| 2. P | GO:0036064 | ciliary basal body |
| 2. P | GO:0072578 | neurotransmitter-gated ion channel clustering |
| 2. P | GO:0099055 | integral component of postsynaptic membrane |
| 2. P | GO:0016604 | nuclear body |
| 2. P | GO:0046826 | negative regulation of protein export from nucleus |
| 2. P | GO:0007010 | cytoskeleton organization |
| 2. P | GO:0001530 | lipopolysaccharide binding |
| 2. P | GO:0072202 | cell differentiation involved in metanephros development |
| 2. P | GO:0043395 | heparan sulfate proteoglycan binding |
| 2. P | GO:0032584 | growth cone membrane |
| 2. P | GO:0043204 | perikaryon |
| 2. P | GO:0072224 | metanephric glomerulus development |
| 2. P | GO:0005681 | spliceosomal complex |
| 2. P | GO:0042272 | nuclear RNA export factor complex |
| 2. P | GO:0043014 | alpha-tubulin binding |
| 2. P | GO:0009994 | oocyte differentiation |
| 2. P | GO:0043679 | axon terminus |
| 2. P | GO:0060322 | head development |
| 2. P | GO:0000398 | mRNA splicing, via spliceosome |
| 2. P | GO:0051963 | regulation of synapse assembly |
| 2. P | GO:0008528 | G protein-coupled peptide receptor activity |
| 2. P | GO:0005814 | centriole |
| 2. P | GO:0046696 | lipopolysaccharide receptor complex |
| 2. P | GO:0005104 | fibroblast growth factor receptor binding |
| 2. P | GO:0052170 | suppression by symbiont of host innate immune response |
| 2. P | GO:0042769 | obsolete DNA damage response, detection of DNA damage |
| 2. P | GO:0032391 | photoreceptor connecting cilium |
| 2. P | GO:1904115 | axon cytoplasm |
| 2. P | GO:0030532 | small nuclear ribonucleoprotein complex |
| 2. P | GO:0071007 | U2-type catalytic step 2 spliceosome |
| 2. P | GO:0045499 | chemorepellent activity |
| 2. P | GO:1901629 | regulation of presynaptic membrane organization |
| 2. P | GO:0061290 | canonical Wnt signaling pathway involved in metanephric kidney development |
| 2. P | GO:0007186 | G protein-coupled receptor signaling pathway |
| 2. P | GO:0032809 | neuronal cell body membrane |
| 2. P | GO:0034260 | negative regulation of GTPase activity |
| 2. P | GO:0007413 | axonal fasciculation |
| 2. P | GO:0030621 | U4 snRNA binding |
| 2. P | GO:0042552 | myelination |
| 2. P | GO:0050673 | epithelial cell proliferation |
| 2. P | GO:0001669 | acrosomal vesicle |
| 2. P | GO:0001818 | negative regulation of cytokine production |
| 2. P | GO:0007224 | smoothened signaling pathway |
| 2. P | GO:0016607 | nuclear speck |
| 2. P | GO:0004888 | transmembrane signaling receptor activity |
| 2. P | GO:0007189 | adenylate cyclase-activating G protein-coupled receptor signaling pathway |
| 2. P | GO:0015631 | tubulin binding |
| 2. P | GO:0000776 | kinetochore |
| 2. P | GO:0044782 | cilium organization |
| 2. P | GO:0036335 | intestinal stem cell homeostasis |
| 2. P | GO:0045211 | postsynaptic membrane |
| 2. P | GO:1904117 | cellular response to vasopressin |
| 2. P | GO:0035239 | tube morphogenesis |
| 2. P | GO:0010976 | positive regulation of neuron projection development |
| 2. P | GO:0005654 | nucleoplasm |
| 3. B | GO:0048132 | female germ-line stem cell asymmetric division |
| 3. B | GO:0030511 | positive regulation of transforming growth factor beta receptor signaling pathway |
| 3. B | GO:0005815 | microtubule organizing center |
| 3. B | GO:0090651 | apical cytoplasm |
| 3. B | GO:0043393 | regulation of protein binding |
| 3. B | GO:0030336 | negative regulation of cell migration |
| 3. B | GO:0007527 | adult somatic muscle development |
| 3. B | GO:0030239 | myofibril assembly |
| 3. B | GO:0008584 | male gonad development |
| 3. B | GO:0035904 | aorta development |
| 3. B | GO:0061512 | protein localization to cilium |
| 3. B | GO:0060027 | convergent extension involved in gastrulation |
| 3. B | GO:0008217 | regulation of blood pressure |
| 3. B | GO:0010004 | gastrulation involving germ band extension |
| 3. B | GO:0005769 | early endosome |
| 3. B | GO:0019901 | protein kinase binding |
| 3. B | GO:0003351 | epithelial cilium movement involved in extracellular fluid movement |
| 3. B | GO:0030036 | actin cytoskeleton organization |
| 3. B | GO:0048793 | pronephros development |
| 3. B | GO:0017151 | DEAD/H-box RNA helicase binding |
| 3. B | GO:0001822 | kidney development |
| 3. B | GO:0005102 | signaling receptor binding |
| 3. B | GO:0003279 | cardiac septum development |
| 3. B | GO:0061458 | reproductive system development |
| 3. B | GO:0072687 | meiotic spindle |
| 3. B | GO:0055037 | recycling endosome |
| 3. B | GO:0090660 | cerebrospinal fluid circulation |
| 3. B | GO:0035091 | phosphatidylinositol binding |
| 3. B | GO:0004016 | adenylate cyclase activity |
| 3. B | GO:0061975 | articular cartilage development |
| 3. B | GO:0045171 | intercellular bridge |
| 3. B | GO:0030317 | flagellated sperm motility |
| 3. B | GO:0030254 | protein secretion by the type III secretion system |
| 3. B | GO:0016601 | Rac protein signal transduction |
| 3. B | GO:0006006 | glucose metabolic process |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0007605 | sensory perception of sound |
| 3. B | GO:0005178 | integrin binding |
| 3. B | GO:0044165 | host cell endoplasmic reticulum |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0015630 | microtubule cytoskeleton |
| 3. B | GO:0061371 | determination of heart left/right asymmetry |
| 3. B | GO:0005829 | cytosol |
| 3. B | GO:1905606 | regulation of presynapse assembly |
| 3. B | GO:0090619 | meiotic spindle pole |
| 3. B | GO:0051014 | actin filament severing |
| 3. B | GO:0018996 | molting cycle, collagen and cuticulin-based cuticle |
| 3. B | GO:0051493 | regulation of cytoskeleton organization |
| 3. B | GO:0045202 | synapse |
| 3. B | GO:0008092 | cytoskeletal protein binding |
| 3. B | GO:0090543 | Flemming body |
| 3. B | GO:0120103 | centriolar subdistal appendage |
| 3. B | GO:0120293 | dynein axonemal particle |
| 3. B | GO:0060976 | coronary vasculature development |
| 3. B | GO:0048243 | norepinephrine secretion |
| 3. B | GO:0032228 | regulation of synaptic transmission, GABAergic |
| 3. B | GO:0097431 | mitotic spindle pole |
| 3. B | GO:0003281 | ventricular septum development |
| 3. B | GO:0007268 | chemical synaptic transmission |
| 3. B | GO:0006171 | cAMP biosynthetic process |
| 3. B | GO:0004722 | protein serine/threonine phosphatase activity |
| 3. B | GO:0008154 | actin polymerization or depolymerization |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q965M2 | Leucine-rich repeats and immunoglobulin-like domains protein sma-10 | 2.08e-01 | 1.36e-02 | 0.010 |
| 1. PB | Q91YK0 | Leucine-rich repeat-containing protein 49 | 1.37e-02 | 1.10e-09 | 4.95e-05 |
| 1. PB | A8IVX2 | Dynein regulatory complex subunit 3 | 2.08e-04 | 3.24e-08 | 7.41e-04 |
| 1. PB | B6D5P6 | Dynein axonemal assembly factor 1 | 4.68e-03 | 2.25e-22 | 1.74e-05 |
| 1. PB | Q8N309 | Leucine-rich repeat-containing protein 43 | 0 | 1.09e-155 | 0.0 |
| 1. PB | Q3V0L5 | Leucine-rich repeat-containing protein 43 | 6.33e-15 | 6.96e-80 | 0.0 |
| 1. PB | A6H759 | Leucine-rich repeat-containing protein 72 | 7.11e-03 | 5.74e-03 | 0.009 |
| 1. PB | Q95JT3 | Leucine-rich repeat-containing protein 43 | 0.00e+00 | 1.67e-107 | 0.0 |
| 1. PB | B6D5P1 | Dynein axonemal assembly factor 1 | 4.91e-03 | 1.32e-21 | 1.63e-04 |
| 1. PB | A6NJI9 | Leucine-rich repeat-containing protein 72 | 1.06e-03 | 9.12e-04 | 0.011 |
| 1. PB | P0CC10 | Leucine-rich repeat-containing protein 4B | 1.11e-01 | 4.82e-02 | 0.028 |
| 1. PB | Q7ZV84 | Dynein axonemal assembly factor 1 | 4.94e-03 | 6.33e-20 | 3.09e-07 |
| 1. PB | Q9D2H9 | Dynein axonemal assembly factor 1 | 1.31e-03 | 9.11e-21 | 4.80e-04 |
| 1. PB | Q8IUZ0 | Leucine-rich repeat-containing protein 49 | 3.79e-02 | 4.42e-10 | 9.59e-05 |
| 1. PB | Q9D5S7 | Leucine-rich repeat and guanylate kinase domain-containing protein | 8.22e-02 | 9.12e-04 | 0.018 |
| 1. PB | B6D5P3 | Dynein axonemal assembly factor 1 | 3.09e-03 | 1.65e-20 | 1.64e-04 |
| 1. PB | Q3SYS4 | Dynein axonemal assembly factor 1 | 1.97e-03 | 6.58e-20 | 1.11e-04 |
| 1. PB | Q80ZD9 | Amphoterin-induced protein 2 | 3.66e-02 | 1.13e-02 | 0.024 |
| 1. PB | Q9VR52 | Protein tilB | 1.10e-02 | 1.69e-02 | 1.91e-06 |
| 1. PB | Q8NEP3 | Dynein axonemal assembly factor 1 | 7.22e-02 | 1.87e-21 | 2.53e-04 |
| 2. P | Q95LL2 | X-ray radiation resistance-associated protein 1 (Fragment) | 1.85e-01 | 2.96e-02 | NA |
| 2. P | Q8IYG6 | Leucine-rich repeat-containing protein 56 | 2.50e-02 | 2.95e-12 | NA |
| 2. P | Q6IRU7 | Centrosomal protein of 78 kDa | 3.07e-01 | 2.85e-04 | NA |
| 2. P | Q99PH1 | Leucine-rich repeat-containing protein 4 | 2.42e-02 | 3.04e-02 | NA |
| 2. P | Q6FV04 | U2 small nuclear ribonucleoprotein A' | 6.67e-04 | 1.29e-03 | NA |
| 2. P | A8Y3R9 | Protein phosphatase 1 regulatory subunit 37 homolog | 2.64e-01 | 3.81e-08 | NA |
| 2. P | Q7TNJ4 | Amphoterin-induced protein 2 | 4.49e-01 | 3.07e-02 | NA |
| 2. P | Q387Y5 | Leucine-rich repeat-containing protein 56 homolog | 1.27e-01 | 1.27e-10 | NA |
| 2. P | Q8BGT1 | Leucine-rich repeat transmembrane protein FLRT3 | 4.06e-02 | 2.70e-02 | NA |
| 2. P | Q9VFH6 | Protein Cep78 homolog | 2.45e-01 | 1.62e-03 | NA |
| 2. P | Q4P5F9 | U2 small nuclear ribonucleoprotein A' | 2.57e-04 | 1.93e-02 | NA |
| 2. P | B2RYF1 | Protein phosphatase 1 regulatory subunit 37 | 4.37e-02 | 4.77e-02 | NA |
| 2. P | O75427 | Leucine-rich repeat and calponin homology domain-containing protein 4 | 4.05e-02 | 2.76e-05 | NA |
| 2. P | Q5VUJ6 | Leucine-rich repeat and calponin homology domain-containing protein 2 | 3.69e-03 | 8.91e-07 | NA |
| 2. P | Q4R747 | Leucine-rich repeat-containing protein 46 | 1.02e-02 | 2.26e-05 | NA |
| 2. P | Q5QJ74 | Tubulin-specific chaperone cofactor E-like protein | 2.19e-02 | 2.26e-05 | NA |
| 2. P | Q6K7R2 | Plant intracellular Ras-group-related LRR protein 6 | 9.78e-03 | 1.04e-02 | NA |
| 2. P | Q3UMG5 | Leucine-rich repeat and calponin homology domain-containing protein 2 | 1.65e-01 | 2.07e-07 | NA |
| 2. P | Q80YS5 | Leucine-rich repeat-containing protein 27 | 2.26e-01 | 1.27e-05 | NA |
| 2. P | Q8K375 | Leucine-rich repeat-containing protein 56 | 2.19e-02 | 2.14e-19 | NA |
| 2. P | B0BLW3 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 3.60e-01 | 2.35e-02 | NA |
| 2. P | B1H234 | Leucine-rich repeat transmembrane protein FLRT3 | 2.38e-02 | 1.69e-02 | NA |
| 2. P | Q80ZD7 | Amphoterin-induced protein 1 | 5.54e-01 | 3.37e-03 | NA |
| 2. P | Q5XI54 | Dynein regulatory complex subunit 3 | 3.70e-05 | 5.98e-09 | NA |
| 2. P | Q86WK6 | Amphoterin-induced protein 1 | 1.07e-01 | 1.60e-03 | NA |
| 2. P | Q9Z1P4 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 1.74e-01 | 2.62e-03 | NA |
| 2. P | Q9NJE9 | Dynein axonemal assembly factor 11 | 6.37e-04 | 3.91e-03 | NA |
| 2. P | Q55CS7 | MAP kinase phosphatase with leucine-rich repeats protein 1 | 4.39e-02 | 3.20e-03 | NA |
| 2. P | P90920 | Leucine-rich repeat-containing protein egg-6 | 9.77e-02 | 9.37e-07 | NA |
| 2. P | D3ZAL8 | Leucine-rich repeat transmembrane neuronal protein 3 | 3.25e-02 | 3.10e-03 | NA |
| 2. P | Q8C5W3 | Tubulin-specific chaperone cofactor E-like protein | 3.61e-03 | 1.25e-05 | NA |
| 2. P | P46061 | Ran GTPase-activating protein 1 | 5.46e-02 | 6.79e-04 | NA |
| 2. P | Q9VIW3 | Ran GTPase-activating protein | 4.63e-02 | 5.35e-05 | NA |
| 2. P | Q960C5 | Leucine-rich repeat and calponin homology domain-containing protein | 6.75e-02 | 6.37e-05 | NA |
| 2. P | Q5Y2C3 | Histone H2A.Y | 1.36e-02 | 4.23e-06 | NA |
| 2. P | P09661 | U2 small nuclear ribonucleoprotein A' | 2.82e-03 | 7.50e-05 | NA |
| 2. P | Q19857 | Protein phosphatase 1 regulatory subunit 37 homolog | 1.57e-01 | 9.89e-11 | NA |
| 2. P | Q6AYH9 | Dynein axonemal assembly factor 1 | 1.00e-03 | 2.86e-24 | NA |
| 2. P | F1MLX5 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 3.55e-01 | 7.51e-03 | NA |
| 2. P | Q86VH5 | Leucine-rich repeat transmembrane neuronal protein 3 | 1.15e-01 | 6.37e-03 | NA |
| 2. P | Q4R803 | Protein phosphatase 1 regulatory subunit 42 | 2.71e-03 | 2.97e-03 | NA |
| 2. P | Q5PPX0 | Protein phosphatase 1 regulatory subunit 42 | 1.78e-04 | 2.26e-02 | NA |
| 2. P | Q8ND23 | Capping protein, Arp2/3 and myosin-I linker protein 3 | 7.79e-01 | 3.74e-02 | NA |
| 2. P | Q9Y2L9 | Leucine-rich repeat and calponin homology domain-containing protein 1 | 4.46e-02 | 9.33e-04 | NA |
| 2. P | Q8BVU0 | DISP complex protein LRCH3 | 1.74e-02 | 1.08e-06 | NA |
| 2. P | P34390 | Uncharacterized protein F09G8.5 | 3.26e-03 | 1.17e-02 | NA |
| 2. P | O75473 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 2.70e-01 | 7.33e-04 | NA |
| 2. P | Q96M69 | Leucine-rich repeat and guanylate kinase domain-containing protein | 3.10e-02 | 2.01e-03 | NA |
| 2. P | Q5R7M3 | Amphoterin-induced protein 2 | 2.85e-01 | 1.66e-02 | NA |
| 2. P | Q06479 | F-box protein YLR352W | 4.00e-01 | 5.82e-04 | NA |
| 2. P | Q80ZD8 | Amphoterin-induced protein 1 | 1.71e-02 | 1.33e-03 | NA |
| 2. P | Q9BXB1 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 2.12e-01 | 2.55e-02 | NA |
| 2. P | E5DHB5 | Leucine-rich repeat-containing G-protein coupled receptor 5A | 2.87e-01 | 1.80e-03 | NA |
| 2. P | Q505F5 | Leucine-rich repeat-containing protein 47 | 1.32e-01 | 1.86e-09 | NA |
| 2. P | P18009 | Probable E3 ubiquitin-protein ligase ipaH4.5 | 2.20e-01 | 1.07e-04 | NA |
| 2. P | A2ARI4 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 2.12e-01 | 2.87e-02 | NA |
| 2. P | Q9C0I9 | Leucine-rich repeat-containing protein 27 | 1.29e-01 | 3.41e-04 | NA |
| 2. P | Q9DAP0 | Leucine-rich repeat-containing protein 46 | 5.38e-03 | 9.61e-06 | NA |
| 2. P | P43333 | U2 small nuclear ribonucleoprotein A' | 1.88e-04 | 4.20e-03 | NA |
| 2. P | Q9XVS8 | Nuclear RNA export factor 2 | 4.00e-01 | 8.09e-04 | NA |
| 2. P | P18014 | Probable E3 ubiquitin-protein ligase ipaH7.8 | 1.25e-01 | 3.60e-02 | NA |
| 2. P | Q7S9P4 | U2 small nuclear ribonucleoprotein A' | 3.75e-04 | 2.54e-03 | NA |
| 2. P | Q8BZ81 | Leucine-rich repeat transmembrane neuronal protein 3 | 3.01e-02 | 2.94e-03 | NA |
| 2. P | Q4R6X9 | Dynein regulatory complex subunit 3 | 3.17e-05 | 1.44e-09 | NA |
| 2. P | A7Z026 | Protein phosphatase 1 regulatory subunit 37 | 5.53e-02 | 2.01e-02 | NA |
| 2. P | P62046 | Leucine-rich repeat and calponin homology domain-containing protein 1 | 2.88e-02 | 5.07e-07 | NA |
| 2. P | Q7L0X0 | TLR4 interactor with leucine rich repeats | 4.14e-02 | 1.84e-03 | NA |
| 2. P | F1MT22 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 8.54e-02 | 2.38e-03 | NA |
| 2. P | Q9BLB6 | Probable U2 small nuclear ribonucleoprotein A' | 8.34e-06 | 6.30e-05 | NA |
| 2. P | Q8N1G4 | Leucine-rich repeat-containing protein 47 | 8.20e-02 | 1.45e-10 | NA |
| 2. P | Q86SJ2 | Amphoterin-induced protein 2 | 4.53e-02 | 3.14e-02 | NA |
| 2. P | Q4WV66 | U2 small nuclear ribonucleoprotein A' | 2.42e-04 | 2.51e-03 | NA |
| 2. P | P57784 | U2 small nuclear ribonucleoprotein A' | 1.00e-03 | 8.23e-05 | NA |
| 2. P | Q9V4Q8 | Probable U2 small nuclear ribonucleoprotein A' | 8.94e-06 | 6.12e-06 | NA |
| 2. P | Q80XG9 | Leucine-rich repeat transmembrane neuronal protein 4 | 2.02e-02 | 8.73e-04 | NA |
| 2. P | Q9DBY4 | TLR4 interactor with leucine rich repeats | 2.19e-01 | 1.41e-03 | NA |
| 2. P | Q3U3V8 | X-ray radiation resistance-associated protein 1 | 1.79e-01 | 8.60e-21 | NA |
| 2. P | Q6AXZ2 | Leucine-rich repeat-containing protein 46 | 7.63e-03 | 3.62e-07 | NA |
| 2. P | Q921G6 | Leucine-rich repeat and calponin homology domain-containing protein 4 | 1.85e-02 | 2.03e-06 | NA |
| 2. P | P46060 | Ran GTPase-activating protein 1 | 4.43e-02 | 5.88e-04 | NA |
| 2. P | Q6PGX3 | Leucine-rich repeat and fibronectin type III domain-containing protein 1 | 6.44e-02 | 1.17e-02 | NA |
| 2. P | F7D3V9 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 1.55e-01 | 8.64e-04 | NA |
| 2. P | O13066 | Ran GTPase-activating protein 1 | 9.25e-02 | 2.03e-03 | NA |
| 2. P | Q4V8C9 | Leucine-rich repeat-containing protein 56 | 9.51e-03 | 4.07e-15 | NA |
| 2. P | Q09JZ4 | Leucine-rich repeat-containing protein ODA7 | 1.94e-03 | 2.92e-09 | NA |
| 2. P | Q8BKR5 | Protein phosphatase 1 regulatory subunit 37 | 1.63e-01 | 2.03e-02 | NA |
| 2. P | O43822 | Cilia- and flagella-associated protein 410 | 1.73e-03 | 2.57e-06 | NA |
| 2. P | Q5JTW2 | Centrosomal protein of 78 kDa | 4.14e-01 | 1.49e-03 | NA |
| 2. P | Q2T9T5 | Leucine-rich repeat-containing protein 61 | 1.00e-02 | 1.80e-04 | NA |
| 2. P | Q96FV0 | Leucine-rich repeat-containing protein 46 | 3.47e-03 | 8.94e-09 | NA |
| 2. P | Q3UVD5 | Leucine-rich repeat-containing G-protein coupled receptor 6 | 2.22e-01 | 2.96e-02 | NA |
| 2. P | Q496Z2 | TLR4 interactor with leucine rich repeats | 4.18e-02 | 1.21e-03 | NA |
| 2. P | Q9HBX8 | Leucine-rich repeat-containing G-protein coupled receptor 6 | 2.42e-01 | 1.85e-02 | NA |
| 2. P | D4AC13 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 9.88e-02 | 6.24e-03 | NA |
| 2. P | Q9Z2H4 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 2.93e-01 | 3.23e-02 | NA |
| 2. P | Q9D5E4 | Dynein regulatory complex subunit 3 | 3.65e-05 | 3.37e-09 | NA |
| 2. P | P0DM44 | Leucine-rich repeat-containing G-protein coupled receptor 6 | 8.49e-01 | 2.52e-04 | NA |
| 2. P | Q4R8Y8 | U2 small nuclear ribonucleoprotein A' | 8.29e-04 | 7.50e-05 | NA |
| 2. P | Q9H069 | Dynein regulatory complex subunit 3 | 3.19e-05 | 2.14e-09 | NA |
| 2. P | Q5PQJ7 | Tubulin-specific chaperone cofactor E-like protein | 3.25e-03 | 1.84e-05 | NA |
| 2. P | Q8C6G1 | Cilia- and flagella-associated protein 410 | 2.67e-03 | 7.59e-05 | NA |
| 2. P | B4F7C5 | Leucine-rich repeat transmembrane neuronal protein 4 | 1.85e-02 | 1.38e-03 | NA |
| 2. P | Q96II8 | DISP complex protein LRCH3 | 6.79e-02 | 3.30e-05 | NA |
| 2. P | Q6P2D8 | X-ray radiation resistance-associated protein 1 | 3.29e-02 | 2.55e-21 | NA |
| 2. P | Q9BGP6 | Leucine-rich repeat transmembrane neuronal protein 3 | 1.36e-02 | 6.37e-03 | NA |
| 2. P | Q99257 | mRNA export factor MEX67 | 1.57e-01 | 3.74e-02 | NA |
| 2. P | O75325 | Leucine-rich repeat neuronal protein 2 | 1.82e-01 | 5.12e-03 | NA |
| 2. P | Q86VH4 | Leucine-rich repeat transmembrane neuronal protein 4 | 2.49e-02 | 2.70e-03 | NA |
| 3. B | Q8ZQQ2 | E3 ubiquitin-protein ligase SlrP | 6.32e-02 | NA | 0.019 |
| 3. B | Q1RMR5 | Dynein axonemal assembly factor 11 | 1.34e-02 | NA | 0.018 |
| 3. B | A2AL36 | Centriolin | 5.19e-01 | NA | 0.008 |
| 3. B | Q0P5X1 | Leucine-rich repeat and IQ domain-containing protein 1 | 2.55e-01 | NA | 0.039 |
| 3. B | B3NLX1 | Dynein axonemal assembly factor 1 homolog | 1.71e-01 | NA | 0.002 |
| 3. B | Q9NT99 | Leucine-rich repeat-containing protein 4B | 1.89e-01 | NA | 0.040 |
| 3. B | Q32Q07 | Leucine-rich repeat neuronal protein 1 | 3.70e-02 | NA | 5.60e-04 |
| 3. B | Q6IRN0 | Serine/threonine-protein kinase 11-interacting protein | 4.68e-02 | NA | 5.50e-08 |
| 3. B | O88978 | Dynein axonemal assembly factor 11 | 3.80e-02 | NA | 0.017 |
| 3. B | Q24020 | Protein flightless-1 | 3.02e-01 | NA | 0.004 |
| 3. B | Q9U3A0 | P-granule-associated novel protein 1 | 2.15e-02 | NA | 0.021 |
| 3. B | Q6ZRR7 | Leucine-rich repeat-containing protein 9 | 7.17e-02 | NA | 0.026 |
| 3. B | A0N0X6 | Leucine-rich repeat neuronal protein 1 | 1.10e-01 | NA | 0.002 |
| 3. B | Q9C8M9 | Protein STRUBBELIG-RECEPTOR FAMILY 6 | 5.65e-02 | NA | 1.11e-04 |
| 3. B | Q9VJ07 | Protein phosphatase PHLPP-like protein | 3.82e-01 | NA | 0.007 |
| 3. B | Q4G017 | Nischarin | 1.65e-01 | NA | 0.016 |
| 3. B | Q61809 | Leucine-rich repeat neuronal protein 1 | 7.72e-02 | NA | 4.29e-04 |
| 3. B | Q96JM4 | Leucine-rich repeat and IQ domain-containing protein 1 | 6.06e-01 | NA | 0.031 |
| 3. B | A0A1L8G016 | Dynein axonemal assembly factor 11 | 3.58e-02 | NA | 0.042 |
| 3. B | Q69ZB0 | Leucine-rich repeat and coiled-coil domain-containing protein 1 | 1.17e-01 | NA | 7.41e-04 |
| 3. B | P0C7U0 | Protein ELFN1 | 3.09e-02 | NA | 0.002 |
| 3. B | Q80TM9 | Nischarin | 8.91e-02 | NA | 0.006 |
| 3. B | Q3ZC49 | Leucine-rich repeat-containing protein 39 | 1.06e-02 | NA | 0.007 |
| 3. B | Q6P3Y9 | Podocan-like protein 1 | 6.67e-02 | NA | 0.017 |
| 3. B | Q86X45 | Dynein axonemal assembly factor 11 | 1.63e-02 | NA | 0.001 |
| 3. B | Q7Z7A1 | Centriolin | 7.19e-01 | NA | 0.024 |
| 3. B | Q01513 | Adenylate cyclase | 8.12e-01 | NA | 0.050 |
| 3. B | Q6P4K6 | Serine/threonine-protein kinase 11-interacting protein | 1.45e-01 | NA | 2.74e-07 |
| 3. B | Q8INT5 | Dynein axonemal assembly factor 1 homolog | 7.77e-02 | NA | 0.001 |
| 3. B | B4P6W7 | Dynein axonemal assembly factor 1 homolog | 4.35e-01 | NA | 0.001 |
| 3. B | Q8L899 | Systemin receptor SR160 | 5.18e-01 | NA | 0.029 |
| 3. B | Q4R3F0 | Protein tilB homolog | 1.36e-02 | NA | 2.16e-04 |
| 3. B | Q90944 | Epiphycan | 4.07e-02 | NA | 0.033 |
| 3. B | Q6UXK5 | Leucine-rich repeat neuronal protein 1 | 7.70e-02 | NA | 0.003 |
| 3. B | Q9Y2I1 | Nischarin | 9.24e-02 | NA | 0.005 |
| 3. B | P0C192 | Leucine-rich repeat-containing protein 4B | 7.32e-02 | NA | 0.030 |