Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
Q06281
(Histone H1-like protein HC2) with a FATCAT P-Value: 0.00635 and RMSD of 2.76 angstrom. The sequence alignment identity is 23.4%.
Structural alignment shown in left. Query protein Q8N377 colored as red in alignment, homolog Q06281 colored as blue.
Query protein Q8N377 is also shown in right top, homolog Q06281 showed in right bottom. They are colored based on secondary structures.
Q8N377 -------MDFRQIS--PTTCTTPASSSSAAPPTP----ASSSSAAPPTPASSSSAA-PPTPANCSTA--AP-------PTPANCSTAAPPT-----P--- 69 Q06281 MLGVQKKRSTRKTAARKTVVRKPAAKKTAAKKAPVRKVAAKKTVARKTVAKKTVAARKPV-AKKATAKKAPVRKVAAKKTVAR-KTVAKKTVAARKPVAK 98 Q8N377 --ASSGSAAPPTPAPDHWWMEAPH-HWLPGLLARCGSRQLPSSVGL-ACFGTAAVPRK--PVNWACQGSHG------ELEASQVGSGKAGPCTPHPSLLG 157 Q06281 RVASTKKSSVAVKAG--VCMK-KHKH-----TAACG-R-VAAS-GVKVC-ASAA-KRKTNP-NRS-RTAHSWRQQLMKLVAR------------------ 165 Q8N377 F 158 Q06281 - 165
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0045735 | nutrient reservoir activity |
| 2. P | GO:0003989 | acetyl-CoA carboxylase activity |
| 2. P | GO:0004658 | propionyl-CoA carboxylase activity |
| 2. P | GO:0033644 | host cell membrane |
| 2. P | GO:0009317 | acetyl-CoA carboxylase complex |
| 2. P | GO:0007340 | acrosome reaction |
| 2. P | GO:0030261 | chromosome condensation |
| 2. P | GO:0005882 | intermediate filament |
| 2. P | GO:0045095 | keratin filament |
| 2. P | GO:0010954 | positive regulation of protein processing |
| 2. P | GO:0015977 | carbon fixation |
| 2. P | GO:0035093 | spermatogenesis, exchange of chromosomal proteins |
| 2. P | GO:0031424 | keratinization |
| 2. P | GO:0050699 | WW domain binding |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0007341 | penetration of zona pellucida |
| 2. P | GO:0003677 | DNA binding |
| 3. B | GO:1990535 | neuron projection maintenance |
| 3. B | GO:1990414 | replication-born double-strand break repair via sister chromatid exchange |
| 3. B | GO:0050905 | neuromuscular process |
| 3. B | GO:0051081 | nuclear membrane disassembly |
| 3. B | GO:0035136 | forelimb morphogenesis |
| 3. B | GO:0032039 | integrator complex |
| 3. B | GO:0043614 | multi-eIF complex |
| 3. B | GO:0005874 | microtubule |
| 3. B | GO:0044258 | intestinal lipid catabolic process |
| 3. B | GO:0071169 | establishment of protein localization to chromatin |
| 3. B | GO:0048156 | tau protein binding |
| 3. B | GO:0003374 | dynamin family protein polymerization involved in mitochondrial fission |
| 3. B | GO:0043083 | synaptic cleft |
| 3. B | GO:0000132 | establishment of mitotic spindle orientation |
| 3. B | GO:0033290 | eukaryotic 48S preinitiation complex |
| 3. B | GO:0042634 | regulation of hair cycle |
| 3. B | GO:0097104 | postsynaptic membrane assembly |
| 3. B | GO:0031122 | cytoplasmic microtubule organization |
| 3. B | GO:0030424 | axon |
| 3. B | GO:0050803 | regulation of synapse structure or activity |
| 3. B | GO:0018350 | protein esterification |
| 3. B | GO:0061010 | gall bladder development |
| 3. B | GO:0099186 | structural constituent of postsynapse |
| 3. B | GO:0042043 | neurexin family protein binding |
| 3. B | GO:0007605 | sensory perception of sound |
| 3. B | GO:0048589 | developmental growth |
| 3. B | GO:0045995 | regulation of embryonic development |
| 3. B | GO:0061002 | negative regulation of dendritic spine morphogenesis |
| 3. B | GO:0008017 | microtubule binding |
| 3. B | GO:0120103 | centriolar subdistal appendage |
| 3. B | GO:0098884 | postsynaptic neurotransmitter receptor internalization |
| 3. B | GO:0007097 | nuclear migration |
| 3. B | GO:2001224 | positive regulation of neuron migration |
| 3. B | GO:0031116 | positive regulation of microtubule polymerization |
| 3. B | GO:0048701 | embryonic cranial skeleton morphogenesis |
| 3. B | GO:0071540 | eukaryotic translation initiation factor 3 complex, eIF3e |
| 3. B | GO:0070050 | neuron cellular homeostasis |
| 3. B | GO:0007420 | brain development |
| 3. B | GO:0031802 | type 5 metabotropic glutamate receptor binding |
| 3. B | GO:0006707 | cholesterol catabolic process |
| 3. B | GO:0034088 | maintenance of mitotic sister chromatid cohesion |
| 3. B | GO:0090694 | Scc2-Scc4 cohesin loading complex |
| 3. B | GO:0042471 | ear morphogenesis |
| 3. B | GO:1903423 | positive regulation of synaptic vesicle recycling |
| 3. B | GO:0016282 | eukaryotic 43S preinitiation complex |
| 3. B | GO:0000922 | spindle pole |
| 3. B | GO:0030050 | vesicle transport along actin filament |
| 3. B | GO:0046514 | ceramide catabolic process |
| 3. B | GO:0098793 | presynapse |
| 3. B | GO:0001732 | formation of cytoplasmic translation initiation complex |
| 3. B | GO:0042826 | histone deacetylase binding |
| 3. B | GO:0044327 | dendritic spine head |
| 3. B | GO:0042713 | sperm ejaculation |
| 3. B | GO:0097105 | presynaptic membrane assembly |
| 3. B | GO:0010457 | centriole-centriole cohesion |
| 3. B | GO:0048638 | regulation of developmental growth |
| 3. B | GO:0003151 | outflow tract morphogenesis |
| 3. B | GO:0003007 | heart morphogenesis |
| 3. B | GO:1990841 | promoter-specific chromatin binding |
| 3. B | GO:0048565 | digestive tract development |
| 3. B | GO:0007064 | mitotic sister chromatid cohesion |
| 3. B | GO:1905515 | non-motile cilium assembly |
| 3. B | GO:0061001 | regulation of dendritic spine morphogenesis |
| 3. B | GO:0060236 | regulation of mitotic spindle organization |
| 3. B | GO:0050998 | nitric-oxide synthase binding |
| 3. B | GO:0030479 | actin cortical patch |
| 3. B | GO:0099738 | cell cortex region |
| 3. B | GO:0060325 | face morphogenesis |
| 3. B | GO:0031798 | type 1 metabotropic glutamate receptor binding |
| 3. B | GO:0032044 | DSIF complex |
| 3. B | GO:1904398 | positive regulation of neuromuscular junction development |
| 3. B | GO:0051010 | microtubule plus-end binding |
| 3. B | GO:0005868 | cytoplasmic dynein complex |
| 3. B | GO:0048592 | eye morphogenesis |
| 3. B | GO:0009062 | fatty acid catabolic process |
| 3. B | GO:0003824 | catalytic activity |
| 3. B | GO:0021517 | ventral spinal cord development |
| 3. B | GO:0007158 | neuron cell-cell adhesion |
| 3. B | GO:0061828 | apical tubulobulbar complex |
| 3. B | GO:1905406 | positive regulation of mitotic cohesin loading |
| 3. B | GO:0005819 | spindle |
| 3. B | GO:0090316 | positive regulation of intracellular protein transport |
| 3. B | GO:0008022 | protein C-terminus binding |
| 3. B | GO:0019827 | stem cell population maintenance |
| 3. B | GO:0071481 | cellular response to X-ray |
| 3. B | GO:0090063 | positive regulation of microtubule nucleation |
| 3. B | GO:0032784 | regulation of DNA-templated transcription, elongation |
| 3. B | GO:0048557 | embryonic digestive tract morphogenesis |
| 3. B | GO:0046847 | filopodium assembly |
| 3. B | GO:0045444 | fat cell differentiation |
| 3. B | GO:0032402 | melanosome transport |
| 3. B | GO:0006897 | endocytosis |
| 3. B | GO:0061038 | uterus morphogenesis |
| 3. B | GO:0061829 | basal tubulobulbar complex |
| 3. B | GO:0008126 | acetylesterase activity |
| 3. B | GO:0061744 | motor behavior |
| 3. B | GO:0099558 | maintenance of synapse structure |
| 3. B | GO:0016459 | myosin complex |
| 3. B | GO:0042147 | retrograde transport, endosome to Golgi |
| 3. B | GO:0016185 | synaptic vesicle budding from presynaptic endocytic zone membrane |
| 3. B | GO:0034613 | cellular protein localization |
| 3. B | GO:0030286 | dynein complex |
| 3. B | GO:0030157 | pancreatic juice secretion |
| 3. B | GO:0040018 | positive regulation of multicellular organism growth |
| 3. B | GO:0051491 | positive regulation of filopodium assembly |
| 3. B | GO:0070087 | chromo shadow domain binding |
| 3. B | GO:0034454 | microtubule anchoring at centrosome |
| 3. B | GO:0005814 | centriole |
| 3. B | GO:0005875 | microtubule associated complex |
| 3. B | GO:0031065 | positive regulation of histone deacetylation |
| 3. B | GO:0005813 | centrosome |
| 3. B | GO:0050890 | cognition |
| 3. B | GO:0015630 | microtubule cytoskeleton |
| 3. B | GO:0047485 | protein N-terminus binding |
| 3. B | GO:0035371 | microtubule plus-end |
| 3. B | GO:0035115 | embryonic forelimb morphogenesis |
| 3. B | GO:0030299 | intestinal cholesterol absorption |
| 3. B | GO:0004771 | sterol esterase activity |
| 3. B | GO:0071921 | cohesin loading |
| 3. B | GO:0035261 | external genitalia morphogenesis |
| 3. B | GO:0045778 | positive regulation of ossification |
| 3. B | GO:0007528 | neuromuscular junction development |
| 3. B | GO:0098844 | postsynaptic endocytic zone membrane |
| 3. B | GO:0036033 | mediator complex binding |
| 3. B | GO:0048703 | embryonic viscerocranium morphogenesis |
| 3. B | GO:0034087 | establishment of mitotic sister chromatid cohesion |
| 3. B | GO:0001656 | metanephros development |
| 3. B | GO:0015631 | tubulin binding |
| 3. B | GO:0048488 | synaptic vesicle endocytosis |
| 3. B | GO:0000776 | kinetochore |
| 3. B | GO:0032116 | SMC loading complex |
| 3. B | GO:0005938 | cell cortex |
| 3. B | GO:0002188 | translation reinitiation |
| 3. B | GO:0005635 | nuclear envelope |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8N377 | Putative uncharacterized protein LOC387726 | 0 | 2.43e-157 | 8.80e-104 |
| 2. P | Q65213 | Uncharacterized protein DP96R | NA | 1.91e-06 | NA |
| 2. P | Q921P9 | Transcription elongation factor A protein-like 1 | 2.74e-01 | 2.59e-02 | NA |
| 2. P | P14935 | Uncharacterized protein MTBMA_p00030 | 4.96e-02 | 3.74e-03 | NA |
| 2. P | Q54MW0 | Putative uncharacterized transmembrane protein DDB_G0285779 | 8.66e-01 | 2.73e-02 | NA |
| 2. P | P09125 | Merozoite surface protein CMZ-8 (Fragment) | 5.36e-02 | 1.46e-04 | NA |
| 2. P | O70561 | Putative small proline-rich protein 2J | 6.76e-01 | 7.31e-04 | NA |
| 2. P | Q9QJ13 | Protein B8 | NA | 3.15e-02 | NA |
| 2. P | Q8V9S1 | Uncharacterized protein B117L | NA | 4.21e-02 | NA |
| 2. P | A0A286YFB4 | Small cysteine and glycine repeat-containing protein 2 | 9.51e-01 | 5.86e-03 | NA |
| 2. P | P0C759 | Uncharacterized protein DP96R | NA | 5.92e-03 | NA |
| 2. P | Q06280 | Histone-like protein HC2 | 2.46e-01 | 2.36e-04 | NA |
| 2. P | P21260 | Uncharacterized proline-rich protein (Fragment) | 4.49e-02 | 6.83e-04 | NA |
| 2. P | P0C5E0 | Putative uncharacterized protein YDR193W | 5.57e-01 | 2.34e-02 | NA |
| 2. P | Q6ZQT0 | Putative uncharacterized protein FLJ45035 | 8.59e-01 | 4.21e-02 | NA |
| 2. P | Q7M4S9 | Uncharacterized protein YBL113C | 9.58e-01 | 4.25e-02 | NA |
| 2. P | P0C758 | Uncharacterized protein DP96R | NA | 2.54e-05 | NA |
| 2. P | P18128 | Uncharacterized 26.4 kDa protein | 6.47e-01 | 1.45e-07 | NA |
| 2. P | P0C757 | Uncharacterized protein DP96R | NA | 2.03e-03 | NA |
| 2. P | P0DI83 | Ras-related protein Rab-34, isoform NARR | 6.28e-01 | 1.25e-03 | NA |
| 2. P | Q196Z8 | Uncharacterized protein 062L | NA | 1.04e-04 | NA |
| 2. P | Q5UPY2 | Uncharacterized protein R298 | NA | 4.21e-02 | NA |
| 2. P | O77645 | Nuclear transition protein 2 | 4.88e-02 | 9.93e-03 | NA |
| 2. P | Q9BYS1 | Keratin-associated protein 1-5 | 4.35e-01 | 5.10e-03 | NA |
| 2. P | P38469 | Uncharacterized mitochondrial protein ymf27 | 9.06e-01 | 4.53e-03 | NA |
| 2. P | P17589 | Latency-related protein 2 | NA | 2.15e-14 | NA |
| 2. P | P96886 | Biotin-dependent acetyl-/propionyl-coenzyme A carboxylase epsilon subunit | 2.94e-02 | 3.40e-05 | NA |
| 2. P | P08116 | Processed variable antigen (Fragment) | 6.30e-02 | 2.49e-02 | NA |
| 2. P | Q06281 | Histone H1-like protein HC2 | 6.35e-03 | 2.30e-05 | NA |
| 2. P | A0A023PZI1 | Putative uncharacterized protein OPI11 | 6.86e-01 | 2.05e-02 | NA |
| 2. P | Q55FU5 | Putative uncharacterized protein DDB_G0267946 | 3.85e-02 | 2.83e-04 | NA |
| 2. P | Q5SDL7 | Tick receptor for ospA | 3.09e-01 | 7.56e-04 | NA |
| 2. P | Q54KS5 | Putative uncharacterized protein DDB_G0287145 | 7.05e-01 | 2.90e-02 | NA |
| 2. P | Q8NHX4 | Spermatogenesis-associated protein 3 | 1.54e-01 | 2.88e-07 | NA |
| 2. P | O13530 | Putative uncharacterized protein YLR198C | 8.26e-01 | 7.42e-08 | NA |
| 2. P | P0CA91 | Late protein I196L | NA | 2.48e-05 | NA |
| 2. P | P17991 | C-hordein (Fragment) | 2.43e-02 | 1.93e-02 | NA |
| 2. P | Q85X26 | Photosystem I reaction center subunit VIII | 4.47e-01 | 1.48e-05 | NA |
| 2. P | Q03904 | Putative uncharacterized protein YDR133C | 3.25e-01 | 1.85e-02 | NA |
| 2. P | Q9Z287 | Keratin-associated protein 12-1 | 4.53e-02 | 4.30e-02 | NA |
| 2. P | Q8NA96 | Putative uncharacterized protein FLJ35723 | 4.74e-02 | 7.64e-06 | NA |
| 2. P | Q5RGS3 | Protein FAM74A1 | 7.07e-01 | 7.14e-04 | NA |
| 2. P | Q07627 | Keratin-associated protein 1-1 | 6.44e-01 | 3.35e-03 | NA |
| 3. B | Q6KCD5 | Nipped-B-like protein | NA | NA | 3.66e-06 |
| 3. B | P0CR70 | Transcription elongation factor SPT5 | 9.52e-01 | NA | 0.014 |
| 3. B | P28023 | Dynactin subunit 1 | 9.97e-01 | NA | 0.032 |
| 3. B | A8YPR9 | Snake venom metalloprotease inhibitor 02A10 | 5.46e-01 | NA | 0.001 |
| 3. B | P0CR71 | Transcription elongation factor SPT5 | 9.26e-01 | NA | 0.015 |
| 3. B | P17930 | Capsid protein p87 | NA | NA | 0.037 |
| 3. B | B0XP13 | Eukaryotic translation initiation factor 3 subunit A | 9.80e-01 | NA | 0.026 |
| 3. B | Q54X08 | Myb-like protein V | 7.01e-01 | NA | 5.91e-07 |
| 3. B | P0CP00 | Myosin-1 | 9.64e-01 | NA | 0.046 |
| 3. B | Q4WJQ1 | Eukaryotic translation initiation factor 3 subunit A | 9.90e-01 | NA | 0.026 |
| 3. B | Q14203 | Dynactin subunit 1 | 9.91e-01 | NA | 0.011 |
| 3. B | P25927 | Putative surface-exposed virulence protein BigA | 9.92e-01 | NA | 0.015 |
| 3. B | P0CP01 | Myosin-1 | 9.74e-01 | NA | 0.046 |
| 3. B | Q6KC79 | Nipped-B-like protein | NA | NA | 3.63e-04 |
| 3. B | Q08877 | Dynamin-3 | 9.47e-01 | NA | 0.041 |
| 3. B | P19835 | Bile salt-activated lipase | 8.84e-01 | NA | 1.01e-05 |
| 3. B | B7FF07 | WD repeat-containing protein on Y chromosome | 9.67e-01 | NA | 0.002 |
| 3. B | P35458 | Dynactin subunit 1 | NA | NA | 0.012 |