Summary

Q8N402

Homolog: Q5MJ10.
Function: Sperm protein associated with the nucleus on the X chromosome N2.

Statistics

Total GO Annotation: 114
Unique PROST Go: 114
Unique BLAST Go: 0

Total Homologs: 62
Unique PROST Homologs: 61
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q5MJ10 (Sperm protein associated with the nucleus on the X chromosome N2) with a FATCAT P-Value: 0.00834 and RMSD of 3.32 angstrom. The sequence alignment identity is 23.2%.
Structural alignment shown in left. Query protein Q8N402 colored as red in alignment, homolog Q5MJ10 colored as blue. Query protein Q8N402 is also shown in right top, homolog Q5MJ10 showed in right bottom. They are colored based on secondary structures. 

  Q8N402 MGIHFSCIRGDLKK-P----SKK--RVKREPYSTTMLQVTSLSPINEILRRYSL-Y-T--NQHWRHHGFWRKKIQPQEASEEPPAHKDRGGGERPVNARV 89
  Q5MJ10 MEQPTSSTNGEKRKSPCESNNKKNDEMQEAPN-----RV--LAPKQSLQKTKTIEYLTIIVYYYRKH----TKINSNQ------LEKDQ-SRENSIN--- 79

  Q8N402 VRVAPLR----PGFALCGYAVQDISKEDTVYDICNEDAVDIS------DEDTVDISNEASVHDISNEAAVCDISNDAVNISNEAAVRDISNDAVDICNEA 179
  Q5MJ10 ----PVQEEEDEG--L------D-SAEGSSQE--DED-LDSSEGSSQEDED-LD-SSEGS----SQEDE--DL--D----SSEGSSQE-DED-LD-SSEG 146

  Q8N402 AVHDISNEDTIEDISYEDTVYDITNEDAVRYLCKKDATKEPLTLENDLIVESMSDD--EDFAA 240
  Q5MJ10 S----SQED--EDL---DPPEGSSQED-------ED-------LDSS---EGSSQEGGED--- 180

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0033373 maintenance of protease location in mast cell secretory granule
2. P GO:0045735 nutrient reservoir activity
2. P GO:0099175 regulation of postsynapse organization
2. P GO:2000781 positive regulation of double-strand break repair
2. P GO:0001515 opioid peptide activity
2. P GO:0051656 establishment of organelle localization
2. P GO:0043198 dendritic shaft
2. P GO:0019904 protein domain specific binding
2. P GO:0042307 positive regulation of protein import into nucleus
2. P GO:0043267 negative regulation of potassium ion transport
2. P GO:1900273 positive regulation of long-term synaptic potentiation
2. P GO:0050775 positive regulation of dendrite morphogenesis
2. P GO:0030430 host cell cytoplasm
2. P GO:0001934 positive regulation of protein phosphorylation
2. P GO:0070073 clustering of voltage-gated calcium channels
2. P GO:0035254 glutamate receptor binding
2. P GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
2. P GO:0044162 host cell cytoplasmic vesicle membrane
2. P GO:0012511 monolayer-surrounded lipid storage body
2. P GO:1900006 positive regulation of dendrite development
2. P GO:0033371 T cell secretory granule organization
2. P GO:0043197 dendritic spine
2. P GO:0045121 membrane raft
2. P GO:0030238 male sex determination
2. P GO:0030346 protein phosphatase 2B binding
2. P GO:0031297 replication fork processing
2. P GO:0043271 negative regulation of ion transport
2. P GO:0007218 neuropeptide signaling pathway
2. P GO:0034237 protein kinase A regulatory subunit binding
2. P GO:0098641 cadherin binding involved in cell-cell adhesion
2. P GO:0012505 endomembrane system
2. P GO:0031274 positive regulation of pseudopodium assembly
2. P GO:0045163 clustering of voltage-gated potassium channels
2. P GO:0005576 extracellular region
2. P GO:0009653 anatomical structure morphogenesis
2. P GO:0035092 sperm DNA condensation
2. P GO:0045179 apical cortex
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0050817 coagulation
2. P GO:0010524 positive regulation of calcium ion transport into cytosol
2. P GO:0033382 maintenance of granzyme B location in T cell secretory granule
2. P GO:0030838 positive regulation of actin filament polymerization
2. P GO:0070886 positive regulation of calcineurin-NFAT signaling cascade
2. P GO:0006997 nucleus organization
2. P GO:0060076 excitatory synapse
2. P GO:0006952 defense response
2. P GO:0007266 Rho protein signal transduction
2. P GO:0005516 calmodulin binding
2. P GO:0042255 ribosome assembly
2. P GO:0007194 negative regulation of adenylate cyclase activity
2. P GO:0071417 cellular response to organonitrogen compound
2. P GO:1901318 negative regulation of flagellated sperm motility
2. P GO:0050825 ice binding
2. P GO:0036394 amylase secretion
2. P GO:0098978 glutamatergic synapse
2. P GO:0018149 peptide cross-linking
2. P GO:0009898 cytoplasmic side of plasma membrane
2. P GO:0007420 brain development
2. P GO:0030502 negative regulation of bone mineralization
2. P GO:0017124 SH3 domain binding
2. P GO:0099149 regulation of postsynaptic neurotransmitter receptor internalization
2. P GO:0060090 molecular adaptor activity
2. P GO:0016323 basolateral plasma membrane
2. P GO:0032590 dendrite membrane
2. P GO:0043113 receptor clustering
2. P GO:0042588 zymogen granule
2. P GO:0098837 postsynaptic recycling endosome
2. P GO:0099091 postsynaptic specialization, intracellular component
2. P GO:1905751 positive regulation of endosome to plasma membrane protein transport
2. P GO:0033234 negative regulation of protein sumoylation
2. P GO:0051602 response to electrical stimulus
2. P GO:0021510 spinal cord development
2. P GO:0060135 maternal process involved in female pregnancy
2. P GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
2. P GO:0032591 dendritic spine membrane
2. P GO:0032279 asymmetric synapse
2. P GO:0031424 keratinization
2. P GO:0106333 subcortical maternal complex
2. P GO:1903078 positive regulation of protein localization to plasma membrane
2. P GO:0031527 filopodium membrane
2. P GO:0050811 GABA receptor binding
2. P GO:0044164 host cell cytosol
2. P GO:0033364 mast cell secretory granule organization
2. P GO:0010738 regulation of protein kinase A signaling
2. P GO:0008179 adenylate cyclase binding
2. P GO:0033363 secretory granule organization
2. P GO:0019900 kinase binding
2. P GO:0045296 cadherin binding
2. P GO:1905168 positive regulation of double-strand break repair via homologous recombination
2. P GO:0001664 G protein-coupled receptor binding
2. P GO:0044099 polar tube
2. P GO:0045762 positive regulation of adenylate cyclase activity
2. P GO:0005813 centrosome
2. P GO:0032991 protein-containing complex
2. P GO:0007088 regulation of mitotic nuclear division
2. P GO:0014069 postsynaptic density
2. P GO:0140507 granzyme-mediated programmed cell death signaling pathway
2. P GO:0043624
2. P GO:0040019 positive regulation of embryonic development
2. P GO:0042629 mast cell granule
2. P GO:0030112 glycocalyx
2. P GO:0001818 negative regulation of cytokine production
2. P GO:0005856 cytoskeleton
2. P GO:0014850 response to muscle activity
2. P GO:0035925 mRNA 3'-UTR AU-rich region binding
2. P GO:0099092 postsynaptic density, intracellular component
2. P GO:0031698 beta-2 adrenergic receptor binding
2. P GO:0007548 sex differentiation
2. P GO:0097110 scaffold protein binding
2. P GO:1990393 3M complex
2. P GO:0005577 fibrinogen complex
2. P GO:0007290 spermatid nucleus elongation
2. P GO:0005938 cell cortex
2. P GO:0060491 regulation of cell projection assembly

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8N402 Putative uncharacterized protein LOC388882 0 1.74e-151 2.20e-179
2. P P05421 Dermorphin-2 (Fragment) 5.67e-02 3.89e-04 NA
2. P P06674 Zein-alpha 19A2 (Fragment) 5.56e-01 6.88e-03 NA
2. P P02895 Glycophorin-binding protein 5.95e-01 4.86e-02 NA
2. P H0YM25 Golgin subfamily A member 6-like protein 22 8.91e-01 8.57e-04 NA
2. P P0DJ88 Secreted effector protein EspF(U) 7.82e-01 9.57e-05 NA
2. P P02674 Fibrinogen alpha-1 chain (Fragment) 7.05e-01 8.23e-03 NA
2. P Q2GIB5 SUMOylated effector protein AmpA 3.46e-01 2.58e-04 NA
2. P D3YVF0 A-kinase anchor protein 5 4.19e-01 2.70e-07 NA
2. P Q62563 Sex-determining region Y protein 2.06e-01 5.47e-03 NA
2. P Q6IC83 Uncharacterized protein C22orf42 8.78e-02 1.25e-12 NA
2. P P08416 Zein-alpha GZ19AB11 6.82e-01 2.27e-02 NA
2. P D3ZVV1 KH domain-containing protein 3 8.92e-01 2.36e-02 NA
2. P Q8BVC1 Beta-defensin 22 7.66e-01 1.99e-02 NA
2. P P24450 Zein-alpha PMS2 4.30e-01 8.48e-03 NA
2. P Q9H321 Variable charge X-linked protein 3B 3.85e-01 2.97e-02 NA
2. P P21850 [D-Ala2]-deltorphins 2.05e-01 1.67e-02 NA
2. P Q5H9T9 Fibrous sheath CABYR-binding protein 4.33e-01 3.33e-02 NA
2. P Q5ISE2 mRNA decay activator protein ZFP36L3 7.65e-01 1.48e-02 NA
2. P Q43710 Proteinase inhibitor type-2 TR8 6.23e-01 4.30e-02 NA
2. P Q8X482 Secreted effector protein EspF(U) NA 2.37e-05 NA
2. P Q7M3V1 33kDa venom protein 6.95e-01 2.25e-02 NA
2. P Q42626 Oleosin-B3 1.09e-01 3.36e-02 NA
2. P O76273 Polar tube protein 1 4.92e-01 4.30e-02 NA
2. P O77733 Semenogelin-1 4.31e-01 1.06e-02 NA
2. P P24587 A-kinase anchor protein 5 2.24e-01 1.20e-05 NA
2. P P04702 Zein-alpha M6 3.83e-01 6.88e-03 NA
2. P Q5UQP8 Uncharacterized protein L454 NA 4.14e-02 NA
2. P Q9BWJ2 Putative uncharacterized protein encoded by RHPN1-AS1 9.52e-01 3.95e-02 NA
2. P Q9H320 Variable charge X-linked protein 1 7.84e-02 2.50e-02 NA
2. P Q9H6K5 Proline-rich protein 36 7.82e-01 3.46e-02 NA
2. P Q26005 Ring-infected erythrocyte surface antigen (Fragment) 7.35e-01 4.68e-02 NA
2. P D3YZV8 Coiled-coil domain-containing protein 8 homolog 5.24e-01 1.00e-03 NA
2. P Q28658 Small proline-rich protein 3 7.88e-01 8.22e-04 NA
2. P P62521 Coiled-coil domain-containing protein 8 3.22e-01 7.22e-06 NA
2. P Q91W92 Cdc42 effector protein 1 1.59e-01 7.61e-03 NA
2. P Q4ZJZ3 Protease inhibitor Egf1.5a NA 1.12e-02 NA
2. P M4C367 Virulence protein ATR13 7.03e-01 3.49e-02 NA
2. P P04705 Zein-alpha PZ19.1 (Fragment) 7.55e-01 1.08e-05 NA
2. P P17772 Organ-specific protein S2 7.89e-01 3.17e-06 NA
2. P Q5U7M9 Semenogelin-2 NA 1.02e-02 NA
2. P Q62565 Sex-determining region Y protein 8.01e-01 2.62e-02 NA
2. P P0DJ89 Secreted effector protein EspF(U) 5.99e-01 9.57e-05 NA
2. P P0C2X8 Cell division cycle-associated protein 3 2.31e-01 3.80e-05 NA
2. P Q02752 Acidic phosphoprotein 2.25e-01 8.32e-03 NA
2. P Q5MJ10 Sperm protein associated with the nucleus on the X chromosome N2 8.34e-03 4.50e-05 NA
2. P Q8VE94 Protein FAM110C 1.77e-01 3.77e-02 NA
2. P A6NEY3 Putative golgin subfamily A member 6-like protein 3 5.69e-01 1.25e-02 NA
2. P P05422 Dermorphin-1 2.20e-01 1.59e-03 NA
2. P Q6PGQ1 Aspartate-rich protein 1 1.25e-01 9.36e-06 NA
2. P Q8CJI4 Testis-specific H1 histone 4.10e-01 4.59e-02 NA
2. P C6UYI3 Secreted effector protein EspF(U) 7.22e-01 9.57e-05 NA
2. P P04917 Serglycin 3.30e-01 4.11e-04 NA
2. P P07835 Ice-structuring protein 2A7 3.53e-01 3.80e-02 NA
2. P E2RYF7 Protein PBMUCL2 4.60e-01 2.00e-02 NA
2. P Q90W88 Kininogen-1c 8.70e-01 3.21e-02 NA
2. P Q9JJL0 Testis-specific gene A8 protein 4.51e-02 5.91e-05 NA
2. P Q5UPC9 Uncharacterized protein L53 NA 4.13e-03 NA
2. P Q6NSX1 Coiled-coil domain-containing protein 70 3.17e-01 3.21e-02 NA
2. P Q08DY0 Glutamate-rich protein 5 1.33e-01 2.77e-03 NA
2. P Q00587 Cdc42 effector protein 1 1.67e-01 2.48e-03 NA
2. P Q6GZS6 Uncharacterized protein 050L NA 2.51e-05 NA