Summary

Q8N4B5

Homolog: Q6PAN7.
Function: Proline-rich protein 18.

Statistics

Total GO Annotation: 110
Unique PROST Go: 110
Unique BLAST Go: 0

Total Homologs: 33
Unique PROST Homologs: 31
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q6PAN7 (Proline-rich protein 18) with a FATCAT P-Value: 0.000379 and RMSD of 6.77 angstrom. The sequence alignment identity is 59.6%.
Structural alignment shown in left. Query protein Q8N4B5 colored as red in alignment, homolog Q6PAN7 colored as blue. Query protein Q8N4B5 is also shown in right top, homolog Q6PAN7 showed in right bottom. They are colored based on secondary structures. 

  Q8N4B5 -------------MPFPPMPPPPAP-APGAQAARQLPRRPC------------AAGDKKKRPPQRPEGLLSSSWPSATLKRPPARRGPGL-DRTQPPAPP 73
  Q6PAN7 MLRLLGRVMSFLPMPPPPPPPPPPPRTPGGPAARQLSRRPCAPPAPSPPAASAAGGEKKRRP---PEMLLSSSWPSATLKRPPVRRGPGLGSGTPQPATS 97

  Q8N4B5 G-VSPQALPSRARAPATCAPPRPAGSGHSPARTTYAATSAGTGTTAAGTSSGAGPCPDSAARFCLNLTPEAVLVIQKRHLEKQLLARPRRPFPSPSAEPR 172
  Q6PAN7 ARVPPQPSPGRGGTSTTCSAPRRVACSHIPA-----------GSTASGTSAGAGAGPDDATRFSLNLTPEAILVIQRRHLEKQLLARPRRPFPTPSADP- 185

  Q8N4B5 RL-LAPCLP-ARAAGPRRGGPASDPDAPPTAGQGRRAPPPGAQLLHGGLQ--VPQLSPRPGALRPMLKVSLLNERHRYDDVEYEEEPEAVDEGLVRKCTE 268
  Q6PAN7 RLPLVPC-PRTRASTLRRGGPTSVPNAPLAVAVSSR--PPRASLLPGGLQATLP--SPCPSSLRPVLKVSLLNEKHKYDDEEYEEEVEVVDEGLVRKCTE 280

  Q8N4B5 WLRGVESAAAARGRAGALDSRRHLSTL 295
  Q6PAN7 WLRGVESAAAARGRTGHLDSLPHLSTL 307

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0030984 kininogen binding
2. P GO:1901165 positive regulation of trophoblast cell migration
2. P GO:0031800 type 3 metabotropic glutamate receptor binding
2. P GO:0043029 T cell homeostasis
2. P GO:0048025 negative regulation of mRNA splicing, via spliceosome
2. P GO:0030879 mammary gland development
2. P GO:0007601 visual perception
2. P GO:0014065 phosphatidylinositol 3-kinase signaling
2. P GO:0000122 negative regulation of transcription by RNA polymerase II
2. P GO:0001849 complement component C1q complex binding
2. P GO:0031690 adrenergic receptor binding
2. P GO:0042308 negative regulation of protein import into nucleus
2. P GO:0007127 meiosis I
2. P GO:0005080 protein kinase C binding
2. P GO:0035148 tube formation
2. P GO:0048786 presynaptic active zone
2. P GO:0039592 suppression by virus of G2/M transition of host mitotic cell cycle
2. P GO:0007076 mitotic chromosome condensation
2. P GO:0097141 BIM-BCL-2 complex
2. P GO:2000510 positive regulation of dendritic cell chemotaxis
2. P GO:0043065 positive regulation of apoptotic process
2. P GO:0008139 nuclear localization sequence binding
2. P GO:1902110 positive regulation of mitochondrial membrane permeability involved in apoptotic process
2. P GO:0097177 mitochondrial ribosome binding
2. P GO:0097140 BIM-BCL-xl complex
2. P GO:0006302 double-strand break repair
2. P GO:0003714 transcription corepressor activity
2. P GO:1901386 negative regulation of voltage-gated calcium channel activity
2. P GO:0010311 lateral root formation
2. P GO:0060040 retinal bipolar neuron differentiation
2. P GO:0090200 positive regulation of release of cytochrome c from mitochondria
2. P GO:0044325 transmembrane transporter binding
2. P GO:0048367 shoot system development
2. P GO:0005540 hyaluronic acid binding
2. P GO:0030449 regulation of complement activation
2. P GO:1901385 regulation of voltage-gated calcium channel activity
2. P GO:0044280 subplasmalemmal coating
2. P GO:0005634 nucleus
2. P GO:0042256 mature ribosome assembly
2. P GO:0036342 post-anal tail morphogenesis
2. P GO:0031536 positive regulation of exit from mitosis
2. P GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand
2. P GO:0045787 positive regulation of cell cycle
2. P GO:0006958 complement activation, classical pathway
2. P GO:0048527 lateral root development
2. P GO:0002262 myeloid cell homeostasis
2. P GO:0045876 positive regulation of sister chromatid cohesion
2. P GO:1902263 apoptotic process involved in embryonic digit morphogenesis
2. P GO:0001776 leukocyte homeostasis
2. P GO:0001782 B cell homeostasis
2. P GO:0099527 postsynapse to nucleus signaling pathway
2. P GO:0039652 induction by virus of host NF-kappaB cascade
2. P GO:0005246 calcium channel regulator activity
2. P GO:0070242 thymocyte apoptotic process
2. P GO:0039534 negative regulation of MDA-5 signaling pathway
2. P GO:0046620 regulation of organ growth
2. P GO:0045785 positive regulation of cell adhesion
2. P GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
2. P GO:0009798 axis specification
2. P GO:0008594 photoreceptor cell morphogenesis
2. P GO:0098978 glutamatergic synapse
2. P GO:0050687 negative regulation of defense response to virus
2. P GO:0098885 modification of postsynaptic actin cytoskeleton
2. P GO:1904646 cellular response to amyloid-beta
2. P GO:0032689 negative regulation of interferon-gamma production
2. P GO:0006397 mRNA processing
2. P GO:0033650 host cell mitochondrion
2. P GO:2001244 positive regulation of intrinsic apoptotic signaling pathway
2. P GO:0060349 bone morphogenesis
2. P GO:0071922 regulation of cohesin loading
2. P GO:0032695 negative regulation of interleukin-12 production
2. P GO:0045815 epigenetic maintenance of chromatin in transcription-competent conformation
2. P GO:0043583 ear development
2. P GO:0048066 developmental pigmentation
2. P GO:0002260 lymphocyte homeostasis
2. P GO:0046907 intracellular transport
2. P GO:0048070 regulation of developmental pigmentation
2. P GO:0046549 retinal cone cell development
2. P GO:0009880 embryonic pattern specification
2. P GO:0048538 thymus development
2. P GO:0098982 GABA-ergic synapse
2. P GO:0090023 positive regulation of neutrophil chemotaxis
2. P GO:0070131 positive regulation of mitochondrial translation
2. P GO:0098793 presynapse
2. P GO:0019079 viral genome replication
2. P GO:0048536 spleen development
2. P GO:0060271 cilium assembly
2. P GO:0008380 RNA splicing
2. P GO:0060139 positive regulation of apoptotic process by virus
2. P GO:0006915 apoptotic process
2. P GO:0005759 mitochondrial matrix
2. P GO:0097136 Bcl-2 family protein complex
2. P GO:0000795 synaptonemal complex
2. P GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
2. P GO:2000271 positive regulation of fibroblast apoptotic process
2. P GO:0008494 translation activator activity
2. P GO:0007064 mitotic sister chromatid cohesion
2. P GO:0045087 innate immune response
2. P GO:0051897 positive regulation of protein kinase B signaling
2. P GO:0045736 negative regulation of cyclin-dependent protein serine/threonine kinase activity
2. P GO:0032525 somite rostral/caudal axis specification
2. P GO:0010651 negative regulation of cell communication by electrical coupling
2. P GO:0099573 glutamatergic postsynaptic density
2. P GO:1905539 regulation of postsynapse to nucleus signaling pathway
2. P GO:0048563 post-embryonic animal organ morphogenesis
2. P GO:0048366 leaf development
2. P GO:0034263 positive regulation of autophagy in response to ER overload
2. P GO:0039536 negative regulation of RIG-I signaling pathway
2. P GO:0045740 positive regulation of DNA replication
2. P GO:0097677 STAT family protein binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6PAN7 Proline-rich protein 18 3.79e-04 9.34e-23 9.99e-83
1. PB Q8N4B5 Proline-rich protein 18 0 1.49e-150 0.0
2. P Q9PXA2 Protein X NA 1.15e-03 NA
2. P O35796 Complement component 1 Q subcomponent-binding protein, mitochondrial 1.14e-01 1.27e-02 NA
2. P Q8HZJ4 Calcium-binding protein 4 1.73e-01 3.17e-02 NA
2. P Q5VUJ9 Dynein regulatory complex protein 8 4.01e-01 2.19e-02 NA
2. P Q9BUN5 Coiled-coil domain-containing protein 28B 7.45e-02 1.54e-02 NA
2. P Q96FF9 Sororin 1.28e-01 9.66e-03 NA
2. P Q8IYB0 Putative uncharacterized protein MGC39545 7.56e-01 1.79e-02 NA
2. P Q563C3 Sororin 1.99e-01 4.92e-03 NA
2. P Q9M9H3 Embryogenesis-like protein 8.98e-02 2.00e-02 NA
2. P O35658 Complement component 1 Q subcomponent-binding protein, mitochondrial 5.42e-02 4.98e-02 NA
2. P Q4R4T9 Ran-binding protein 3 8.99e-02 7.47e-03 NA
2. P Q8CEG5 Coiled-coil domain-containing protein 28B 1.38e-01 4.41e-02 NA
2. P Q9ULZ0 TP53-target gene 3 protein 3.47e-01 2.08e-02 NA
2. P A8MWP4 Putative uncharacterized protein ENSP00000401716 3.31e-01 7.85e-03 NA
2. P Q9H607 Occludin/ELL domain-containing protein 1 9.44e-02 4.41e-02 NA
2. P Q3ZN08 Protein FAM220A 1.65e-01 2.29e-02 NA
2. P A5E748 Ribosome biogenesis protein ALB1 4.84e-01 7.47e-03 NA
2. P Q66H03 Glutamate-rich protein 2 4.82e-02 2.83e-02 NA
2. P Q32KT5 Uncharacterized protein C6orf136 homolog 3.69e-01 6.00e-03 NA
2. P Q67Y93 Cyclin-dependent kinase inhibitor 1 1.25e-01 2.65e-02 NA
2. P Q5R4Y2 Ran-binding protein 3 4.15e-01 1.84e-02 NA
2. P O88751 Calcium-binding protein 1 1.61e-01 1.82e-06 NA
2. P Q8IZU0 Protein FAM9B 1.37e-01 2.85e-04 NA
2. P Q6GZM9 Uncharacterized protein 096R NA 3.05e-02 NA
2. P O54918 Bcl-2-like protein 11 1.19e-01 3.65e-02 NA
2. P P20977 Protein X NA 3.14e-02 NA
2. P Q9MZE0 Complement component 1 Q subcomponent-binding protein, mitochondrial 1.71e-01 4.75e-02 NA
2. P A8IHN8 Uncharacterized protein C11orf96 homolog 3.32e-02 2.47e-03 NA
2. P Q3UPL5 Uncharacterized protein C11orf96 homolog 2.53e-01 1.46e-02 NA
2. P P0C678 Protein X NA 2.62e-02 NA
2. P Q2WG76 Protein ripply2 8.69e-01 3.45e-02 NA