Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q9D3W5
(Leucine-rich repeat-containing protein 71) with a FATCAT P-Value: 1.53e-13 and RMSD of 4.88 angstrom. The sequence alignment identity is 80.7%.
Structural alignment shown in left. Query protein Q8N4P6 colored as red in alignment, homolog Q9D3W5 colored as blue.
Query protein Q8N4P6 is also shown in right top, homolog Q9D3W5 showed in right bottom. They are colored based on secondary structures.
Q8N4P6 MSSEQSAPGASPRAPRPGTQKSSGAVTKKGERAAKEKPATVLPPVGEEEPKSPEEYQCSGVLETDFAELCTRWGYTDFPKVVNRPRPHPPFVPSASLSEK 100 Q9D3W5 MSSEPSTTGTSPRTPRPGAQKSSGAVTKKGDRAAKDKTASTLPPVGEDEPKNPEEYQCTGVLETDFAELCTRSGYVDFPKVVTRPRVQQSSVPSASTSEK 100 Q8N4P6 ATLDDPRLSGSCSLNSLESKYVFFRPTIQVELEQEDSKSVKEIYIRGWKVEERILGVFSKCLPPLTQLQAINLWKVGLTDKTLTTFIELLPLCSSTLRKV 200 Q9D3W5 PVLDDQRPSASCSQSSLESKYVFFRPTIQVELEQEDSKAVKEIYIRGWKVEDRILGIFSKCLPSLSQLQAINLWKVGLTDKTLTTFIALLPLCSSTLRKV 200 Q8N4P6 SLEGNPLPEQSYHKLMALDSTIAHLSLRNNNIDDRGAQLLGQALSTLHSCNRTLVSLNLGFNHIGDEGAGYIADGLRLNRSLLWLSLAHNRIQDKGALKL 300 Q9D3W5 SLEGNPIPEQSFSKLMGLDSTIVHLSLRNNNINDHGAQLLGQALSTLQNSNRTLVSLNLAFNHIGDVGAGYIADGLRLNRSLLWLSLAHNHIQDKGALKL 300 Q8N4P6 AEVLRAFELTHTEVVERRRLLLEKGTQERSRSPSSSRHGDSKTDREKSQMVGISNSALVDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQG 400 Q9D3W5 AEVLRPFELTHREVVERRRLLLVKGTQERSRSPSSSRYGDSKAEREKSQTLGISNVTLVDKQEKMQSLKAPKTISKKKEKTGEVVKKEEKLGSGQSPTQG 400 Q8N4P6 TPKKEDATKAGKGKVTIPEQKPSRAKGIKIGSREKRSILLESE-LVVEATEVVNPLLEPVEHRDGKVFMPGNKVLLHLNLIRNRITEVGLEGFLATVQYQ 499 Q9D3W5 TPKKEDAAKAGKGKVTIPEQKMSKGKATKMGAKEKRSILLESEQLVVEATEMVNPLLEPVEHRDGKVFLPGNKVLLHLNLLRNQITEVGLEGFLTAVQYQ 500 Q8N4P6 MQFSKAKSASKGPVGLLWLSLAKNCFAPQCPAYAIIQELMLPRDPIKAKLREDEAMAFFP 559 Q9D3W5 VQVSKPKTSPKAPLGLLWLSLAKNCFDPQCPTHVMIQELMLPRDPVKAKAREEEAAAT-- 558
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0030154 | cell differentiation |
| 1. PB | GO:0004864 | protein phosphatase inhibitor activity |
| 1. PB | GO:0007015 | actin filament organization |
| 1. PB | GO:0005730 | nucleolus |
| 2. P | GO:0005096 | GTPase activator activity |
| 2. P | GO:0060170 | ciliary membrane |
| 2. P | GO:0030239 | myofibril assembly |
| 2. P | GO:0009504 | cell plate |
| 2. P | GO:0006941 | striated muscle contraction |
| 2. P | GO:0005819 | spindle |
| 2. P | GO:0009524 | phragmoplast |
| 2. P | GO:0019005 | SCF ubiquitin ligase complex |
| 2. P | GO:0030016 | myofibril |
| 2. P | GO:0048741 | skeletal muscle fiber development |
| 2. P | GO:0043231 | intracellular membrane-bounded organelle |
| 2. P | GO:0031965 | nuclear membrane |
| 2. P | GO:0045010 | actin nucleation |
| 2. P | GO:0005523 | tropomyosin binding |
| 2. P | GO:0031514 | motile cilium |
| 2. P | GO:0048743 | positive regulation of skeletal muscle fiber development |
| 2. P | GO:0005865 | striated muscle thin filament |
| 2. P | GO:0051694 | pointed-end actin filament capping |
| 2. P | GO:0031430 | M band |
| 2. P | GO:0006936 | muscle contraction |
| 2. P | GO:0030030 | cell projection organization |
| 2. P | GO:0006913 | nucleocytoplasmic transport |
| 2. P | GO:0006606 | protein import into nucleus |
| 2. P | GO:0031146 | SCF-dependent proteasomal ubiquitin-dependent protein catabolic process |
| 2. P | GO:0031672 | A band |
| 2. P | GO:0005930 | axoneme |
| 2. P | GO:0030240 | skeletal muscle thin filament assembly |
| 2. P | GO:0000911 | cytokinesis by cell plate formation |
| 2. P | GO:0007165 | signal transduction |
| 2. P | GO:0005635 | nuclear envelope |
| 2. P | GO:0004722 | protein serine/threonine phosphatase activity |
| 2. P | GO:0003785 | actin monomer binding |
| 3. B | GO:0036336 | dendritic cell migration |
| 3. B | GO:0050680 | negative regulation of epithelial cell proliferation |
| 3. B | GO:0051656 | establishment of organelle localization |
| 3. B | GO:0044319 | wound healing, spreading of cells |
| 3. B | GO:0036312 | phosphatidylinositol 3-kinase regulatory subunit binding |
| 3. B | GO:0045591 | positive regulation of regulatory T cell differentiation |
| 3. B | GO:0032701 | negative regulation of interleukin-18 production |
| 3. B | GO:0009595 | detection of biotic stimulus |
| 3. B | GO:0032720 | negative regulation of tumor necrosis factor production |
| 3. B | GO:0032755 | positive regulation of interleukin-6 production |
| 3. B | GO:0051639 | actin filament network formation |
| 3. B | GO:0002925 | positive regulation of humoral immune response mediated by circulating immunoglobulin |
| 3. B | GO:0010942 | positive regulation of cell death |
| 3. B | GO:0031953 | negative regulation of protein autophosphorylation |
| 3. B | GO:0072558 | NLRP1 inflammasome complex |
| 3. B | GO:0043549 | regulation of kinase activity |
| 3. B | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0048147 | negative regulation of fibroblast proliferation |
| 3. B | GO:0034451 | centriolar satellite |
| 3. B | GO:0048872 | homeostasis of number of cells |
| 3. B | GO:0060471 | cortical granule exocytosis |
| 3. B | GO:0032733 | positive regulation of interleukin-10 production |
| 3. B | GO:0060340 | positive regulation of type I interferon-mediated signaling pathway |
| 3. B | GO:0032879 | regulation of localization |
| 3. B | GO:0002710 | negative regulation of T cell mediated immunity |
| 3. B | GO:0032498 | detection of muramyl dipeptide |
| 3. B | GO:0071224 | cellular response to peptidoglycan |
| 3. B | GO:0044877 | protein-containing complex binding |
| 3. B | GO:1904417 | positive regulation of xenophagy |
| 3. B | GO:0043552 | positive regulation of phosphatidylinositol 3-kinase activity |
| 3. B | GO:0042834 | peptidoglycan binding |
| 3. B | GO:0045751 | negative regulation of Toll signaling pathway |
| 3. B | GO:0002732 | positive regulation of dendritic cell cytokine production |
| 3. B | GO:1900016 | negative regulation of cytokine production involved in inflammatory response |
| 3. B | GO:0045179 | apical cortex |
| 3. B | GO:0002830 | positive regulation of type 2 immune response |
| 3. B | GO:0061851 | leading edge of lamellipodium |
| 3. B | GO:0140608 | cysteine-type endopeptidase activator activity |
| 3. B | GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation |
| 3. B | GO:1900029 | positive regulation of ruffle assembly |
| 3. B | GO:0009986 | cell surface |
| 3. B | GO:0042110 | T cell activation |
| 3. B | GO:0090091 | positive regulation of extracellular matrix disassembly |
| 3. B | GO:0050871 | positive regulation of B cell activation |
| 3. B | GO:2000363 | positive regulation of prostaglandin-E synthase activity |
| 3. B | GO:0006954 | inflammatory response |
| 3. B | GO:0046645 | positive regulation of gamma-delta T cell activation |
| 3. B | GO:0051293 | establishment of spindle localization |
| 3. B | GO:0032494 | response to peptidoglycan |
| 3. B | GO:0002227 | innate immune response in mucosa |
| 3. B | GO:0050766 | positive regulation of phagocytosis |
| 3. B | GO:1901223 | negative regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0030011 | maintenance of cell polarity |
| 3. B | GO:0016323 | basolateral plasma membrane |
| 3. B | GO:0030277 | maintenance of gastrointestinal epithelium |
| 3. B | GO:0019901 | protein kinase binding |
| 3. B | GO:0030544 | Hsp70 protein binding |
| 3. B | GO:0002862 | negative regulation of inflammatory response to antigenic stimulus |
| 3. B | GO:0050700 | CARD domain binding |
| 3. B | GO:0060339 | negative regulation of type I interferon-mediated signaling pathway |
| 3. B | GO:0051770 | positive regulation of nitric-oxide synthase biosynthetic process |
| 3. B | GO:0045345 | positive regulation of MHC class I biosynthetic process |
| 3. B | GO:0045089 | positive regulation of innate immune response |
| 3. B | GO:0031252 | cell leading edge |
| 3. B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0045087 | innate immune response |
| 3. B | GO:0051353 | positive regulation of oxidoreductase activity |
| 3. B | GO:0005856 | cytoskeleton |
| 3. B | GO:0045824 | negative regulation of innate immune response |
| 3. B | GO:0061339 | establishment or maintenance of monopolar cell polarity |
| 3. B | GO:0071222 | cellular response to lipopolysaccharide |
| 3. B | GO:0034315 | regulation of Arp2/3 complex-mediated actin nucleation |
| 3. B | GO:0043124 | negative regulation of I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0008656 | cysteine-type endopeptidase activator activity involved in apoptotic process |
| 3. B | GO:0039536 | negative regulation of RIG-I signaling pathway |
| 3. B | GO:0061702 | inflammasome complex |
| 3. B | GO:0036126 | sperm flagellum |
| 3. B | GO:0071225 | cellular response to muramyl dipeptide |
| 3. B | GO:0060473 | cortical granule |
| 3. B | GO:0032760 | positive regulation of tumor necrosis factor production |
| 3. B | GO:0002606 | positive regulation of dendritic cell antigen processing and presentation |
| 3. B | GO:0038187 | pattern recognition receptor activity |
| 3. B | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0002720 | positive regulation of cytokine production involved in immune response |
| 3. B | GO:0046330 | positive regulation of JNK cascade |
| 3. B | GO:0050728 | negative regulation of inflammatory response |
| 3. B | GO:0043281 | regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0014067 | negative regulation of phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0032735 | positive regulation of interleukin-12 production |
| 3. B | GO:0046597 | negative regulation of viral entry into host cell |
| 3. B | GO:0070374 | positive regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0034136 | negative regulation of toll-like receptor 2 signaling pathway |
| 3. B | GO:0032715 | negative regulation of interleukin-6 production |
| 3. B | GO:0050679 | positive regulation of epithelial cell proliferation |
| 3. B | GO:0032692 | negative regulation of interleukin-1 production |
| 3. B | GO:0071257 | cellular response to electrical stimulus |
| 3. B | GO:0006887 | exocytosis |
| 3. B | GO:0071639 | positive regulation of monocyte chemotactic protein-1 production |
| 3. B | GO:0032757 | positive regulation of interleukin-8 production |
| 3. B | GO:0032687 | negative regulation of interferon-alpha production |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0045348 | positive regulation of MHC class II biosynthetic process |
| 3. B | GO:0051879 | Hsp90 protein binding |
| 3. B | GO:0060335 | positive regulation of interferon-gamma-mediated signaling pathway |
| 3. B | GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0051000 | positive regulation of nitric-oxide synthase activity |
| 3. B | GO:0019899 | enzyme binding |
| 3. B | GO:0002253 | activation of immune response |
| 3. B | GO:0032731 | positive regulation of interleukin-1 beta production |
| 3. B | GO:1902523 | positive regulation of protein K63-linked ubiquitination |
| 3. B | GO:0032689 | negative regulation of interferon-gamma production |
| 3. B | GO:0002221 | pattern recognition receptor signaling pathway |
| 3. B | GO:0032703 | negative regulation of interleukin-2 production |
| 3. B | GO:0032695 | negative regulation of interleukin-12 production |
| 3. B | GO:2000813 | negative regulation of barbed-end actin filament capping |
| 3. B | GO:0007584 | response to nutrient |
| 3. B | GO:1900017 | positive regulation of cytokine production involved in inflammatory response |
| 3. B | GO:2000110 | negative regulation of macrophage apoptotic process |
| 3. B | GO:0017024 | myosin I binding |
| 3. B | GO:0043330 | response to exogenous dsRNA |
| 3. B | GO:0090022 | regulation of neutrophil chemotaxis |
| 3. B | GO:0006919 | activation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0042585 | germinal vesicle |
| 3. B | GO:0043487 | regulation of RNA stability |
| 3. B | GO:0005794 | Golgi apparatus |
| 3. B | GO:0106333 | subcortical maternal complex |
| 3. B | GO:1902745 | positive regulation of lamellipodium organization |
| 3. B | GO:0042981 | regulation of apoptotic process |
| 3. B | GO:0030317 | flagellated sperm motility |
| 3. B | GO:0051302 | regulation of cell division |
| 3. B | GO:0045747 | positive regulation of Notch signaling pathway |
| 3. B | GO:0070685 | macropinocytic cup |
| 3. B | GO:0032991 | protein-containing complex |
| 3. B | GO:0097300 | programmed necrotic cell death |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0006963 | positive regulation of antibacterial peptide biosynthetic process |
| 3. B | GO:0032740 | positive regulation of interleukin-17 production |
| 3. B | GO:0043406 | positive regulation of MAP kinase activity |
| 3. B | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 3. B | GO:0040019 | positive regulation of embryonic development |
| 3. B | GO:0032688 | negative regulation of interferon-beta production |
| 3. B | GO:0031982 | vesicle |
| 3. B | GO:0060585 | positive regulation of prostaglandin-endoperoxide synthase activity |
| 3. B | GO:0035556 | intracellular signal transduction |
| 3. B | GO:0015631 | tubulin binding |
| 3. B | GO:0050727 | regulation of inflammatory response |
| 3. B | GO:0046658 | anchored component of plasma membrane |
| 3. B | GO:0032874 | positive regulation of stress-activated MAPK cascade |
| 3. B | GO:0071407 | cellular response to organic cyclic compound |
| 3. B | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 3. B | GO:0016045 | detection of bacterium |
| 3. B | GO:0042742 | defense response to bacterium |
| 3. B | GO:0045335 | phagocytic vesicle |
| 3. B | GO:0006965 | positive regulation of biosynthetic process of antibacterial peptides active against Gram-positive bacteria |
| 3. B | GO:0044354 | macropinosome |
| 3. B | GO:0005938 | cell cortex |
| 3. B | GO:0050830 | defense response to Gram-positive bacterium |
| 3. B | GO:0032500 | muramyl dipeptide binding |
| 3. B | GO:1900226 | negative regulation of NLRP3 inflammasome complex assembly |
| 3. B | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8BKR5 | Protein phosphatase 1 regulatory subunit 37 | 4.83e-03 | 6.90e-05 | 1.21e-05 |
| 1. PB | Q19857 | Protein phosphatase 1 regulatory subunit 37 homolog | 2.43e-03 | 2.76e-09 | 0.022 |
| 1. PB | Q9DAM1 | Leucine-rich repeat-containing protein 34 | 1.16e-04 | 3.51e-05 | 0.005 |
| 1. PB | A8HMZ4 | Dynein regulatory complex subunit 5 | 1.29e-04 | 1.68e-05 | 5.32e-04 |
| 1. PB | O75864 | Protein phosphatase 1 regulatory subunit 37 | 4.00e-03 | 2.82e-04 | 8.19e-06 |
| 1. PB | Q0VAA2 | Leucine-rich repeat-containing protein 74A | 4.58e-04 | 9.69e-07 | 8.57e-06 |
| 1. PB | Q9M651 | RAN GTPase-activating protein 2 | 6.96e-03 | 2.26e-02 | 0.021 |
| 1. PB | A8Y3R9 | Protein phosphatase 1 regulatory subunit 37 homolog | 1.05e-02 | 2.72e-08 | 8.09e-04 |
| 1. PB | Q9D3W5 | Leucine-rich repeat-containing protein 71 | 1.53e-13 | 2.16e-93 | 0.0 |
| 1. PB | Q14BP6 | Leucine-rich repeat-containing protein 74B | 8.77e-04 | 1.40e-08 | 1.04e-04 |
| 1. PB | A0JPI9 | Leucine-rich repeat-containing protein 74A | 8.25e-05 | 1.27e-09 | 9.51e-07 |
| 1. PB | Q8IZ02 | Leucine-rich repeat-containing protein 34 | 6.53e-05 | 4.78e-08 | 8.75e-04 |
| 1. PB | Q6ZQY2 | Leucine-rich repeat-containing protein 74B | 4.91e-04 | 8.04e-08 | 6.34e-06 |
| 1. PB | B2RYF1 | Protein phosphatase 1 regulatory subunit 37 | 2.06e-02 | 3.12e-04 | 9.66e-06 |
| 1. PB | Q1L994 | Protein phosphatase 1 regulatory subunit 37 | 2.31e-03 | 1.31e-03 | 8.77e-06 |
| 1. PB | Q8N4P6 | Leucine-rich repeat-containing protein 71 | 0 | 2.00e-153 | 0.0 |
| 1. PB | Q4V8D9 | Leucine-rich repeat-containing protein 34 | 8.97e-05 | 3.94e-03 | 0.004 |
| 1. PB | A7Z026 | Protein phosphatase 1 regulatory subunit 37 | 2.76e-03 | 6.66e-05 | 5.53e-07 |
| 2. P | Q4KLV2 | Leucine-rich repeat-containing protein 42 | 8.06e-02 | 1.63e-02 | NA |
| 2. P | Q0P4D1 | Protein AMN1 homolog | 2.45e-02 | 3.07e-02 | NA |
| 2. P | Q6PEZ8 | Podocan-like protein 1 | 1.95e-02 | 2.73e-03 | NA |
| 2. P | Q6UY01 | Leucine-rich repeat-containing protein 31 | 1.08e-02 | 1.99e-04 | NA |
| 2. P | Q8R2U7 | Leucine-rich repeat-containing protein 42 | 2.64e-02 | 3.03e-06 | NA |
| 2. P | Q9Y546 | Leucine-rich repeat-containing protein 42 | 7.93e-02 | 1.58e-08 | NA |
| 2. P | E9QA62 | Leiomodin-3 | 1.12e-02 | 4.37e-03 | NA |
| 2. P | Q3UV48 | Leucine-rich repeat-containing protein 30 | 9.06e-02 | 3.52e-02 | NA |
| 2. P | A6NM36 | Leucine-rich repeat-containing protein 30 | 9.59e-02 | 7.95e-03 | NA |
| 2. P | Q9LE82 | RAN GTPase-activating protein 1 | 2.10e-03 | 8.78e-05 | NA |
| 2. P | Q2HJ90 | Leucine-rich repeat-containing protein 42 | 1.11e-01 | 1.60e-07 | NA |
| 2. P | Q4KM95 | Leucine-rich repeat-containing protein 42 | 4.89e-02 | 4.72e-06 | NA |
| 2. P | Q5U201 | Protein AMN1 homolog | 2.73e-03 | 1.99e-02 | NA |
| 2. P | Q387Y5 | Leucine-rich repeat-containing protein 56 homolog | 3.68e-02 | 3.84e-02 | NA |
| 2. P | Q0V9Y8 | Leucine-rich repeat-containing protein 42 | 3.17e-02 | 1.20e-06 | NA |
| 2. P | A6NHZ5 | Leucine-rich repeat-containing protein 14B | 9.70e-03 | 3.78e-03 | NA |
| 3. B | Q66X19 | NACHT, LRR and PYD domains-containing protein 4E | 3.65e-02 | NA | 8.73e-05 |
| 3. B | P10775 | Ribonuclease inhibitor | 1.07e-03 | NA | 0.018 |
| 3. B | A6H639 | Dynein regulatory complex subunit 5 | 8.83e-04 | NA | 2.07e-06 |
| 3. B | Q86WI3 | Protein NLRC5 | 1.18e-01 | NA | 0.007 |
| 3. B | Q7RTR2 | NLR family CARD domain-containing protein 3 | 1.51e-02 | NA | 1.17e-09 |
| 3. B | Q4R642 | Dynein regulatory complex subunit 5 | 1.28e-03 | NA | 1.68e-04 |
| 3. B | Q3TL44 | NLR family member X1 | 3.23e-02 | NA | 0.009 |
| 3. B | Q9Y239 | Nucleotide-binding oligomerization domain-containing protein 1 | 1.62e-02 | NA | 0.001 |
| 3. B | Q3TKR3 | NACHT, LRR and PYD domains-containing protein 4C | 3.19e-02 | NA | 4.38e-04 |
| 3. B | Q3V3V9 | Capping protein, Arp2/3 and myosin-I linker protein 2 | 7.54e-02 | NA | 0.043 |
| 3. B | Q2LKU9 | NACHT, LRR and PYD domains-containing protein 1a | 7.91e-02 | NA | 0.030 |
| 3. B | Q96CN5 | Leucine-rich repeat-containing protein 45 | 1.83e-03 | NA | 0.009 |
| 3. B | E9Q5R7 | NACHT, LRR and PYD domains-containing protein 12 | 1.64e-02 | NA | 0.003 |
| 3. B | Q5DU56 | Protein NLRC3 | 1.91e-02 | NA | 9.94e-09 |
| 3. B | Q5JU00 | Dynein regulatory complex subunit 5 | 2.94e-04 | NA | 1.73e-04 |
| 3. B | Q5ZI11 | Leucine-rich repeat-containing protein 45 | 1.11e-03 | NA | 0.002 |
| 3. B | Q53B88 | Nucleotide-binding oligomerization domain-containing protein 2 | 1.82e-02 | NA | 1.34e-09 |
| 3. B | Q1ZXD6 | Probable serine/threonine-protein kinase roco5 | NA | NA | 1.31e-06 |
| 3. B | Q647I9 | NACHT, LRR and PYD domains-containing protein 5 | 2.82e-02 | NA | 0.002 |
| 3. B | Q6B966 | NACHT, LRR and PYD domains-containing protein 14 | 4.56e-02 | NA | 0.026 |
| 3. B | Q9R1M5 | NACHT, LRR and PYD domains-containing protein 5 | 9.07e-02 | NA | 0.005 |
| 3. B | Q95VZ3 | Protein CARMIL | 3.49e-02 | NA | 0.001 |
| 3. B | Q6E804 | Nucleotide-binding oligomerization domain-containing protein 2 | 1.03e-02 | NA | 1.18e-04 |
| 3. B | Q8K3Z0 | Nucleotide-binding oligomerization domain-containing protein 2 | 1.37e-02 | NA | 8.41e-06 |
| 3. B | Q86W25 | NACHT, LRR and PYD domains-containing protein 13 | 3.08e-02 | NA | 6.51e-04 |
| 3. B | P59047 | NACHT, LRR and PYD domains-containing protein 5 | 1.08e-01 | NA | 7.09e-06 |
| 3. B | Q8CIM1 | Leucine-rich repeat-containing protein 45 | 1.78e-03 | NA | 7.02e-04 |
| 3. B | Q8BHB0 | Nucleotide-binding oligomerization domain-containing protein 1 | 1.64e-02 | NA | 2.23e-04 |
| 3. B | Q53B87 | Nucleotide-binding oligomerization domain-containing protein 2 | 2.50e-02 | NA | 3.58e-10 |
| 3. B | P79621 | MHC class II transactivator | 8.98e-02 | NA | 1.25e-05 |
| 3. B | Q86W24 | NACHT, LRR and PYD domains-containing protein 14 | 3.98e-02 | NA | 3.40e-04 |
| 3. B | Q8BU40 | NACHT, LRR and PYD domains-containing protein 4A | 2.37e-02 | NA | 0.002 |
| 3. B | Q9HC29 | Nucleotide-binding oligomerization domain-containing protein 2 | 2.36e-02 | NA | 1.01e-09 |
| 3. B | Q96MN2 | NACHT, LRR and PYD domains-containing protein 4 | 1.79e-02 | NA | 2.83e-04 |