Summary

Q8N5Q1

Homolog: Q6IPT2.
Function: Protein FAM71E1.

Statistics

Total GO Annotation: 153
Unique PROST Go: 150
Unique BLAST Go: 3

Total Homologs: 48
Unique PROST Homologs: 27
Unique BLAST Homologs: 13

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q6IPT2 (Protein FAM71E1) with a FATCAT P-Value: 0.000198 and RMSD of 3.06 angstrom. The sequence alignment identity is 7.3%.
Structural alignment shown in left. Query protein Q8N5Q1 colored as red in alignment, homolog Q6IPT2 colored as blue. Query protein Q8N5Q1 is also shown in right top, homolog Q6IPT2 showed in right bottom. They are colored based on secondary structures. 

  Q8N5Q1 ---------------------------------------------------------------MIWLRNRRCLEP-LQGT----PKWV---PVLG---EL 26
  Q6IPT2 MGPPLWPDLQEPPPPGTSSQIRSPLLCDVIKPAPHHDVTVRVVPPPRFLPLLLRPLPSDGDIAM---RRDRGPKPALGGAGEVEPGGMAASPT-GRPRRL 96

  Q8N5Q1 QKTLQKGEYLPLRPLPMFESNFVQV--------THQGGP--VFVNHRTNRLAMGVAASLPGLVLPDILLI-GQPAEDRDCSG-LVLTRMIPLDLVHLCVH 114
  Q6IPT2 QRYLQSGEFDQFRDFPIFESNFVQFCPDIYPAPTSDLWPQVTRLGEVANEVTMGVAASSPALELPDLLLLAG-PAKE---NGHLQLFGLFPLKFVQLFVH 192

  Q8N5Q1 DLSAWRLKLRLVSGRQYYLALDAP----DNEVGFLFHCWVRLI-NL--LQEPA-PTWTPRTTRTAPLDMPLAEAPASTWHLQDQPISRHAVRVAERNFPH 206
  Q6IPT2 DKSRCQLEVKLNTSRTFYLQLRAPLKTRDREFG----QWVRLLYRLRFLSASAVP-FTQE---------------------------------------- 247

  Q8N5Q1 KTVAAQRQRKAKALKRSFKSQAVGDSVPLIWSQLEHADVRKKPAEKKSHSDPRPDRTHTQIRLPEKTSITTWTIFSIISSTANQTQSSPKACTSASDEAT 306
  Q6IPT2 ---------------------------------------------------------------------------------------------------- 247

  Q8N5Q1 GQGHVVESPSHCVSADSPDGFFLGSCSSLDPCLWHQDTEDLMDSGGSTLSSAASGLAPYPPAACLSTPYSSIPRGREKAGPMGSHQGPGPPPCQKAPSGL 406
  Q6IPT2 ---------------------------------------------------------------------------------------------------- 247

  Q8N5Q1 VTSCKAPFLVDQSQKLPAVPASSWKPPPGLAPPQKAPAASAPPRKAPAVPAPSQKAPAVPAPSQKAPAIPAPSRKASAASASPRKASAVPAPPQKTPPPS 506
  Q6IPT2 ---------------------------------------------------------------------------------------------------- 247

  Q8N5Q1 QKAPSVPTIPQKAVSPTAPKKKSLLLPAPSQKALPTSPTEYQMALSPPASRGKLPGDFDVLPTGIPGRAVLERSQSGGKPEPVVTVRTQETDVVEMTTQA 606
  Q6IPT2 ---------------------------------------------------------------------------------------------------- 247

  Q8N5Q1 KSPESPFTVTKKESKDILISQTKEVTLEAFRGQGKLEDWAHWAKLEERSPDLPGVRSKELEQRKRWVKAKELAVEGPSQEHSRPFSVEALTLTKLMITAN 706
  Q6IPT2 ---------------------------------------------------------------------------------------------------- 247

  Q8N5Q1 SKEQPSKSALVSLPSWLLATPQASATSMMASVPSRPGQLSLLEGKPVVVREQPESHTWVKEGKRPWGEMKEQPWGEMKEPPWDPKGPPKVPFRSKPTSAS 806
  Q6IPT2 ---------------------------------------------------------------------------------------------------- 247

  Q8N5Q1 LKREGISQAPIPLTASPWEDLRPSPLSETLISKMEATARASQQPKRVSQEPMRMPAQHPLATVGSSSEILLPMLLELETVRNTATKAEEIQEESGVLNLL 906
  Q6IPT2 ---------------------------------------------------------------------------------------------------- 247

  Q8N5Q1 PSLQHSQHSEWPDAGA 922
  Q6IPT2 ---------------- 247

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0050680 negative regulation of epithelial cell proliferation
2. P GO:0005159 insulin-like growth factor receptor binding
2. P GO:0016055 Wnt signaling pathway
2. P GO:0032886 regulation of microtubule-based process
2. P GO:0010718 positive regulation of epithelial to mesenchymal transition
2. P GO:0030374 nuclear receptor coactivator activity
2. P GO:0050775 positive regulation of dendrite morphogenesis
2. P GO:0045177 apical part of cell
2. P GO:0032968 positive regulation of transcription elongation from RNA polymerase II promoter
2. P GO:0001934 positive regulation of protein phosphorylation
2. P GO:1903688 positive regulation of border follicle cell migration
2. P GO:0007285 primary spermatocyte growth
2. P GO:0010008 endosome membrane
2. P GO:0060250 germ-line stem-cell niche homeostasis
2. P GO:0090090 negative regulation of canonical Wnt signaling pathway
2. P GO:0048009 insulin-like growth factor receptor signaling pathway
2. P GO:0008307 structural constituent of muscle
2. P GO:2000298 regulation of Rho-dependent protein serine/threonine kinase activity
2. P GO:0050778 positive regulation of immune response
2. P GO:0001701 in utero embryonic development
2. P GO:0007409 axonogenesis
2. P GO:1990113 RNA polymerase I assembly
2. P GO:0048268 clathrin coat assembly
2. P GO:2001237 negative regulation of extrinsic apoptotic signaling pathway
2. P GO:0032091 negative regulation of protein binding
2. P GO:0048545 response to steroid hormone
2. P GO:0035159 regulation of tube length, open tracheal system
2. P GO:0030235 nitric-oxide synthase regulator activity
2. P GO:0019897 extrinsic component of plasma membrane
2. P GO:0055123 digestive system development
2. P GO:0005905 clathrin-coated pit
2. P GO:0007405 neuroblast proliferation
2. P GO:1990023 mitotic spindle midzone
2. P GO:0050769 positive regulation of neurogenesis
2. P GO:0045785 positive regulation of cell adhesion
2. P GO:0043066 negative regulation of apoptotic process
2. P GO:0030099 myeloid cell differentiation
2. P GO:0035264 multicellular organism growth
2. P GO:0007296 vitellogenesis
2. P GO:0098978 glutamatergic synapse
2. P GO:0046622 positive regulation of organ growth
2. P GO:0030511 positive regulation of transforming growth factor beta receptor signaling pathway
2. P GO:0071560 cellular response to transforming growth factor beta stimulus
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:0016323 basolateral plasma membrane
2. P GO:0001731 formation of translation preinitiation complex
2. P GO:0051256 mitotic spindle midzone assembly
2. P GO:0005667 transcription regulator complex
2. P GO:0030308 negative regulation of cell growth
2. P GO:0007588 excretion
2. P GO:0045930 negative regulation of mitotic cell cycle
2. P GO:0021670 lateral ventricle development
2. P GO:0001650 fibrillar center
2. P GO:0035091 phosphatidylinositol binding
2. P GO:0001042 RNA polymerase I core binding
2. P GO:0045296 cadherin binding
2. P GO:0010259 multicellular organism aging
2. P GO:0071425 hematopoietic stem cell proliferation
2. P GO:0045087 innate immune response
2. P GO:0050998 nitric-oxide synthase binding
2. P GO:0099150 regulation of postsynaptic specialization assembly
2. P GO:0048133 male germ-line stem cell asymmetric division
2. P GO:0046600 negative regulation of centriole replication
2. P GO:0042551 neuron maturation
2. P GO:1990393 3M complex
2. P GO:0030132 clathrin coat of coated pit
2. P GO:0038024 cargo receptor activity
2. P GO:0005730 nucleolus
2. P GO:0035615 clathrin adaptor activity
2. P GO:0016010 dystrophin-associated glycoprotein complex
2. P GO:0000904 cell morphogenesis involved in differentiation
2. P GO:1902746 regulation of lens fiber cell differentiation
2. P GO:0005876 spindle microtubule
2. P GO:0060766 negative regulation of androgen receptor signaling pathway
2. P GO:0031110 regulation of microtubule polymerization or depolymerization
2. P GO:0045294 alpha-catenin binding
2. P GO:0046662 regulation of oviposition
2. P GO:0060065 uterus development
2. P GO:0030136 clathrin-coated vesicle
2. P GO:0010847 regulation of chromatin assembly
2. P GO:0098974 postsynaptic actin cytoskeleton organization
2. P GO:0040017 positive regulation of locomotion
2. P GO:0008022 protein C-terminus binding
2. P GO:0006898 receptor-mediated endocytosis
2. P GO:0045664 regulation of neuron differentiation
2. P GO:0005178 integrin binding
2. P GO:0050750 low-density lipoprotein particle receptor binding
2. P GO:0061964 negative regulation of entry into reproductive diapause
2. P GO:0060391 positive regulation of SMAD protein signal transduction
2. P GO:0002218 activation of innate immune response
2. P GO:0060395 SMAD protein signal transduction
2. P GO:2000096 positive regulation of Wnt signaling pathway, planar cell polarity pathway
2. P GO:0030276 clathrin binding
2. P GO:0021849 neuroblast division in subventricular zone
2. P GO:0055120 striated muscle dense body
2. P GO:1990115 RNA polymerase III assembly
2. P GO:0030335 positive regulation of cell migration
2. P GO:0071364 cellular response to epidermal growth factor stimulus
2. P GO:0098534 centriole assembly
2. P GO:0007096 regulation of exit from mitosis
2. P GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
2. P GO:0001921 positive regulation of receptor recycling
2. P GO:0035686 sperm fibrous sheath
2. P GO:0070373 negative regulation of ERK1 and ERK2 cascade
2. P GO:1902074 response to salt
2. P GO:2001046 positive regulation of integrin-mediated signaling pathway
2. P GO:2000860 positive regulation of aldosterone secretion
2. P GO:0099149 regulation of postsynaptic neurotransmitter receptor internalization
2. P GO:0071514 genomic imprinting
2. P GO:0005158 insulin receptor binding
2. P GO:0005769 early endosome
2. P GO:0033234 negative regulation of protein sumoylation
2. P GO:0030665 clathrin-coated vesicle membrane
2. P GO:0007295 growth of a germarium-derived egg chamber
2. P GO:1990114 RNA polymerase II core complex assembly
2. P GO:0000278 mitotic cell cycle
2. P GO:0046332 SMAD binding
2. P GO:0005925 focal adhesion
2. P GO:0010862 positive regulation of pathway-restricted SMAD protein phosphorylation
2. P GO:0006915 apoptotic process
2. P GO:0000940 outer kinetochore
2. P GO:1903077 negative regulation of protein localization to plasma membrane
2. P GO:0035026 leading edge cell differentiation
2. P GO:0016575 histone deacetylation
2. P GO:0097228 sperm principal piece
2. P GO:0007088 regulation of mitotic nuclear division
2. P GO:0032349 positive regulation of aldosterone biosynthetic process
2. P GO:0045793 positive regulation of cell size
2. P GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
2. P GO:2000370 positive regulation of clathrin-dependent endocytosis
2. P GO:2000643 positive regulation of early endosome to late endosome transport
2. P GO:0007257 obsolete activation of JUN kinase activity
2. P GO:0045736 negative regulation of cyclin-dependent protein serine/threonine kinase activity
2. P GO:0034332 adherens junction organization
2. P GO:0005546 phosphatidylinositol-4,5-bisphosphate binding
2. P GO:0060487 lung epithelial cell differentiation
2. P GO:0060669 embryonic placenta morphogenesis
2. P GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
2. P GO:0035612 AP-2 adaptor complex binding
2. P GO:0045807 positive regulation of endocytosis
2. P GO:0000776 kinetochore
2. P GO:0042326 negative regulation of phosphorylation
2. P GO:0030900 forebrain development
2. P GO:0030862 positive regulation of polarized epithelial cell differentiation
2. P GO:0034059 response to anoxia
2. P GO:0008355 olfactory learning
2. P GO:0010897 negative regulation of triglyceride catabolic process
2. P GO:0008013 beta-catenin binding
2. P GO:0030325 adrenal gland development
2. P GO:0002092 positive regulation of receptor internalization
3. B GO:0030176 integral component of endoplasmic reticulum membrane
3. B GO:0005634 nucleus
3. B GO:0007165 signal transduction

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q66H38 Protein FAM71B 3.06e-02 2.87e-06 2.32e-19
1. PB Q8TC56 Protein FAM71B 2.25e-03 2.84e-06 7.36e-21
1. PB Q8N9W8 Protein FAM71D 1.26e-02 5.60e-04 5.31e-21
1. PB Q95K21 Protein FAM71A 3.09e-02 2.69e-05 1.90e-19
1. PB Q95K27 Protein FAM71D (Fragment) 3.90e-02 1.69e-04 6.94e-10
1. PB Q5STT6 Protein FAM71B 6.70e-04 8.06e-04 5.40e-20
1. PB Q8IYT1 Protein FAM71A 1.03e-02 1.57e-02 2.51e-20
1. PB Q8N5Q1 Protein FAM71E2 0 4.72e-146 0.0
2. P O88797 Disabled homolog 2 5.15e-02 1.57e-04 NA
2. P Q5RC41 RNA-binding protein 14 2.31e-02 5.40e-03 NA
2. P B3MPN6 Insulin receptor substrate 1 4.28e-02 8.67e-03 NA
2. P Q8STF6 Dystrophin-like protein 1 1.63e-01 1.50e-05 NA
2. P Q5XGC9 Serum response factor-binding protein 1 2.12e-01 4.90e-02 NA
2. P P49757 Protein numb homolog 2.71e-01 3.01e-06 NA
2. P Q8N9H9 Uncharacterized protein C1orf127 1.19e-01 1.17e-02 NA
2. P P98078 Disabled homolog 2 8.78e-02 2.19e-05 NA
2. P Q86UF4 Coiled-coil domain-containing protein 190 7.30e-01 1.65e-02 NA
2. P P49919 Cyclin-dependent kinase inhibitor 1C 7.49e-01 1.93e-03 NA
2. P Q8C2Q3 RNA-binding protein 14 9.32e-02 2.45e-02 NA
2. P Q6NU13 Protein SPT2 homolog 1.45e-01 6.93e-04 NA
2. P P62521 Coiled-coil domain-containing protein 8 1.24e-01 5.82e-03 NA
2. P Q95Y36 Cilia- and flagella-associated protein 36 1.33e-01 5.95e-04 NA
2. P Q9QZS3 Protein numb homolog 2.10e-01 3.14e-05 NA
2. P Q4V7A4 Fibrous sheath CABYR-binding protein 5.03e-02 1.16e-02 NA
2. P B1H1S4 Spindle and kinetochore-associated protein 3 2.20e-01 2.80e-02 NA
2. P A2A7S8 Uncharacterized protein KIAA1522 2.22e-01 2.79e-04 NA
2. P Q5EA36 RNA-binding protein 14 4.61e-02 7.18e-03 NA
2. P P98082 Disabled homolog 2 9.72e-02 1.03e-04 NA
2. P Q96PK6 RNA-binding protein 14 8.83e-02 5.82e-03 NA
2. P P43573 Bud site selection protein 27 7.08e-01 3.57e-03 NA
2. P Q8SXX4 Capon-like protein 5.15e-01 8.12e-03 NA
2. P Q2LC84 Protein numb homolog 5.71e-02 1.36e-04 NA
2. P B0BM16 Spindle and kinetochore-associated protein 3 4.26e-01 3.16e-02 NA
2. P A3KMW7 Microtubule-associated protein 10 5.54e-01 1.33e-02 NA
2. P Q80YD3 Protein FAM205C 4.37e-01 1.45e-03 NA
3. B Q8NEG0 Protein FAM71C 5.61e-03 NA 1.21e-21
3. B Q28298 Ribosome-binding protein 1 9.71e-01 NA 0.032
3. B Q32L49 Protein FAM71E1 1.46e-03 NA 3.55e-16
3. B A1L3C1 Protein FAM71E1 2.90e-03 NA 2.55e-16
3. B Q6NXP2 Protein FAM71F2 2.07e-02 NA 4.76e-08
3. B Q68FV5 Protein FAM71F1 2.30e-02 NA 1.60e-08
3. B Q2YDE8 Protein FAM71D 3.36e-03 NA 7.52e-25
3. B Q2KIP3 Protein FAM71F1 3.12e-02 NA 3.31e-12
3. B Q96KD3 Protein FAM71F1 4.57e-02 NA 1.95e-11
3. B Q6IPT2 Protein FAM71E1 1.98e-04 NA 2.52e-11
3. B Q3UZD7 Protein FAM71F1 2.57e-02 NA 4.24e-10
3. B Q5RJN7 Protein FAM71F2 4.88e-02 NA 4.96e-12
3. B Q4R323 Protein FAM71C 1.06e-02 NA 6.91e-21