Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q64364
(Tumor suppressor ARF) with a FATCAT P-Value: 0.000428 and RMSD of 2.71 angstrom. The sequence alignment identity is 40.4%.
Structural alignment shown in left. Query protein Q8N726 colored as red in alignment, homolog Q64364 colored as blue.
Query protein Q8N726 is also shown in right top, homolog Q64364 showed in right bottom. They are colored based on secondary structures.
Q8N726 MVRRFLVTLRIRRACGPP-RVRVFVVHI-----PRLTGEWAAPGAPAAVALVLMLLRSQRL---GQQPLPRR---PGHDDGQRPSGGAAAAPR-RGAQLR 87 Q64364 MGRRFLVTVRIQRA-GRPLQERVFLVKFVRSRRPR-T-------ASCALAFVNMLLRLERILRRG----PHRNPGPGDDDGQRSRSSSSAQLRCR-FELR 86 Q8N726 RPRHSHPTRARRCPGGLPGHAGGAAPGRGAAGRARCLG-PSAR-GP--G---------------------------------- 132 Q64364 GPHYLLPPGARRSAGRLPGHAGGAARVRGSAGCARCLGSPAARLGPRAGTSRHRAIFAFRWVLFVFRWVVFVYRWERRPDRRA 169
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0071333 | cellular response to glucose stimulus |
| 1. PB | GO:0061771 | response to caloric restriction |
| 1. PB | GO:1902510 | regulation of apoptotic DNA fragmentation |
| 1. PB | GO:0033088 | negative regulation of immature T cell proliferation in thymus |
| 1. PB | GO:0000082 | G1/S transition of mitotic cell cycle |
| 1. PB | GO:0010389 | regulation of G2/M transition of mitotic cell cycle |
| 1. PB | GO:2000346 | negative regulation of hepatocyte proliferation |
| 1. PB | GO:0090398 | cellular senescence |
| 1. PB | GO:0070534 | protein K63-linked ubiquitination |
| 1. PB | GO:0008637 | apoptotic mitochondrial changes |
| 1. PB | GO:0090399 | replicative senescence |
| 1. PB | GO:0019789 | SUMO transferase activity |
| 1. PB | GO:0060058 | positive regulation of apoptotic process involved in mammary gland involution |
| 1. PB | GO:0035986 | obsolete senescence-associated heterochromatin focus assembly |
| 1. PB | GO:0046822 | regulation of nucleocytoplasmic transport |
| 1. PB | GO:0045786 | negative regulation of cell cycle |
| 1. PB | GO:1903214 | regulation of protein targeting to mitochondrion |
| 1. PB | GO:0021549 | cerebellum development |
| 1. PB | GO:0051882 | mitochondrial depolarization |
| 1. PB | GO:1904667 | negative regulation of ubiquitin protein ligase activity |
| 1. PB | GO:0006919 | activation of cysteine-type endopeptidase activity involved in apoptotic process |
| 1. PB | GO:0010243 | response to organonitrogen compound |
| 1. PB | GO:1990948 | ubiquitin ligase inhibitor activity |
| 1. PB | GO:2000111 | positive regulation of macrophage apoptotic process |
| 1. PB | GO:0070542 | response to fatty acid |
| 1. PB | GO:0033600 | negative regulation of mammary gland epithelial cell proliferation |
| 1. PB | GO:0097371 | MDM2/MDM4 family protein binding |
| 1. PB | GO:0008285 | negative regulation of cell population proliferation |
| 1. PB | GO:0000079 | regulation of cyclin-dependent protein serine/threonine kinase activity |
| 1. PB | GO:0070301 | cellular response to hydrogen peroxide |
| 1. PB | GO:0034393 | positive regulation of smooth muscle cell apoptotic process |
| 1. PB | GO:0007265 | Ras protein signal transduction |
| 1. PB | GO:0055105 | ubiquitin-protein transferase inhibitor activity |
| 1. PB | GO:0000209 | protein polyubiquitination |
| 1. PB | GO:1900182 | positive regulation of protein localization to nucleus |
| 1. PB | GO:0035985 | senescence-associated heterochromatin focus |
| 1. PB | GO:0043065 | positive regulation of apoptotic process |
| 1. PB | GO:1903051 | negative regulation of proteolysis involved in cellular protein catabolic process |
| 1. PB | GO:0051059 | NF-kappaB binding |
| 1. PB | GO:0032091 | negative regulation of protein binding |
| 1. PB | GO:0032991 | protein-containing complex |
| 1. PB | GO:0033235 | positive regulation of protein sumoylation |
| 1. PB | GO:0009303 | rRNA transcription |
| 1. PB | GO:0097718 | disordered domain specific binding |
| 1. PB | GO:2000059 | negative regulation of ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0051090 | regulation of DNA-binding transcription factor activity |
| 1. PB | GO:0047485 | protein N-terminus binding |
| 1. PB | GO:1990000 | amyloid fibril formation |
| 1. PB | GO:0004861 | cyclin-dependent protein serine/threonine kinase inhibitor activity |
| 1. PB | GO:0030889 | negative regulation of B cell proliferation |
| 1. PB | GO:0006364 | rRNA processing |
| 1. PB | GO:0007569 | cell aging |
| 1. PB | GO:0002039 | p53 binding |
| 1. PB | GO:0051726 | regulation of cell cycle |
| 1. PB | GO:0046825 | regulation of protein export from nucleus |
| 1. PB | GO:0031647 | regulation of protein stability |
| 1. PB | GO:0022008 | neurogenesis |
| 1. PB | GO:0045736 | negative regulation of cyclin-dependent protein serine/threonine kinase activity |
| 1. PB | GO:0001953 | negative regulation of cell-matrix adhesion |
| 1. PB | GO:0008544 | epidermis development |
| 1. PB | GO:0006469 | negative regulation of protein kinase activity |
| 1. PB | GO:1901798 | positive regulation of signal transduction by p53 class mediator |
| 1. PB | GO:0031648 | protein destabilization |
| 1. PB | GO:0042326 | negative regulation of phosphorylation |
| 1. PB | GO:2000435 | negative regulation of protein neddylation |
| 1. PB | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 1. PB | GO:0005730 | nucleolus |
| 1. PB | GO:0014070 | response to organic cyclic compound |
| 1. PB | GO:0035019 | somatic stem cell population maintenance |
| 1. PB | GO:0001652 | granular component |
| 1. PB | GO:0043517 | positive regulation of DNA damage response, signal transduction by p53 class mediator |
| 1. PB | GO:0051444 | negative regulation of ubiquitin-protein transferase activity |
| 1. PB | GO:0048103 | somatic stem cell division |
| 1. PB | GO:2000774 | positive regulation of cellular senescence |
| 2. P | GO:0005778 | peroxisomal membrane |
| 2. P | GO:0006915 | apoptotic process |
| 2. P | GO:0010033 | response to organic substance |
| 3. B | GO:0019901 | protein kinase binding |
| 3. B | GO:0051091 | positive regulation of DNA-binding transcription factor activity |
| 3. B | GO:0010628 | positive regulation of gene expression |
| 3. B | GO:0007568 | aging |
| 3. B | GO:0042493 | |
| 3. B | GO:0045893 | positive regulation of transcription, DNA-templated |
| 3. B | GO:0000422 | autophagy of mitochondrion |
| 3. B | GO:0050821 | protein stabilization |
| 3. B | GO:0042593 | glucose homeostasis |
| 3. B | GO:0010468 | regulation of gene expression |
| 3. B | GO:0030308 | negative regulation of cell growth |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | O77618 | Tumor suppressor ARF | 1.29e-02 | 2.23e-10 | 1.66e-14 |
| 1. PB | Q8QZZ9 | Tumor suppressor ARF | 7.30e-04 | 7.53e-06 | 2.25e-24 |
| 1. PB | Q8N726 | Tumor suppressor ARF | 0 | 3.03e-151 | 9.93e-84 |
| 2. P | Q54340 | Aminopeptidase G (Fragment) | 9.54e-03 | 2.35e-03 | NA |
| 2. P | B2GHI7 | Putative hydro-lyase KRH_21160 | 4.16e-01 | 1.71e-02 | NA |
| 2. P | Q52M75 | Putative uncharacterized protein encoded by LINC01554 | 1.35e-01 | 3.67e-03 | NA |
| 2. P | Q69UD7 | Acyl transferase 8 | 5.44e-01 | 3.23e-02 | NA |
| 2. P | Q03352 | Antithrombin-III (Fragment) | 2.28e-01 | 4.46e-02 | NA |
| 2. P | Q6GZR9 | Uncharacterized protein 056R | NA | 3.23e-04 | NA |
| 2. P | P45817 | Peroxisomal biogenesis factor 9 | 3.42e-01 | 3.49e-02 | NA |
| 3. B | Q64364 | Tumor suppressor ARF | 4.28e-04 | NA | 2.83e-14 |