Summary

Q8N7L0

Homolog: Q8CC14.
Function: Protein FAM216B.

Statistics

Total GO Annotation: 18
Unique PROST Go: 18
Unique BLAST Go: 0

Total Homologs: 20
Unique PROST Homologs: 14
Unique BLAST Homologs: 3

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8CC14 (Protein FAM216B) with a FATCAT P-Value: 9.5e-11 and RMSD of 3.08 angstrom. The sequence alignment identity is 55.8%.
Structural alignment shown in left. Query protein Q8N7L0 colored as red in alignment, homolog Q8CC14 colored as blue. Query protein Q8N7L0 is also shown in right top, homolog Q8CC14 showed in right bottom. They are colored based on secondary structures. 

  Q8N7L0 MGQNWKRQQKL-WNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKV 99
  Q8CC14 M---WK---DLPQNVPRIPRIQVPAAAADNSLLKDLNQGQRCYLYSIMRIYDSRPQWKALQTRYIHSLGYQQHLGYITQQEALSCAAVLRHSTMRASATV 94

  Q8N7L0 APQRTI-PRKTSAMTRRCPSVLPVSVVLPRAQSKRRQVLRN------ 139
  Q8CC14 APQRTILPRVFSHAKKGQPAK-PGFRVGSRA--SLHSMLSTKTLDKA 138

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0042025 host cell nucleus
2. P GO:0039503 suppression by virus of host innate immune response
2. P GO:0016032 viral process
2. P GO:0009399 nitrogen fixation
2. P GO:0043410 positive regulation of MAPK cascade
2. P GO:0033617 mitochondrial cytochrome c oxidase assembly
2. P GO:0019033 viral tegument
2. P GO:0019028 viral capsid
2. P GO:0030001 metal ion transport
2. P GO:0007049 cell cycle
2. P GO:0044220 host cell perinuclear region of cytoplasm
2. P GO:0005758 mitochondrial intermembrane space
2. P GO:0000187 obsolete activation of MAPK activity
2. P GO:0019048 modulation by virus of host process
2. P GO:0060967 negative regulation of gene silencing by RNA
2. P GO:0044177 host cell Golgi apparatus
2. P GO:0019058 viral life cycle
2. P GO:0005507 copper ion binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8CC14 Protein FAM216B 9.50e-11 1.02e-16 6.74e-41
1. PB Q8N7L0 Protein FAM216B 0 7.39e-144 4.26e-98
1. PB Q17QP0 Protein FAM216B 7.20e-10 1.77e-14 6.47e-61
2. P Q9DXE9 Protein V2 NA 3.50e-05 NA
2. P Q5R8D4 Arginine vasopressin-induced protein 1 5.12e-02 6.64e-03 NA
2. P Q01047 Small capsomere-interacting protein NA 1.62e-06 NA
2. P Q3SZR0 Arginine vasopressin-induced protein 1 9.30e-02 5.83e-03 NA
2. P Q85227 Tegument protein UL51 NA 7.11e-04 NA
2. P Q66633 Uncharacterized gene 30 protein NA 2.65e-02 NA
2. P P0CM86 Cytochrome c oxidase assembly protein COX19 1.29e-01 4.48e-02 NA
2. P P36282 Protein V2 NA 2.04e-04 NA
2. P Q9D7H4 Arginine vasopressin-induced protein 1 1.07e-01 7.49e-03 NA
2. P Q5NLF0 Nitrogenase-stabilizing/protective protein NifW 1.45e-02 1.91e-02 NA
2. P P0CM87 Cytochrome c oxidase assembly protein COX19 5.98e-02 4.48e-02 NA
2. P Q8VDA6 Arginine vasopressin-induced protein 1 3.99e-02 8.88e-03 NA
2. P Q6CL21 Transcription factor NRM1 5.90e-03 4.44e-02 NA
2. P Q02842 Protein Vpx NA 1.21e-03 NA
3. B Q8WUB2 Protein FAM216A 1.12e-02 NA 4.99e-05
3. B Q9DB54 Protein FAM216A 1.99e-02 NA 4.55e-05
3. B Q5U1Y9 Protein FAM216A 2.46e-02 NA 1.39e-05