Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
Q27905
(Probable antibacterial peptide polyprotein) with a FATCAT P-Value: 2.59e-08 and RMSD of 3.10 angstrom. The sequence alignment identity is 24.6%.
Structural alignment shown in left. Query protein Q8N7P7 colored as red in alignment, homolog Q27905 colored as blue.
Query protein Q8N7P7 is also shown in right top, homolog Q27905 showed in right bottom. They are colored based on secondary structures.
Q8N7P7 --------------------------------------------------------------MTAVSSNRNPEDDGCLLEQ----EP--RGRR------- 25 Q27905 MRSPRVIHLACVIAYIVAVEAGDKPVYLPRPTPPRPIHPRLAREVGWELEGQGLSPLSEAELLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESE 100 Q8N7P7 LSPRTGTPRTTAVSSNRDPKNDGCLLKQ----EP--RGRR-------LSPRTGAPGTTAVSSNRNPEDDGCLLKQ----EP--RGRR-------LSPQTG 99 Q27905 LSPLSVAEVLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEAEVLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRVASLESELSPLSE 200 Q8N7P7 TPRTTAVSSNRNPGDDGCLL-KQGP-----RGRR-------LSPQT---GTPGTTAVSSNRNPEDDGCLLKQ----EP--RGRR-------LSPQTGTPG 170 Q27905 AEVLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEEEVLP---EVRERGSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSVAED 297 Q8N7P7 TTAVSSNRDHEDDGCLLKQES------RGRR-------LSPQTGTPGTTAVSSNRNPEDDGCLLKQES------RGRR-------LSPQTGTPGTTAVSS 244 Q27905 LPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEAEVLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEAEVLPEVRE 397 Q8N7P7 NRDPEDDGCLL-KQGP-----RGRR-------LSPQTGTPRTTAVSSNRNPEDDGCLL-KQGP-----RGRR-------LSPQT---GIPRTTAVSSNRD 315 Q27905 RRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEAEVLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEAEVLP---EVRERRS 494 Q8N7P7 PGEDGCLLKQES------RGRR-------LSPQTGTTRTTAVSSKRNPEDDGCLLKQ----EP--RGRR-------LSSLTGAPGTTAVSSNR---D--- 383 Q27905 PVDKGGYLPRPTPPRPVYRSRRDATLESELSPSSEAEVLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEAEVLPEVRERRSPVDKGG 594 Q8N7P7 --PRTT---AVSSNRNPGDDGCL---LK-----QG-P--RGRRLSP--QTG-----TPGTTAVSSNRD--------PEDDGCLLKQEPQELRKPEADTAL 452 Q27905 YLPRPTPPRPVYRSRR---DASLESELSPLSEAEGLPEVRERR-SPGGQGGYLPRPTPRTPLCRSRRDANLDAEQSPVSEGVVL---P-EVR-------- 678 Q8N7P7 452 Q27905 678
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0033621 | nuclear-transcribed mRNA catabolic process, meiosis-specific transcripts |
| 2. P | GO:2000781 | positive regulation of double-strand break repair |
| 2. P | GO:0051656 | establishment of organelle localization |
| 2. P | GO:0007594 | puparial adhesion |
| 2. P | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 2. P | GO:0043710 | cell adhesion involved in multi-species biofilm formation |
| 2. P | GO:0030844 | positive regulation of intermediate filament depolymerization |
| 2. P | GO:0030216 | keratinocyte differentiation |
| 2. P | GO:0021888 | hypothalamus gonadotrophin-releasing hormone neuron development |
| 2. P | GO:0045095 | keratin filament |
| 2. P | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 2. P | GO:1900006 | positive regulation of dendrite development |
| 2. P | GO:0005796 | Golgi lumen |
| 2. P | GO:0031625 | ubiquitin protein ligase binding |
| 2. P | GO:1902255 | positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator |
| 2. P | GO:0047497 | mitochondrion transport along microtubule |
| 2. P | GO:0042790 | nucleolar large rRNA transcription by RNA polymerase I |
| 2. P | GO:0043209 | myelin sheath |
| 2. P | GO:0090281 | negative regulation of calcium ion import |
| 2. P | GO:0031589 | cell-substrate adhesion |
| 2. P | GO:0031297 | replication fork processing |
| 2. P | GO:0000128 | flocculation |
| 2. P | GO:0007141 | male meiosis I |
| 2. P | GO:0016567 | protein ubiquitination |
| 2. P | GO:0007218 | neuropeptide signaling pathway |
| 2. P | GO:0019042 | viral latency |
| 2. P | GO:0048012 | hepatocyte growth factor receptor signaling pathway |
| 2. P | GO:0035096 | larval midgut cell programmed cell death |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0005634 | nucleus |
| 2. P | GO:0051881 | regulation of mitochondrial membrane potential |
| 2. P | GO:0045179 | apical cortex |
| 2. P | GO:0009530 | primary cell wall |
| 2. P | GO:0050817 | coagulation |
| 2. P | GO:0031640 | killing of cells of another organism |
| 2. P | GO:0090307 | mitotic spindle assembly |
| 2. P | GO:1901214 | regulation of neuron death |
| 2. P | GO:0009986 | cell surface |
| 2. P | GO:0009277 | fungal-type cell wall |
| 2. P | GO:0050769 | positive regulation of neurogenesis |
| 2. P | GO:1902527 | positive regulation of protein monoubiquitination |
| 2. P | GO:0007144 | female meiosis I |
| 2. P | GO:0005199 | structural constituent of cell wall |
| 2. P | GO:0075341 | host cell PML body |
| 2. P | GO:0110148 | biomineralization |
| 2. P | GO:1901318 | negative regulation of flagellated sperm motility |
| 2. P | GO:0001533 | cornified envelope |
| 2. P | GO:0005737 | cytoplasm |
| 2. P | GO:0009751 | response to salicylic acid |
| 2. P | GO:0008585 | female gonad development |
| 2. P | GO:0050825 | ice binding |
| 2. P | GO:0018149 | peptide cross-linking |
| 2. P | GO:0000182 | rDNA binding |
| 2. P | GO:0060613 | fat pad development |
| 2. P | GO:0019215 | intermediate filament binding |
| 2. P | GO:0039695 | DNA-templated viral transcription |
| 2. P | GO:0004857 | enzyme inhibitor activity |
| 2. P | GO:0002020 | protease binding |
| 2. P | GO:0097009 | energy homeostasis |
| 2. P | GO:0048812 | neuron projection morphogenesis |
| 2. P | GO:0039588 | suppression by virus of host antigen processing and presentation |
| 2. P | GO:0075342 | disruption by symbiont of host cell PML body |
| 2. P | GO:0032880 | regulation of protein localization |
| 2. P | GO:0031424 | keratinization |
| 2. P | GO:0106333 | subcortical maternal complex |
| 2. P | GO:0031386 | protein tag |
| 2. P | GO:0031225 | anchored component of membrane |
| 2. P | GO:0009664 | plant-type cell wall organization |
| 2. P | GO:0003729 | mRNA binding |
| 2. P | GO:0009737 | response to abscisic acid |
| 2. P | GO:0022408 | negative regulation of cell-cell adhesion |
| 2. P | GO:0018153 | isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine |
| 2. P | GO:0020016 | ciliary pocket |
| 2. P | GO:0039503 | suppression by virus of host innate immune response |
| 2. P | GO:0001042 | RNA polymerase I core binding |
| 2. P | GO:0020003 | symbiont-containing vacuole |
| 2. P | GO:0061136 | regulation of proteasomal protein catabolic process |
| 2. P | GO:1905168 | positive regulation of double-strand break repair via homologous recombination |
| 2. P | GO:0040024 | dauer larval development |
| 2. P | GO:0002168 | instar larval development |
| 2. P | GO:0001520 | outer dense fiber |
| 2. P | GO:0072520 | seminiferous tubule development |
| 2. P | GO:0110143 | magnetosome |
| 2. P | GO:0019941 | modification-dependent protein catabolic process |
| 2. P | GO:0030280 | structural constituent of skin epidermis |
| 2. P | GO:1900005 | positive regulation of serine-type endopeptidase activity |
| 2. P | GO:0040019 | positive regulation of embryonic development |
| 2. P | GO:0010224 | response to UV-B |
| 2. P | GO:0005537 | mannose binding |
| 2. P | GO:0062130 | adhesive extracellular matrix |
| 2. P | GO:0005882 | intermediate filament |
| 2. P | GO:0010227 | floral organ abscission |
| 2. P | GO:0060612 | adipose tissue development |
| 2. P | GO:0004791 | thioredoxin-disulfide reductase activity |
| 2. P | GO:0061187 | regulation of ribosomal DNA heterochromatin assembly |
| 2. P | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 2. P | GO:0042742 | defense response to bacterium |
| 2. P | GO:0050819 | negative regulation of coagulation |
| 2. P | GO:0042628 | mating plug formation |
| 2. P | GO:0008584 | male gonad development |
| 2. P | GO:0031076 | embryonic camera-type eye development |
| 2. P | GO:0033018 | sarcoplasmic reticulum lumen |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8N7P7 | Uncharacterized protein FLJ40521 | 0 | 8.41e-142 | 0.0 |
| 2. P | A1X158 | Foot protein 1 variant 1 | 2.14e-02 | 6.92e-08 | NA |
| 2. P | Q5SF96 | Appendage-associated protein | 9.64e-01 | 3.59e-03 | NA |
| 2. P | P17437 | Skin secretory protein xP2 | 8.58e-01 | 1.01e-05 | NA |
| 2. P | P24710 | Involucrin | 9.15e-01 | 3.65e-06 | NA |
| 2. P | P0CG66 | Polyubiquitin-C | 9.96e-01 | 7.51e-03 | NA |
| 2. P | P0CH27 | Ubiquitin-60S ribosomal protein L40 | 9.87e-01 | 2.34e-08 | NA |
| 2. P | P18899 | Stress protein DDR48 | 9.11e-01 | 7.68e-04 | NA |
| 2. P | A0A1D8PQ86 | Agglutinin-like protein 9 | 9.44e-01 | 3.42e-03 | NA |
| 2. P | A6NKU9 | Speedy protein E3 | 9.06e-01 | 6.82e-06 | NA |
| 2. P | Q2W8Q7 | Magnetosome-associated protein MamJ | 6.58e-01 | 5.49e-04 | NA |
| 2. P | Q86VQ3 | Thioredoxin domain-containing protein 2 | 9.41e-01 | 1.52e-03 | NA |
| 2. P | Q7T3L1 | Kininogen-1a | 2.41e-02 | 8.33e-03 | NA |
| 2. P | Q9DH90 | Uncharacterized gene 81 protein | NA | 1.11e-04 | NA |
| 2. P | Q1EC66 | Polyubiquitin 3 | 9.90e-01 | 2.85e-09 | NA |
| 2. P | P08462 | Submandibular gland secretory Glx-rich protein CB | 7.92e-01 | 3.52e-02 | NA |
| 2. P | O96790 | Serine protease inhibitor dipetalogastin (Fragment) | 9.96e-01 | 3.02e-03 | NA |
| 2. P | O88492 | Perilipin-4 | 2.95e-06 | 1.23e-03 | NA |
| 2. P | P18128 | Uncharacterized 26.4 kDa protein | 1.08e-01 | 5.00e-02 | NA |
| 2. P | P69325 | Polyubiquitin | 9.79e-01 | 4.49e-08 | NA |
| 2. P | Q03650 | Cysteine-rich, acidic integral membrane protein | 2.58e-02 | 1.32e-05 | NA |
| 2. P | O08884 | Keratin-associated protein 6-2 | 8.20e-04 | 8.93e-04 | NA |
| 2. P | P13826 | Circumsporozoite protein (Fragment) | 1.05e-01 | 5.69e-06 | NA |
| 2. P | P17941 | Involucrin | 9.97e-01 | 2.56e-05 | NA |
| 2. P | Q63429 | Polyubiquitin-C | 9.85e-01 | 2.64e-07 | NA |
| 2. P | P07476 | Involucrin | 1.51e-02 | 1.44e-04 | NA |
| 2. P | P0CG62 | Polyubiquitin-B | 9.76e-01 | 1.20e-07 | NA |
| 2. P | Q4ZJY7 | Mucin-like protein Glc1.8b | NA | 5.19e-12 | NA |
| 2. P | Q00725 | Salivary glue protein Sgs-4 | 7.02e-01 | 4.74e-02 | NA |
| 2. P | P18175 | Involucrin | 9.51e-01 | 4.57e-03 | NA |
| 2. P | Q03400 | S-antigen protein | 3.19e-04 | 3.19e-04 | NA |
| 2. P | P0CG50 | Polyubiquitin-C | 9.90e-01 | 2.26e-07 | NA |
| 2. P | Q6L8H4 | Keratin-associated protein 5-1 | 8.31e-01 | 3.61e-06 | NA |
| 2. P | P62976 | Polyubiquitin | 9.95e-01 | 4.04e-10 | NA |
| 2. P | Q9URU4 | Putative cell agglutination protein pfl5 | 8.30e-03 | 5.90e-04 | NA |
| 2. P | Q9BYQ5 | Keratin-associated protein 4-6 | 9.89e-01 | 8.18e-03 | NA |
| 2. P | Q25460 | Adhesive plaque matrix protein (Fragment) | 1.40e-03 | 2.06e-04 | NA |
| 2. P | Q5GC92 | Maximins-S type B/C | 9.96e-01 | 4.71e-05 | NA |
| 2. P | Q6RY98 | Long-sarafotoxin (Fragment) | 6.68e-03 | 1.21e-16 | NA |
| 2. P | O70559 | Small proline-rich protein 2H | 8.65e-01 | 4.48e-04 | NA |
| 2. P | A6NJ88 | Putative SAGE1-like protein | 3.97e-03 | 9.07e-03 | NA |
| 2. P | E5AV36 | Burkholderia TALE-like protein 1 | 1.00e+00 | 1.01e-02 | NA |
| 2. P | P08676 | Circumsporozoite protein | 9.66e-01 | 2.04e-03 | NA |
| 2. P | Q8CIT9 | Suprabasin | 1.08e-02 | 3.20e-03 | NA |
| 2. P | A8MUU9 | Putative uncharacterized protein ENSP00000383309 | 8.18e-01 | 1.44e-14 | NA |
| 2. P | P24711 | Involucrin | 9.40e-01 | 2.84e-06 | NA |
| 2. P | P24712 | Involucrin | 9.91e-01 | 1.10e-02 | NA |
| 2. P | P0CG51 | Polyubiquitin-B | 9.80e-01 | 1.20e-07 | NA |
| 2. P | E2RYF6 | Mucin-22 | 2.41e-01 | 7.09e-03 | NA |
| 2. P | P0CG80 | Polyubiquitin-I | 9.79e-01 | 3.12e-09 | NA |
| 2. P | Q9XVS4 | Nucleolar protein dao-5 | 9.68e-01 | 4.40e-03 | NA |
| 2. P | A6QQF6 | Suprabasin | 9.51e-03 | 4.86e-07 | NA |
| 2. P | P0CG82 | Polyubiquitin | 9.86e-01 | 6.18e-09 | NA |
| 2. P | P19837 | Spidroin-1 (Fragment) | 6.89e-01 | 3.20e-03 | NA |
| 2. P | P69322 | Polyubiquitin | 9.87e-01 | 1.95e-09 | NA |
| 2. P | P69309 | Polyubiquitin | 9.81e-01 | 1.86e-07 | NA |
| 2. P | Q5UP11 | Putative ankyrin repeat protein R848 | NA | 3.88e-05 | NA |
| 2. P | Q3E7T8 | Polyubiquitin 14 | 9.82e-01 | 4.49e-08 | NA |
| 2. P | E5AW45 | Burkholderia TALE-like protein 2 | 1.00e+00 | 1.90e-06 | NA |
| 2. P | Q6ZQT0 | Putative uncharacterized protein FLJ45035 | 7.60e-01 | 3.99e-03 | NA |
| 2. P | P59669 | Polyubiquitin | 9.83e-01 | 2.20e-05 | NA |
| 2. P | P08674 | Circumsporozoite protein | 2.33e-02 | 5.90e-04 | NA |
| 2. P | O46383 | Sodium/potassium/calcium exchanger 1 (Fragment) | 9.11e-02 | 1.28e-02 | NA |
| 2. P | P14708 | Involucrin | 1.97e-03 | 3.61e-06 | NA |
| 2. P | Q9SKP0 | Late embryogenesis abundant protein ECP63 | 9.77e-01 | 1.21e-02 | NA |
| 2. P | P0CG81 | Polyubiquitin-H | 9.86e-01 | 1.75e-10 | NA |
| 2. P | Q25060 | LWamide neuropeptides | 2.13e-01 | 2.65e-06 | NA |
| 2. P | P08672 | Circumsporozoite protein | 8.40e-01 | 4.89e-03 | NA |
| 2. P | Q6L8H1 | Keratin-associated protein 5-4 | 1.64e-01 | 5.72e-05 | NA |
| 2. P | P18729 | Gastrula zinc finger protein XlCGF57.1 (Fragment) | 9.99e-01 | 4.39e-11 | NA |
| 2. P | P81592 | Acaloleptin A | 8.70e-02 | 1.15e-12 | NA |
| 2. P | P0CG68 | Polyubiquitin-C | 9.89e-01 | 4.75e-06 | NA |
| 2. P | Q9D9R9 | Protein FAM186A | 2.28e-01 | 1.56e-02 | NA |
| 2. P | P0CG24 | Zinc finger protein 883 | 9.98e-01 | 3.05e-02 | NA |
| 2. P | P0CG64 | Polyubiquitin-C | 9.95e-01 | 2.00e-02 | NA |
| 2. P | P0CG55 | Polyubiquitin-B | 9.83e-01 | 6.85e-07 | NA |
| 2. P | P0CG49 | Polyubiquitin-B | 9.77e-01 | 1.20e-07 | NA |
| 2. P | P42740 | Polyubiquitin | 9.88e-01 | 2.98e-05 | NA |
| 2. P | Q8N1N5 | Putative protein CRIPAK | 5.30e-04 | 4.64e-11 | NA |
| 2. P | O24006 | Antimicrobial peptides | 9.89e-01 | 7.51e-03 | NA |
| 2. P | P02851 | Balbiani ring protein 2 (Fragment) | 8.91e-01 | 6.85e-07 | NA |
| 2. P | Q5GC91 | Maximins-S type D | 9.94e-01 | 1.43e-02 | NA |
| 2. P | Q03110 | Circumsporozoite protein | 9.79e-01 | 1.42e-02 | NA |
| 2. P | Q6P902 | Thioredoxin domain-containing protein 2 | 8.37e-01 | 2.13e-04 | NA |
| 2. P | Q1HVI8 | Epstein-Barr nuclear antigen leader protein | NA | 4.87e-20 | NA |
| 2. P | P16230 | Sarcoplasmic reticulum histidine-rich calcium-binding protein | 9.50e-01 | 8.26e-06 | NA |
| 2. P | P0CG76 | Polyubiquitin-A | 9.85e-01 | 1.08e-11 | NA |
| 2. P | Q5UPA0 | Putative ankyrin repeat protein L25 | NA | 1.09e-03 | NA |
| 2. P | Q8H159 | Polyubiquitin 10 | 9.89e-01 | 3.96e-05 | NA |
| 2. P | C0HL89 | Lectin SfL-1 | 9.80e-01 | 5.50e-06 | NA |
| 2. P | O09116 | Small proline-rich protein 3 | 3.70e-02 | 1.15e-02 | NA |
| 2. P | P11006 | Magainins | 9.97e-01 | 7.83e-04 | NA |
| 2. P | P10163 | Basic salivary proline-rich protein 4 | 7.73e-01 | 1.52e-03 | NA |
| 2. P | P0CG75 | Polyubiquitin | 9.88e-01 | 2.23e-07 | NA |
| 2. P | Q8MKD1 | Polyubiquitin-B | 9.74e-01 | 1.14e-07 | NA |
| 2. P | Q2KI51 | Protein phosphatase 1 regulatory subunit 15A | 9.58e-01 | 2.28e-02 | NA |
| 2. P | Q9QJ13 | Protein B8 | NA | 1.49e-05 | NA |
| 2. P | P42739 | Polyubiquitin (Fragment) | 9.87e-01 | 3.87e-06 | NA |
| 2. P | P08677 | Circumsporozoite protein | 8.95e-01 | 1.52e-02 | NA |
| 2. P | Q9FS16 | Extensin-3 | 8.33e-01 | 2.97e-04 | NA |
| 2. P | E5AW43 | Burkholderia TALE-like protein 3 | 9.99e-01 | 3.39e-03 | NA |
| 2. P | P82003 | Prothoracicostatic peptide | 9.70e-01 | 3.99e-03 | NA |
| 2. P | P0CG61 | Polyubiquitin-C | 9.97e-01 | 2.00e-02 | NA |
| 2. P | P05143 | Proline-rich protein 2 | 7.63e-01 | 4.48e-04 | NA |
| 2. P | Q8AZK7 | Epstein-Barr nuclear antigen leader protein | NA | 2.64e-20 | NA |
| 2. P | P0CG79 | Polyubiquitin-G | 9.85e-01 | 2.45e-10 | NA |
| 2. P | P20481 | Buccalin | 9.32e-03 | 6.28e-11 | NA |
| 2. P | P0CG88 | Polyubiquitin-J | 9.81e-01 | 3.12e-09 | NA |
| 2. P | P04280 | Basic salivary proline-rich protein 1 | 9.23e-01 | 4.21e-11 | NA |
| 2. P | P46525 | Cold-shock protein CS120 | 9.46e-01 | 4.87e-10 | NA |
| 2. P | P0CG53 | Polyubiquitin-B | 9.68e-01 | 8.74e-08 | NA |
| 2. P | Q86MA7 | Protein PRQFV-amide | 2.47e-03 | 3.36e-03 | NA |
| 2. P | P21787 | Microtubule-associated protein P320 (Fragment) | 1.11e-05 | 7.36e-10 | NA |
| 2. P | V6F519 | Magnetosome-associated protein MamJ | 8.06e-01 | 3.15e-06 | NA |
| 2. P | P0CG85 | Polyubiquitin | 9.89e-01 | 3.96e-05 | NA |
| 2. P | Q95337 | Involucrin | 9.98e-01 | 2.06e-02 | NA |
| 2. P | Q5SSG8 | Mucin-21 | 3.83e-02 | 7.30e-09 | NA |
| 2. P | Q58G87 | Polyubiquitin 3 | 9.85e-01 | 4.78e-09 | NA |
| 2. P | Q8N307 | Mucin-20 | 5.37e-02 | 7.83e-04 | NA |
| 2. P | A1X159 | Foot protein 1 variant 2 | 6.38e-02 | 6.23e-05 | NA |
| 2. P | O36421 | Uncharacterized gene 73 protein | NA | 6.45e-03 | NA |
| 2. P | P14591 | Involucrin | 9.85e-01 | 3.82e-06 | NA |
| 2. P | Q6UWP8 | Suprabasin | 3.52e-02 | 4.57e-03 | NA |
| 2. P | P0CG84 | Polyubiquitin (Fragment) | 9.89e-01 | 5.02e-08 | NA |
| 2. P | Q3KSS4 | Epstein-Barr nuclear antigen 1 | NA | 2.10e-02 | NA |
| 2. P | Q9LF88 | Late embryogenesis abundant protein At3g53040 | 9.90e-01 | 9.06e-05 | NA |
| 2. P | P20075 | Embryonic protein DC-8 | 9.94e-01 | 2.76e-05 | NA |
| 2. P | P0CG70 | Polyubiquitin | 9.82e-01 | 2.77e-07 | NA |
| 2. P | Q4UKZ9 | Putative ankyrin repeat protein RF_0923 | 9.99e-01 | 2.33e-06 | NA |
| 2. P | P0CG74 | Polyubiquitin | 9.82e-01 | 1.53e-08 | NA |
| 2. P | P0CH04 | Polyubiquitin | 9.90e-01 | 2.64e-07 | NA |
| 2. P | P0CH32 | Polyubiquitin 4 | 9.87e-01 | 1.47e-10 | NA |
| 2. P | Q8TFG4 | Uncharacterized protein PB18E9.04c | 4.36e-03 | 1.45e-08 | NA |
| 2. P | P0C728 | Uncharacterized protein LF3 | NA | 8.26e-11 | NA |
| 2. P | P0C727 | Uncharacterized protein LF3 | NA | 8.26e-11 | NA |
| 2. P | P24856 | Ice-structuring glycoprotein (Fragment) | 7.86e-02 | 1.04e-02 | NA |
| 2. P | Q9CWU5 | KH domain-containing protein 3 | 8.24e-02 | 3.46e-04 | NA |
| 2. P | P48998 | Involucrin | 8.71e-01 | 2.46e-03 | NA |
| 2. P | P0CH05 | Polyubiquitin | 9.88e-01 | 2.64e-07 | NA |
| 2. P | P0CG78 | Polyubiquitin-F | 9.93e-01 | 4.63e-07 | NA |
| 2. P | D3ZVV1 | KH domain-containing protein 3 | 9.06e-03 | 1.59e-05 | NA |
| 2. P | P39712 | Flocculation protein FLO9 | 1.85e-04 | 1.53e-02 | NA |
| 2. P | P08673 | Circumsporozoite protein | 3.80e-02 | 3.70e-03 | NA |
| 2. P | P02812 | Basic salivary proline-rich protein 2 | 7.98e-01 | 1.11e-09 | NA |
| 2. P | P14918 | Extensin | 6.49e-01 | 6.59e-09 | NA |
| 2. P | Q06155 | Vesicle-associated protein (Fragment) | 4.99e-01 | 9.78e-03 | NA |
| 2. P | P0CG72 | Polyubiquitin | 9.89e-01 | 1.48e-09 | NA |
| 2. P | P22006 | Seminal vesicle secretory protein 2 | 4.76e-02 | 7.09e-05 | NA |
| 2. P | P69315 | Polyubiquitin (Fragment) | 9.83e-01 | 6.76e-03 | NA |
| 2. P | P09815 | Ice nucleation protein | 8.00e-02 | 1.27e-02 | NA |
| 2. P | P97347 | Repetin | 9.87e-01 | 7.80e-03 | NA |
| 2. P | P14590 | Involucrin | 5.34e-03 | 3.16e-04 | NA |
| 2. P | Q54L50 | Putative uncharacterized protein DDB_G0286901 | 9.30e-01 | 4.98e-03 | NA |
| 2. P | P42565 | FMRFamide-related neuropeptides | 4.58e-02 | 2.94e-04 | NA |
| 2. P | P0CG69 | Polyubiquitin | 9.95e-01 | 6.96e-03 | NA |
| 2. P | P21259 | Pol-RFamide neuropeptides | 9.74e-01 | 3.65e-04 | NA |
| 2. P | P18744 | Oocyte zinc finger protein XlCOF20 (Fragment) | 9.82e-01 | 7.89e-07 | NA |
| 2. P | Q04118 | Basic salivary proline-rich protein 3 | 7.29e-01 | 5.41e-07 | NA |
| 2. P | Q27905 | Probable antibacterial peptide polyprotein | 2.59e-08 | 1.09e-03 | NA |
| 2. P | P0CG63 | Polyubiquitin | 9.88e-01 | 4.80e-10 | NA |
| 2. P | P38894 | Flocculation protein FLO5 | 4.89e-01 | 5.92e-03 | NA |
| 2. P | A0A0U1RQI7 | Kruppel-like factor 18 | 1.33e-01 | 3.49e-03 | NA |
| 2. P | Q4ZJZ0 | Mucin-like protein Glc1.8a | NA | 1.75e-11 | NA |
| 2. P | Q9FHQ6 | Polyubiquitin 9 | 9.82e-01 | 3.12e-05 | NA |
| 2. P | P18715 | Gastrula zinc finger protein XlCGF26.1 (Fragment) | 9.99e-01 | 2.52e-10 | NA |
| 2. P | Q06841 | Early nodulin-75 (Fragment) | 8.89e-01 | 6.64e-17 | NA |
| 2. P | P0CH28 | Polyubiquitin-C | 9.96e-01 | 1.34e-04 | NA |
| 2. P | P0CG54 | Polyubiquitin-B | 9.81e-01 | 4.44e-12 | NA |
| 2. P | Q96M34 | Testis-specific expressed protein 55 | 9.81e-01 | 3.09e-04 | NA |
| 2. P | P01068 | Bromelain inhibitor | 9.83e-01 | 3.50e-04 | NA |
| 2. P | H2A0K8 | Shematrin-like protein 1 | 4.29e-03 | 8.23e-05 | NA |
| 2. P | Q9M1G9 | Extensin-2 | 5.51e-01 | 1.12e-04 | NA |
| 2. P | P0C732 | Epstein-Barr nuclear antigen leader protein | NA | 2.64e-20 | NA |
| 2. P | Q38913 | Extensin-1 | 8.46e-01 | 4.27e-03 | NA |
| 2. P | Q9Z1Q1 | Nestin (Fragments) | 9.92e-01 | 4.81e-04 | NA |
| 2. P | P18165 | Loricrin | 9.83e-01 | 5.43e-03 | NA |
| 2. P | A6LZF4 | Virginiamycin B lyase | 9.83e-01 | 1.30e-02 | NA |
| 2. P | P43537 | Uncharacterized membrane protein YFL067W | 9.88e-01 | 4.53e-02 | NA |