Summary

Q8N7P7

Homolog: Q27905.
Function: Probable antibacterial peptide polyprotein.

Statistics

Total GO Annotation: 102
Unique PROST Go: 102
Unique BLAST Go: 0

Total Homologs: 178
Unique PROST Homologs: 177
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q27905 (Probable antibacterial peptide polyprotein) with a FATCAT P-Value: 2.59e-08 and RMSD of 3.10 angstrom. The sequence alignment identity is 24.6%.
Structural alignment shown in left. Query protein Q8N7P7 colored as red in alignment, homolog Q27905 colored as blue. Query protein Q8N7P7 is also shown in right top, homolog Q27905 showed in right bottom. They are colored based on secondary structures. 

  Q8N7P7 --------------------------------------------------------------MTAVSSNRNPEDDGCLLEQ----EP--RGRR------- 25
  Q27905 MRSPRVIHLACVIAYIVAVEAGDKPVYLPRPTPPRPIHPRLAREVGWELEGQGLSPLSEAELLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESE 100

  Q8N7P7 LSPRTGTPRTTAVSSNRDPKNDGCLLKQ----EP--RGRR-------LSPRTGAPGTTAVSSNRNPEDDGCLLKQ----EP--RGRR-------LSPQTG 99
  Q27905 LSPLSVAEVLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEAEVLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRVASLESELSPLSE 200

  Q8N7P7 TPRTTAVSSNRNPGDDGCLL-KQGP-----RGRR-------LSPQT---GTPGTTAVSSNRNPEDDGCLLKQ----EP--RGRR-------LSPQTGTPG 170
  Q27905 AEVLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEEEVLP---EVRERGSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSVAED 297

  Q8N7P7 TTAVSSNRDHEDDGCLLKQES------RGRR-------LSPQTGTPGTTAVSSNRNPEDDGCLLKQES------RGRR-------LSPQTGTPGTTAVSS 244
  Q27905 LPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEAEVLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEAEVLPEVRE 397

  Q8N7P7 NRDPEDDGCLL-KQGP-----RGRR-------LSPQTGTPRTTAVSSNRNPEDDGCLL-KQGP-----RGRR-------LSPQT---GIPRTTAVSSNRD 315
  Q27905 RRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEAEVLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEAEVLP---EVRERRS 494

  Q8N7P7 PGEDGCLLKQES------RGRR-------LSPQTGTTRTTAVSSKRNPEDDGCLLKQ----EP--RGRR-------LSSLTGAPGTTAVSSNR---D--- 383
  Q27905 PVDKGGYLPRPTPPRPVYRSRRDATLESELSPSSEAEVLPEVRERRSPVDKGGYLPRPTPPRPVYRSRRDASLESELSPLSEAEVLPEVRERRSPVDKGG 594

  Q8N7P7 --PRTT---AVSSNRNPGDDGCL---LK-----QG-P--RGRRLSP--QTG-----TPGTTAVSSNRD--------PEDDGCLLKQEPQELRKPEADTAL 452
  Q27905 YLPRPTPPRPVYRSRR---DASLESELSPLSEAEGLPEVRERR-SPGGQGGYLPRPTPRTPLCRSRRDANLDAEQSPVSEGVVL---P-EVR-------- 678

  Q8N7P7  452
  Q27905  678

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0033621 nuclear-transcribed mRNA catabolic process, meiosis-specific transcripts
2. P GO:2000781 positive regulation of double-strand break repair
2. P GO:0051656 establishment of organelle localization
2. P GO:0007594 puparial adhesion
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:0043710 cell adhesion involved in multi-species biofilm formation
2. P GO:0030844 positive regulation of intermediate filament depolymerization
2. P GO:0030216 keratinocyte differentiation
2. P GO:0021888 hypothalamus gonadotrophin-releasing hormone neuron development
2. P GO:0045095 keratin filament
2. P GO:0006511 ubiquitin-dependent protein catabolic process
2. P GO:1900006 positive regulation of dendrite development
2. P GO:0005796 Golgi lumen
2. P GO:0031625 ubiquitin protein ligase binding
2. P GO:1902255 positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator
2. P GO:0047497 mitochondrion transport along microtubule
2. P GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
2. P GO:0043209 myelin sheath
2. P GO:0090281 negative regulation of calcium ion import
2. P GO:0031589 cell-substrate adhesion
2. P GO:0031297 replication fork processing
2. P GO:0000128 flocculation
2. P GO:0007141 male meiosis I
2. P GO:0016567 protein ubiquitination
2. P GO:0007218 neuropeptide signaling pathway
2. P GO:0019042 viral latency
2. P GO:0048012 hepatocyte growth factor receptor signaling pathway
2. P GO:0035096 larval midgut cell programmed cell death
2. P GO:0005576 extracellular region
2. P GO:0005634 nucleus
2. P GO:0051881 regulation of mitochondrial membrane potential
2. P GO:0045179 apical cortex
2. P GO:0009530 primary cell wall
2. P GO:0050817 coagulation
2. P GO:0031640 killing of cells of another organism
2. P GO:0090307 mitotic spindle assembly
2. P GO:1901214 regulation of neuron death
2. P GO:0009986 cell surface
2. P GO:0009277 fungal-type cell wall
2. P GO:0050769 positive regulation of neurogenesis
2. P GO:1902527 positive regulation of protein monoubiquitination
2. P GO:0007144 female meiosis I
2. P GO:0005199 structural constituent of cell wall
2. P GO:0075341 host cell PML body
2. P GO:0110148 biomineralization
2. P GO:1901318 negative regulation of flagellated sperm motility
2. P GO:0001533 cornified envelope
2. P GO:0005737 cytoplasm
2. P GO:0009751 response to salicylic acid
2. P GO:0008585 female gonad development
2. P GO:0050825 ice binding
2. P GO:0018149 peptide cross-linking
2. P GO:0000182 rDNA binding
2. P GO:0060613 fat pad development
2. P GO:0019215 intermediate filament binding
2. P GO:0039695 DNA-templated viral transcription
2. P GO:0004857 enzyme inhibitor activity
2. P GO:0002020 protease binding
2. P GO:0097009 energy homeostasis
2. P GO:0048812 neuron projection morphogenesis
2. P GO:0039588 suppression by virus of host antigen processing and presentation
2. P GO:0075342 disruption by symbiont of host cell PML body
2. P GO:0032880 regulation of protein localization
2. P GO:0031424 keratinization
2. P GO:0106333 subcortical maternal complex
2. P GO:0031386 protein tag
2. P GO:0031225 anchored component of membrane
2. P GO:0009664 plant-type cell wall organization
2. P GO:0003729 mRNA binding
2. P GO:0009737 response to abscisic acid
2. P GO:0022408 negative regulation of cell-cell adhesion
2. P GO:0018153 isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine
2. P GO:0020016 ciliary pocket
2. P GO:0039503 suppression by virus of host innate immune response
2. P GO:0001042 RNA polymerase I core binding
2. P GO:0020003 symbiont-containing vacuole
2. P GO:0061136 regulation of proteasomal protein catabolic process
2. P GO:1905168 positive regulation of double-strand break repair via homologous recombination
2. P GO:0040024 dauer larval development
2. P GO:0002168 instar larval development
2. P GO:0001520 outer dense fiber
2. P GO:0072520 seminiferous tubule development
2. P GO:0110143 magnetosome
2. P GO:0019941 modification-dependent protein catabolic process
2. P GO:0030280 structural constituent of skin epidermis
2. P GO:1900005 positive regulation of serine-type endopeptidase activity
2. P GO:0040019 positive regulation of embryonic development
2. P GO:0010224 response to UV-B
2. P GO:0005537 mannose binding
2. P GO:0062130 adhesive extracellular matrix
2. P GO:0005882 intermediate filament
2. P GO:0010227 floral organ abscission
2. P GO:0060612 adipose tissue development
2. P GO:0004791 thioredoxin-disulfide reductase activity
2. P GO:0061187 regulation of ribosomal DNA heterochromatin assembly
2. P GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway
2. P GO:0042742 defense response to bacterium
2. P GO:0050819 negative regulation of coagulation
2. P GO:0042628 mating plug formation
2. P GO:0008584 male gonad development
2. P GO:0031076 embryonic camera-type eye development
2. P GO:0033018 sarcoplasmic reticulum lumen

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8N7P7 Uncharacterized protein FLJ40521 0 8.41e-142 0.0
2. P A1X158 Foot protein 1 variant 1 2.14e-02 6.92e-08 NA
2. P Q5SF96 Appendage-associated protein 9.64e-01 3.59e-03 NA
2. P P17437 Skin secretory protein xP2 8.58e-01 1.01e-05 NA
2. P P24710 Involucrin 9.15e-01 3.65e-06 NA
2. P P0CG66 Polyubiquitin-C 9.96e-01 7.51e-03 NA
2. P P0CH27 Ubiquitin-60S ribosomal protein L40 9.87e-01 2.34e-08 NA
2. P P18899 Stress protein DDR48 9.11e-01 7.68e-04 NA
2. P A0A1D8PQ86 Agglutinin-like protein 9 9.44e-01 3.42e-03 NA
2. P A6NKU9 Speedy protein E3 9.06e-01 6.82e-06 NA
2. P Q2W8Q7 Magnetosome-associated protein MamJ 6.58e-01 5.49e-04 NA
2. P Q86VQ3 Thioredoxin domain-containing protein 2 9.41e-01 1.52e-03 NA
2. P Q7T3L1 Kininogen-1a 2.41e-02 8.33e-03 NA
2. P Q9DH90 Uncharacterized gene 81 protein NA 1.11e-04 NA
2. P Q1EC66 Polyubiquitin 3 9.90e-01 2.85e-09 NA
2. P P08462 Submandibular gland secretory Glx-rich protein CB 7.92e-01 3.52e-02 NA
2. P O96790 Serine protease inhibitor dipetalogastin (Fragment) 9.96e-01 3.02e-03 NA
2. P O88492 Perilipin-4 2.95e-06 1.23e-03 NA
2. P P18128 Uncharacterized 26.4 kDa protein 1.08e-01 5.00e-02 NA
2. P P69325 Polyubiquitin 9.79e-01 4.49e-08 NA
2. P Q03650 Cysteine-rich, acidic integral membrane protein 2.58e-02 1.32e-05 NA
2. P O08884 Keratin-associated protein 6-2 8.20e-04 8.93e-04 NA
2. P P13826 Circumsporozoite protein (Fragment) 1.05e-01 5.69e-06 NA
2. P P17941 Involucrin 9.97e-01 2.56e-05 NA
2. P Q63429 Polyubiquitin-C 9.85e-01 2.64e-07 NA
2. P P07476 Involucrin 1.51e-02 1.44e-04 NA
2. P P0CG62 Polyubiquitin-B 9.76e-01 1.20e-07 NA
2. P Q4ZJY7 Mucin-like protein Glc1.8b NA 5.19e-12 NA
2. P Q00725 Salivary glue protein Sgs-4 7.02e-01 4.74e-02 NA
2. P P18175 Involucrin 9.51e-01 4.57e-03 NA
2. P Q03400 S-antigen protein 3.19e-04 3.19e-04 NA
2. P P0CG50 Polyubiquitin-C 9.90e-01 2.26e-07 NA
2. P Q6L8H4 Keratin-associated protein 5-1 8.31e-01 3.61e-06 NA
2. P P62976 Polyubiquitin 9.95e-01 4.04e-10 NA
2. P Q9URU4 Putative cell agglutination protein pfl5 8.30e-03 5.90e-04 NA
2. P Q9BYQ5 Keratin-associated protein 4-6 9.89e-01 8.18e-03 NA
2. P Q25460 Adhesive plaque matrix protein (Fragment) 1.40e-03 2.06e-04 NA
2. P Q5GC92 Maximins-S type B/C 9.96e-01 4.71e-05 NA
2. P Q6RY98 Long-sarafotoxin (Fragment) 6.68e-03 1.21e-16 NA
2. P O70559 Small proline-rich protein 2H 8.65e-01 4.48e-04 NA
2. P A6NJ88 Putative SAGE1-like protein 3.97e-03 9.07e-03 NA
2. P E5AV36 Burkholderia TALE-like protein 1 1.00e+00 1.01e-02 NA
2. P P08676 Circumsporozoite protein 9.66e-01 2.04e-03 NA
2. P Q8CIT9 Suprabasin 1.08e-02 3.20e-03 NA
2. P A8MUU9 Putative uncharacterized protein ENSP00000383309 8.18e-01 1.44e-14 NA
2. P P24711 Involucrin 9.40e-01 2.84e-06 NA
2. P P24712 Involucrin 9.91e-01 1.10e-02 NA
2. P P0CG51 Polyubiquitin-B 9.80e-01 1.20e-07 NA
2. P E2RYF6 Mucin-22 2.41e-01 7.09e-03 NA
2. P P0CG80 Polyubiquitin-I 9.79e-01 3.12e-09 NA
2. P Q9XVS4 Nucleolar protein dao-5 9.68e-01 4.40e-03 NA
2. P A6QQF6 Suprabasin 9.51e-03 4.86e-07 NA
2. P P0CG82 Polyubiquitin 9.86e-01 6.18e-09 NA
2. P P19837 Spidroin-1 (Fragment) 6.89e-01 3.20e-03 NA
2. P P69322 Polyubiquitin 9.87e-01 1.95e-09 NA
2. P P69309 Polyubiquitin 9.81e-01 1.86e-07 NA
2. P Q5UP11 Putative ankyrin repeat protein R848 NA 3.88e-05 NA
2. P Q3E7T8 Polyubiquitin 14 9.82e-01 4.49e-08 NA
2. P E5AW45 Burkholderia TALE-like protein 2 1.00e+00 1.90e-06 NA
2. P Q6ZQT0 Putative uncharacterized protein FLJ45035 7.60e-01 3.99e-03 NA
2. P P59669 Polyubiquitin 9.83e-01 2.20e-05 NA
2. P P08674 Circumsporozoite protein 2.33e-02 5.90e-04 NA
2. P O46383 Sodium/potassium/calcium exchanger 1 (Fragment) 9.11e-02 1.28e-02 NA
2. P P14708 Involucrin 1.97e-03 3.61e-06 NA
2. P Q9SKP0 Late embryogenesis abundant protein ECP63 9.77e-01 1.21e-02 NA
2. P P0CG81 Polyubiquitin-H 9.86e-01 1.75e-10 NA
2. P Q25060 LWamide neuropeptides 2.13e-01 2.65e-06 NA
2. P P08672 Circumsporozoite protein 8.40e-01 4.89e-03 NA
2. P Q6L8H1 Keratin-associated protein 5-4 1.64e-01 5.72e-05 NA
2. P P18729 Gastrula zinc finger protein XlCGF57.1 (Fragment) 9.99e-01 4.39e-11 NA
2. P P81592 Acaloleptin A 8.70e-02 1.15e-12 NA
2. P P0CG68 Polyubiquitin-C 9.89e-01 4.75e-06 NA
2. P Q9D9R9 Protein FAM186A 2.28e-01 1.56e-02 NA
2. P P0CG24 Zinc finger protein 883 9.98e-01 3.05e-02 NA
2. P P0CG64 Polyubiquitin-C 9.95e-01 2.00e-02 NA
2. P P0CG55 Polyubiquitin-B 9.83e-01 6.85e-07 NA
2. P P0CG49 Polyubiquitin-B 9.77e-01 1.20e-07 NA
2. P P42740 Polyubiquitin 9.88e-01 2.98e-05 NA
2. P Q8N1N5 Putative protein CRIPAK 5.30e-04 4.64e-11 NA
2. P O24006 Antimicrobial peptides 9.89e-01 7.51e-03 NA
2. P P02851 Balbiani ring protein 2 (Fragment) 8.91e-01 6.85e-07 NA
2. P Q5GC91 Maximins-S type D 9.94e-01 1.43e-02 NA
2. P Q03110 Circumsporozoite protein 9.79e-01 1.42e-02 NA
2. P Q6P902 Thioredoxin domain-containing protein 2 8.37e-01 2.13e-04 NA
2. P Q1HVI8 Epstein-Barr nuclear antigen leader protein NA 4.87e-20 NA
2. P P16230 Sarcoplasmic reticulum histidine-rich calcium-binding protein 9.50e-01 8.26e-06 NA
2. P P0CG76 Polyubiquitin-A 9.85e-01 1.08e-11 NA
2. P Q5UPA0 Putative ankyrin repeat protein L25 NA 1.09e-03 NA
2. P Q8H159 Polyubiquitin 10 9.89e-01 3.96e-05 NA
2. P C0HL89 Lectin SfL-1 9.80e-01 5.50e-06 NA
2. P O09116 Small proline-rich protein 3 3.70e-02 1.15e-02 NA
2. P P11006 Magainins 9.97e-01 7.83e-04 NA
2. P P10163 Basic salivary proline-rich protein 4 7.73e-01 1.52e-03 NA
2. P P0CG75 Polyubiquitin 9.88e-01 2.23e-07 NA
2. P Q8MKD1 Polyubiquitin-B 9.74e-01 1.14e-07 NA
2. P Q2KI51 Protein phosphatase 1 regulatory subunit 15A 9.58e-01 2.28e-02 NA
2. P Q9QJ13 Protein B8 NA 1.49e-05 NA
2. P P42739 Polyubiquitin (Fragment) 9.87e-01 3.87e-06 NA
2. P P08677 Circumsporozoite protein 8.95e-01 1.52e-02 NA
2. P Q9FS16 Extensin-3 8.33e-01 2.97e-04 NA
2. P E5AW43 Burkholderia TALE-like protein 3 9.99e-01 3.39e-03 NA
2. P P82003 Prothoracicostatic peptide 9.70e-01 3.99e-03 NA
2. P P0CG61 Polyubiquitin-C 9.97e-01 2.00e-02 NA
2. P P05143 Proline-rich protein 2 7.63e-01 4.48e-04 NA
2. P Q8AZK7 Epstein-Barr nuclear antigen leader protein NA 2.64e-20 NA
2. P P0CG79 Polyubiquitin-G 9.85e-01 2.45e-10 NA
2. P P20481 Buccalin 9.32e-03 6.28e-11 NA
2. P P0CG88 Polyubiquitin-J 9.81e-01 3.12e-09 NA
2. P P04280 Basic salivary proline-rich protein 1 9.23e-01 4.21e-11 NA
2. P P46525 Cold-shock protein CS120 9.46e-01 4.87e-10 NA
2. P P0CG53 Polyubiquitin-B 9.68e-01 8.74e-08 NA
2. P Q86MA7 Protein PRQFV-amide 2.47e-03 3.36e-03 NA
2. P P21787 Microtubule-associated protein P320 (Fragment) 1.11e-05 7.36e-10 NA
2. P V6F519 Magnetosome-associated protein MamJ 8.06e-01 3.15e-06 NA
2. P P0CG85 Polyubiquitin 9.89e-01 3.96e-05 NA
2. P Q95337 Involucrin 9.98e-01 2.06e-02 NA
2. P Q5SSG8 Mucin-21 3.83e-02 7.30e-09 NA
2. P Q58G87 Polyubiquitin 3 9.85e-01 4.78e-09 NA
2. P Q8N307 Mucin-20 5.37e-02 7.83e-04 NA
2. P A1X159 Foot protein 1 variant 2 6.38e-02 6.23e-05 NA
2. P O36421 Uncharacterized gene 73 protein NA 6.45e-03 NA
2. P P14591 Involucrin 9.85e-01 3.82e-06 NA
2. P Q6UWP8 Suprabasin 3.52e-02 4.57e-03 NA
2. P P0CG84 Polyubiquitin (Fragment) 9.89e-01 5.02e-08 NA
2. P Q3KSS4 Epstein-Barr nuclear antigen 1 NA 2.10e-02 NA
2. P Q9LF88 Late embryogenesis abundant protein At3g53040 9.90e-01 9.06e-05 NA
2. P P20075 Embryonic protein DC-8 9.94e-01 2.76e-05 NA
2. P P0CG70 Polyubiquitin 9.82e-01 2.77e-07 NA
2. P Q4UKZ9 Putative ankyrin repeat protein RF_0923 9.99e-01 2.33e-06 NA
2. P P0CG74 Polyubiquitin 9.82e-01 1.53e-08 NA
2. P P0CH04 Polyubiquitin 9.90e-01 2.64e-07 NA
2. P P0CH32 Polyubiquitin 4 9.87e-01 1.47e-10 NA
2. P Q8TFG4 Uncharacterized protein PB18E9.04c 4.36e-03 1.45e-08 NA
2. P P0C728 Uncharacterized protein LF3 NA 8.26e-11 NA
2. P P0C727 Uncharacterized protein LF3 NA 8.26e-11 NA
2. P P24856 Ice-structuring glycoprotein (Fragment) 7.86e-02 1.04e-02 NA
2. P Q9CWU5 KH domain-containing protein 3 8.24e-02 3.46e-04 NA
2. P P48998 Involucrin 8.71e-01 2.46e-03 NA
2. P P0CH05 Polyubiquitin 9.88e-01 2.64e-07 NA
2. P P0CG78 Polyubiquitin-F 9.93e-01 4.63e-07 NA
2. P D3ZVV1 KH domain-containing protein 3 9.06e-03 1.59e-05 NA
2. P P39712 Flocculation protein FLO9 1.85e-04 1.53e-02 NA
2. P P08673 Circumsporozoite protein 3.80e-02 3.70e-03 NA
2. P P02812 Basic salivary proline-rich protein 2 7.98e-01 1.11e-09 NA
2. P P14918 Extensin 6.49e-01 6.59e-09 NA
2. P Q06155 Vesicle-associated protein (Fragment) 4.99e-01 9.78e-03 NA
2. P P0CG72 Polyubiquitin 9.89e-01 1.48e-09 NA
2. P P22006 Seminal vesicle secretory protein 2 4.76e-02 7.09e-05 NA
2. P P69315 Polyubiquitin (Fragment) 9.83e-01 6.76e-03 NA
2. P P09815 Ice nucleation protein 8.00e-02 1.27e-02 NA
2. P P97347 Repetin 9.87e-01 7.80e-03 NA
2. P P14590 Involucrin 5.34e-03 3.16e-04 NA
2. P Q54L50 Putative uncharacterized protein DDB_G0286901 9.30e-01 4.98e-03 NA
2. P P42565 FMRFamide-related neuropeptides 4.58e-02 2.94e-04 NA
2. P P0CG69 Polyubiquitin 9.95e-01 6.96e-03 NA
2. P P21259 Pol-RFamide neuropeptides 9.74e-01 3.65e-04 NA
2. P P18744 Oocyte zinc finger protein XlCOF20 (Fragment) 9.82e-01 7.89e-07 NA
2. P Q04118 Basic salivary proline-rich protein 3 7.29e-01 5.41e-07 NA
2. P Q27905 Probable antibacterial peptide polyprotein 2.59e-08 1.09e-03 NA
2. P P0CG63 Polyubiquitin 9.88e-01 4.80e-10 NA
2. P P38894 Flocculation protein FLO5 4.89e-01 5.92e-03 NA
2. P A0A0U1RQI7 Kruppel-like factor 18 1.33e-01 3.49e-03 NA
2. P Q4ZJZ0 Mucin-like protein Glc1.8a NA 1.75e-11 NA
2. P Q9FHQ6 Polyubiquitin 9 9.82e-01 3.12e-05 NA
2. P P18715 Gastrula zinc finger protein XlCGF26.1 (Fragment) 9.99e-01 2.52e-10 NA
2. P Q06841 Early nodulin-75 (Fragment) 8.89e-01 6.64e-17 NA
2. P P0CH28 Polyubiquitin-C 9.96e-01 1.34e-04 NA
2. P P0CG54 Polyubiquitin-B 9.81e-01 4.44e-12 NA
2. P Q96M34 Testis-specific expressed protein 55 9.81e-01 3.09e-04 NA
2. P P01068 Bromelain inhibitor 9.83e-01 3.50e-04 NA
2. P H2A0K8 Shematrin-like protein 1 4.29e-03 8.23e-05 NA
2. P Q9M1G9 Extensin-2 5.51e-01 1.12e-04 NA
2. P P0C732 Epstein-Barr nuclear antigen leader protein NA 2.64e-20 NA
2. P Q38913 Extensin-1 8.46e-01 4.27e-03 NA
2. P Q9Z1Q1 Nestin (Fragments) 9.92e-01 4.81e-04 NA
2. P P18165 Loricrin 9.83e-01 5.43e-03 NA
2. P A6LZF4 Virginiamycin B lyase 9.83e-01 1.30e-02 NA
2. P P43537 Uncharacterized membrane protein YFL067W 9.88e-01 4.53e-02 NA