Summary

Q8N7U9

Homolog: Q9FDX9.
Function: Guanine nucleotide-binding protein subunit gamma 1.

Statistics

Total GO Annotation: 36
Unique PROST Go: 36
Unique BLAST Go: 0

Total Homologs: 28
Unique PROST Homologs: 27
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q9FDX9 (Guanine nucleotide-binding protein subunit gamma 1) with a FATCAT P-Value: 0.000474 and RMSD of 0.75 angstrom. The sequence alignment identity is 22.1%.
Structural alignment shown in left. Query protein Q8N7U9 colored as red in alignment, homolog Q9FDX9 colored as blue. Query protein Q8N7U9 is also shown in right top, homolog Q9FDX9 showed in right bottom. They are colored based on secondary structures. 

  Q8N7U9 MTSSAPTLPDVTI-----RNVSRHIQMSLMGKGEPPWLCRLQLEPLLQAMEEQQLGNLEARWEVEKHGNEVSGSTSREVWEDADFICPVLKQCTNPKLNE 95
  Q9FDX9 -------MREETVVYEQEESVS-H------GGGKH----RI-LAEL--ARVEQEVAFL------EK---EL-----KEV-ENTDIVSTV---C--EEL-- 57

  Q8N7U9 NKNIHQAKECEK--SPFLSLS--PHQ----QWKPGLPRRNDALPTSLCLCCSEN 141
  Q9FDX9 ------LSVIEKGPDPLLPLTNGPLNLGWDRWFEG-PNGGEG-----CRCLIL- 98

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0046966 thyroid hormone receptor binding
2. P GO:0010541 acropetal auxin transport
2. P GO:0007040 lysosome organization
2. P GO:0042632 cholesterol homeostasis
2. P GO:0018342 protein prenylation
2. P GO:0018345 protein palmitoylation
2. P GO:0043410 positive regulation of MAPK cascade
2. P GO:0060261 positive regulation of transcription initiation from RNA polymerase II promoter
2. P GO:0009904 chloroplast accumulation movement
2. P GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
2. P GO:0000187 obsolete activation of MAPK activity
2. P GO:0071986 Ragulator complex
2. P GO:0031225 anchored component of membrane
2. P GO:0007035 vacuolar acidification
2. P GO:0019827 stem cell population maintenance
2. P GO:0031902 late endosome membrane
2. P GO:0016197 endosomal transport
2. P GO:0005834 heterotrimeric G-protein complex
2. P GO:0032008 positive regulation of TOR signaling
2. P GO:0071230 cellular response to amino acid stimulus
2. P GO:0072665 protein localization to vacuole
2. P GO:0009903 chloroplast avoidance movement
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0007186 G protein-coupled receptor signaling pathway
2. P GO:0003712 transcription coregulator activity
2. P GO:0000329 fungal-type vacuole membrane
2. P GO:0009845 seed germination
2. P GO:0048527 lateral root development
2. P GO:0016237 lysosomal microautophagy
2. P GO:0042060 wound healing
2. P GO:0016592 mediator complex
2. P GO:0045334 clathrin-coated endocytic vesicle
2. P GO:0007049 cell cycle
2. P GO:0031681 G-protein beta-subunit binding
2. P GO:0001919 regulation of receptor recycling
2. P GO:0042599 lamellar body

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8N7U9 Putative uncharacterized protein encoded by LINC00469 0 2.47e-155 1.08e-101
2. P F5HGC2 Uncharacterized protein UL30 NA 1.29e-07 NA
2. P Q02205 Protein MEH1 5.54e-02 3.06e-02 NA
2. P Q5R8D4 Arginine vasopressin-induced protein 1 9.31e-02 2.51e-07 NA
2. P Q9E6L7 Uncharacterized gene 93 protein NA 3.91e-02 NA
2. P F4I0N3 WEB family protein At1g75720 2.61e-02 1.64e-02 NA
2. P Q3SZR0 Arginine vasopressin-induced protein 1 7.19e-02 2.85e-05 NA
2. P P0C7M3 Surfactant-associated protein 3 3.30e-02 1.31e-02 NA
2. P Q9FDX9 Guanine nucleotide-binding protein subunit gamma 1 4.74e-04 7.91e-05 NA
2. P B8AN27 Guanine nucleotide-binding protein subunit gamma 1 5.20e-02 2.36e-02 NA
2. P Q92JM6 Uncharacterized protein RC0041 2.41e-03 1.48e-02 NA
2. P Q7RWT0 Guanine nucleotide-binding protein subunit gamma 7.09e-03 2.73e-02 NA
2. P P16840 Uncharacterized protein US5 NA 8.57e-04 NA
2. P Q9BZP3 Putative uncharacterized protein encoded by LINC00470 1.20e-02 1.48e-02 NA
2. P Q9D7H4 Arginine vasopressin-induced protein 1 1.18e-01 3.36e-02 NA
2. P Q2YDE5 Putative coiled-coil domain-containing protein 196 9.74e-02 4.67e-04 NA
2. P Q32P96 Spermatogenesis-associated protein 45 8.83e-02 3.81e-04 NA
2. P Q5JTZ5 Uncharacterized protein C9orf152 4.14e-01 3.80e-03 NA
2. P Q2YDF2 Mediator of RNA polymerase II transcription subunit 30 3.30e-02 3.94e-04 NA
2. P Q8VDA6 Arginine vasopressin-induced protein 1 1.82e-01 8.31e-04 NA
2. P P02891 Gene BABR protein 2 1.44e-02 3.39e-02 NA
2. P Q9SD24 WEB family protein At3g51220 1.89e-02 3.49e-02 NA
2. P P16765 Uncharacterized protein UL30 NA 1.68e-05 NA
2. P Q75WU1 Guanine nucleotide-binding protein subunit gamma 1 2.03e-02 2.36e-02 NA
2. P Q6C5P0 Mediator of RNA polymerase II transcription subunit 10 2.44e-03 1.51e-02 NA
2. P A0QRX8 Uncharacterized protein MSMEG_1276/MSMEI_1238.1 1.41e-01 2.42e-04 NA
2. P Q14BK3 Testis-expressed protein 35 2.79e-02 3.71e-06 NA
2. P Q5T686 Arginine vasopressin-induced protein 1 3.83e-01 1.38e-04 NA