Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
Q9FDX9
(Guanine nucleotide-binding protein subunit gamma 1) with a FATCAT P-Value: 0.000474 and RMSD of 0.75 angstrom. The sequence alignment identity is 22.1%.
Structural alignment shown in left. Query protein Q8N7U9 colored as red in alignment, homolog Q9FDX9 colored as blue.
Query protein Q8N7U9 is also shown in right top, homolog Q9FDX9 showed in right bottom. They are colored based on secondary structures.
Q8N7U9 MTSSAPTLPDVTI-----RNVSRHIQMSLMGKGEPPWLCRLQLEPLLQAMEEQQLGNLEARWEVEKHGNEVSGSTSREVWEDADFICPVLKQCTNPKLNE 95 Q9FDX9 -------MREETVVYEQEESVS-H------GGGKH----RI-LAEL--ARVEQEVAFL------EK---EL-----KEV-ENTDIVSTV---C--EEL-- 57 Q8N7U9 NKNIHQAKECEK--SPFLSLS--PHQ----QWKPGLPRRNDALPTSLCLCCSEN 141 Q9FDX9 ------LSVIEKGPDPLLPLTNGPLNLGWDRWFEG-PNGGEG-----CRCLIL- 98
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0046966 | thyroid hormone receptor binding |
| 2. P | GO:0010541 | acropetal auxin transport |
| 2. P | GO:0007040 | lysosome organization |
| 2. P | GO:0042632 | cholesterol homeostasis |
| 2. P | GO:0018342 | protein prenylation |
| 2. P | GO:0018345 | protein palmitoylation |
| 2. P | GO:0043410 | positive regulation of MAPK cascade |
| 2. P | GO:0060261 | positive regulation of transcription initiation from RNA polymerase II promoter |
| 2. P | GO:0009904 | chloroplast accumulation movement |
| 2. P | GO:0000750 | pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 2. P | GO:0000187 | obsolete activation of MAPK activity |
| 2. P | GO:0071986 | Ragulator complex |
| 2. P | GO:0031225 | anchored component of membrane |
| 2. P | GO:0007035 | vacuolar acidification |
| 2. P | GO:0019827 | stem cell population maintenance |
| 2. P | GO:0031902 | late endosome membrane |
| 2. P | GO:0016197 | endosomal transport |
| 2. P | GO:0005834 | heterotrimeric G-protein complex |
| 2. P | GO:0032008 | positive regulation of TOR signaling |
| 2. P | GO:0071230 | cellular response to amino acid stimulus |
| 2. P | GO:0072665 | protein localization to vacuole |
| 2. P | GO:0009903 | chloroplast avoidance movement |
| 2. P | GO:0015630 | microtubule cytoskeleton |
| 2. P | GO:0007186 | G protein-coupled receptor signaling pathway |
| 2. P | GO:0003712 | transcription coregulator activity |
| 2. P | GO:0000329 | fungal-type vacuole membrane |
| 2. P | GO:0009845 | seed germination |
| 2. P | GO:0048527 | lateral root development |
| 2. P | GO:0016237 | lysosomal microautophagy |
| 2. P | GO:0042060 | wound healing |
| 2. P | GO:0016592 | mediator complex |
| 2. P | GO:0045334 | clathrin-coated endocytic vesicle |
| 2. P | GO:0007049 | cell cycle |
| 2. P | GO:0031681 | G-protein beta-subunit binding |
| 2. P | GO:0001919 | regulation of receptor recycling |
| 2. P | GO:0042599 | lamellar body |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8N7U9 | Putative uncharacterized protein encoded by LINC00469 | 0 | 2.47e-155 | 1.08e-101 |
| 2. P | F5HGC2 | Uncharacterized protein UL30 | NA | 1.29e-07 | NA |
| 2. P | Q02205 | Protein MEH1 | 5.54e-02 | 3.06e-02 | NA |
| 2. P | Q5R8D4 | Arginine vasopressin-induced protein 1 | 9.31e-02 | 2.51e-07 | NA |
| 2. P | Q9E6L7 | Uncharacterized gene 93 protein | NA | 3.91e-02 | NA |
| 2. P | F4I0N3 | WEB family protein At1g75720 | 2.61e-02 | 1.64e-02 | NA |
| 2. P | Q3SZR0 | Arginine vasopressin-induced protein 1 | 7.19e-02 | 2.85e-05 | NA |
| 2. P | P0C7M3 | Surfactant-associated protein 3 | 3.30e-02 | 1.31e-02 | NA |
| 2. P | Q9FDX9 | Guanine nucleotide-binding protein subunit gamma 1 | 4.74e-04 | 7.91e-05 | NA |
| 2. P | B8AN27 | Guanine nucleotide-binding protein subunit gamma 1 | 5.20e-02 | 2.36e-02 | NA |
| 2. P | Q92JM6 | Uncharacterized protein RC0041 | 2.41e-03 | 1.48e-02 | NA |
| 2. P | Q7RWT0 | Guanine nucleotide-binding protein subunit gamma | 7.09e-03 | 2.73e-02 | NA |
| 2. P | P16840 | Uncharacterized protein US5 | NA | 8.57e-04 | NA |
| 2. P | Q9BZP3 | Putative uncharacterized protein encoded by LINC00470 | 1.20e-02 | 1.48e-02 | NA |
| 2. P | Q9D7H4 | Arginine vasopressin-induced protein 1 | 1.18e-01 | 3.36e-02 | NA |
| 2. P | Q2YDE5 | Putative coiled-coil domain-containing protein 196 | 9.74e-02 | 4.67e-04 | NA |
| 2. P | Q32P96 | Spermatogenesis-associated protein 45 | 8.83e-02 | 3.81e-04 | NA |
| 2. P | Q5JTZ5 | Uncharacterized protein C9orf152 | 4.14e-01 | 3.80e-03 | NA |
| 2. P | Q2YDF2 | Mediator of RNA polymerase II transcription subunit 30 | 3.30e-02 | 3.94e-04 | NA |
| 2. P | Q8VDA6 | Arginine vasopressin-induced protein 1 | 1.82e-01 | 8.31e-04 | NA |
| 2. P | P02891 | Gene BABR protein 2 | 1.44e-02 | 3.39e-02 | NA |
| 2. P | Q9SD24 | WEB family protein At3g51220 | 1.89e-02 | 3.49e-02 | NA |
| 2. P | P16765 | Uncharacterized protein UL30 | NA | 1.68e-05 | NA |
| 2. P | Q75WU1 | Guanine nucleotide-binding protein subunit gamma 1 | 2.03e-02 | 2.36e-02 | NA |
| 2. P | Q6C5P0 | Mediator of RNA polymerase II transcription subunit 10 | 2.44e-03 | 1.51e-02 | NA |
| 2. P | A0QRX8 | Uncharacterized protein MSMEG_1276/MSMEI_1238.1 | 1.41e-01 | 2.42e-04 | NA |
| 2. P | Q14BK3 | Testis-expressed protein 35 | 2.79e-02 | 3.71e-06 | NA |
| 2. P | Q5T686 | Arginine vasopressin-induced protein 1 | 3.83e-01 | 1.38e-04 | NA |