Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
A8MZA4
(Golgin subfamily A member 6-like protein 6) with a FATCAT P-Value: 0.0 and RMSD of 5.61 angstrom. The sequence alignment identity is 85.1%.
Structural alignment shown in left. Query protein Q8N7Z2 colored as red in alignment, homolog A8MZA4 colored as blue.
Query protein Q8N7Z2 is also shown in right top, homolog A8MZA4 showed in right bottom. They are colored based on secondary structures.
Q8N7Z2 MLMWPQPHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTNPETTT 100 A8MZA4 MLMWPQ------------PHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTNPETTT 88 Q8N7Z2 SGGCHSPEDEQKASHQHQEALRRELEAQVHTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTK 200 A8MZA4 SGGCHSPEDEQKASHQHQEALRRELEAQVHTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTK 188 Q8N7Z2 ERDALSLELYRNTITDEELKEKNAKLQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADHLGKELQSVSAKLQAQVEENELWNRLNQQQEE 300 A8MZA4 ERDALSLELYRNTITDEELKEKNAELQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADHLGKELQSVSAKLQAQVEENELWNRLNQQQEE 288 Q8N7Z2 KMWRQEEKIQEWEEKIQEQEEKIREQEEKIREQEEKMRRQEEMMWEKEEKMRRQEEMMWEKEEKMRRLEEMMWEKEEKIRELEEKMHEQEKIREQEEKRQ 400 A8MZA4 KMWRQEEKIQEWEEKIQEQEEKIREQEEKIREQEEKMRRQEEMMWEKEEKMRRQEEMMWEKEEKMRRQEEMMWEKEEKIRELEEKMHEQEKIREQEEKRQ 388 Q8N7Z2 EEEKIREQEKRQEQEAKMWRQEEKIREQEEKIREQEKKMWRQEEKIHEQEKIREEEKRQEQEEMWRQEEKIREQEEIWRQKEKMHEQ-EKIRKQEEKVWR 499 A8MZA4 EEEKIREQEKRQEQEAKMWRQEEKIREQEEKIREQEKKMWRQEEKIHEQEKIREEEKRQEQEEMWRQEEKIREQEEIWRQKEKMHEQEEKIRKQEEKVWR 488 Q8N7Z2 QEEKMHDQEEKIREQEEKMWRQEEKIRE--------------------------------QEEKIRE-------QEEKIREQEEMMQEQEEKMGEQEEKM 560 A8MZA4 QEEKIREQEEKIREQEEKMWRQEEKIREQEEMWREEEKMHEQEKIWEEEKRQEQEDKMWRQEEKIREQEEKVWRQEEKIREQEEKRQEQEEKMWKQEEKI 588 Q8N7Z2 QEQ-EKMRRQEEKIREQEEKIREQ---------K--------------------------EKIREQEEKIWEQEEKIREQEEMMQEQEEKMWEQEEKMCE 624 A8MZA4 REQEEKIREQEEKIREQEEKIREQEEMTQEQEEKMGEQEEKMCEQEEKMQEQEETMWRQEEKIREQEKKIREQEEKIREQEEMMQEQEEKMWEQEEKMCE 688 Q8N7Z2 QEEKMQEQEEKMRRQEEKMWEQEVRLRQQEEKMQEHQEHLEAAI 668 A8MZA4 QEEKMQEQEEKMRRQEEKMWEQEVRLRQQEEKMQEH-------- 724
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0050772 | positive regulation of axonogenesis |
| 1. PB | GO:0060050 | positive regulation of protein glycosylation |
| 1. PB | GO:0051289 | protein homotetramerization |
| 1. PB | GO:0090161 | Golgi ribbon formation |
| 1. PB | GO:0008356 | asymmetric cell division |
| 1. PB | GO:0010507 | negative regulation of autophagy |
| 1. PB | GO:0007098 | centrosome cycle |
| 1. PB | GO:0000922 | spindle pole |
| 1. PB | GO:0005794 | Golgi apparatus |
| 1. PB | GO:0072686 | mitotic spindle |
| 1. PB | GO:0030134 | COPII-coated ER to Golgi transport vesicle |
| 1. PB | GO:0006486 | protein glycosylation |
| 1. PB | GO:0020016 | ciliary pocket |
| 1. PB | GO:0032091 | negative regulation of protein binding |
| 1. PB | GO:0090306 | meiotic spindle assembly |
| 1. PB | GO:0007030 | Golgi organization |
| 1. PB | GO:0000137 | Golgi cis cisterna |
| 1. PB | GO:0005801 | cis-Golgi network |
| 1. PB | GO:0008017 | microtubule binding |
| 1. PB | GO:0061676 | importin-alpha family protein binding |
| 1. PB | GO:0007020 | microtubule nucleation |
| 1. PB | GO:0051645 | Golgi localization |
| 1. PB | GO:0006888 | endoplasmic reticulum to Golgi vesicle-mediated transport |
| 1. PB | GO:0032580 | Golgi cisterna membrane |
| 1. PB | GO:0090307 | mitotic spindle assembly |
| 1. PB | GO:0019905 | syntaxin binding |
| 1. PB | GO:0033116 | endoplasmic reticulum-Golgi intermediate compartment membrane |
| 1. PB | GO:0090166 | Golgi disassembly |
| 1. PB | GO:0051225 | spindle assembly |
| 2. P | GO:0048471 | perinuclear region of cytoplasm |
| 2. P | GO:0003682 | chromatin binding |
| 2. P | GO:0010445 | nuclear dicing body |
| 2. P | GO:0030336 | negative regulation of cell migration |
| 2. P | GO:0007420 | brain development |
| 2. P | GO:0000151 | ubiquitin ligase complex |
| 2. P | GO:0035279 | miRNA-mediated gene silencing by mRNA destabilization |
| 2. P | GO:0031492 | nucleosomal DNA binding |
| 2. P | GO:0005654 | nucleoplasm |
| 2. P | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 2. P | GO:0005796 | Golgi lumen |
| 2. P | GO:0031625 | ubiquitin protein ligase binding |
| 2. P | GO:0010008 | endosome membrane |
| 2. P | GO:0033503 | HULC complex |
| 2. P | GO:0010589 | leaf proximal/distal pattern formation |
| 2. P | GO:0043588 | skin development |
| 2. P | GO:0006325 | chromatin organization |
| 2. P | GO:0003713 | transcription coactivator activity |
| 2. P | GO:0035198 | miRNA binding |
| 2. P | GO:0030016 | myofibril |
| 2. P | GO:0098792 | xenophagy |
| 2. P | GO:0031062 | positive regulation of histone methylation |
| 2. P | GO:0045109 | intermediate filament organization |
| 2. P | GO:0000209 | protein polyubiquitination |
| 2. P | GO:0035196 | production of miRNAs involved in gene silencing by miRNA |
| 2. P | GO:0010305 | leaf vascular tissue pattern formation |
| 2. P | GO:0010390 | histone monoubiquitination |
| 2. P | GO:0009735 | response to cytokinin |
| 2. P | GO:0016574 | histone ubiquitination |
| 2. P | GO:0030422 | production of siRNA involved in RNA interference |
| 2. P | GO:0005634 | nucleus |
| 2. P | GO:0010267 | primary ta-siRNA processing |
| 2. P | GO:1901098 | positive regulation of autophagosome maturation |
| 2. P | GO:0002039 | p53 binding |
| 2. P | GO:0033523 | histone H2B ubiquitination |
| 2. P | GO:0000139 | Golgi membrane |
| 2. P | GO:2001168 | positive regulation of histone H2B ubiquitination |
| 2. P | GO:0032982 | myosin filament |
| 2. P | GO:0004842 | ubiquitin-protein transferase activity |
| 2. P | GO:0031054 | pre-miRNA processing |
| 2. P | GO:1900364 | negative regulation of mRNA polyadenylation |
| 2. P | GO:0045893 | positive regulation of transcription, DNA-templated |
| 2. P | GO:0070307 | lens fiber cell development |
| 2. P | GO:0005730 | nucleolus |
| 2. P | GO:0042802 | identical protein binding |
| 2. P | GO:0016459 | myosin complex |
| 2. P | GO:0042255 | ribosome assembly |
| 2. P | GO:0031053 | primary miRNA processing |
| 2. P | GO:0003730 | mRNA 3'-UTR binding |
| 2. P | GO:0042393 | histone binding |
| 3. B | GO:1990535 | neuron projection maintenance |
| 3. B | GO:0071711 | basement membrane organization |
| 3. B | GO:1990414 | replication-born double-strand break repair via sister chromatid exchange |
| 3. B | GO:0010737 | protein kinase A signaling |
| 3. B | GO:0046007 | negative regulation of activated T cell proliferation |
| 3. B | GO:0045886 | negative regulation of synaptic assembly at neuromuscular junction |
| 3. B | GO:0007414 | axonal defasciculation |
| 3. B | GO:0005874 | microtubule |
| 3. B | GO:0009888 | tissue development |
| 3. B | GO:0005608 | laminin-3 complex |
| 3. B | GO:1901588 | dendritic microtubule |
| 3. B | GO:0071169 | establishment of protein localization to chromatin |
| 3. B | GO:0005201 | extracellular matrix structural constituent |
| 3. B | GO:0002011 | morphogenesis of an epithelial sheet |
| 3. B | GO:0044409 | entry into host |
| 3. B | GO:0035118 | embryonic pectoral fin morphogenesis |
| 3. B | GO:1903136 | cuprous ion binding |
| 3. B | GO:1900449 | regulation of glutamate receptor signaling pathway |
| 3. B | GO:0043083 | synaptic cleft |
| 3. B | GO:0008307 | structural constituent of muscle |
| 3. B | GO:0050860 | negative regulation of T cell receptor signaling pathway |
| 3. B | GO:0007507 | heart development |
| 3. B | GO:0051371 | muscle alpha-actinin binding |
| 3. B | GO:0019828 | aspartic-type endopeptidase inhibitor activity |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0048514 | blood vessel morphogenesis |
| 3. B | GO:0005911 | cell-cell junction |
| 3. B | GO:0045995 | regulation of embryonic development |
| 3. B | GO:0051788 | response to misfolded protein |
| 3. B | GO:0031672 | A band |
| 3. B | GO:0098003 | viral tail assembly |
| 3. B | GO:0045214 | sarcomere organization |
| 3. B | GO:0043256 | laminin complex |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:0030240 | skeletal muscle thin filament assembly |
| 3. B | GO:0035633 | maintenance of blood-brain barrier |
| 3. B | GO:0042805 | actinin binding |
| 3. B | GO:1902951 | negative regulation of dendritic spine maintenance |
| 3. B | GO:0030018 | Z disc |
| 3. B | GO:0060441 | epithelial tube branching involved in lung morphogenesis |
| 3. B | GO:0099642 | retrograde axonal protein transport |
| 3. B | GO:0098737 | protein insertion into plasma membrane |
| 3. B | GO:0009887 | animal organ morphogenesis |
| 3. B | GO:0097493 | structural molecule activity conferring elasticity |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0055013 | cardiac muscle cell development |
| 3. B | GO:0070050 | neuron cellular homeostasis |
| 3. B | GO:0044307 | dendritic branch |
| 3. B | GO:0005859 | muscle myosin complex |
| 3. B | GO:0099641 | anterograde axonal protein transport |
| 3. B | GO:0031802 | type 5 metabotropic glutamate receptor binding |
| 3. B | GO:0002020 | protease binding |
| 3. B | GO:0000270 | peptidoglycan metabolic process |
| 3. B | GO:0019901 | protein kinase binding |
| 3. B | GO:0090694 | Scc2-Scc4 cohesin loading complex |
| 3. B | GO:0060048 | cardiac muscle contraction |
| 3. B | GO:0060419 | heart growth |
| 3. B | GO:0055003 | cardiac myofibril assembly |
| 3. B | GO:1903135 | cupric ion binding |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:0061304 | retinal blood vessel morphogenesis |
| 3. B | GO:0005865 | striated muscle thin filament |
| 3. B | GO:0006936 | muscle contraction |
| 3. B | GO:0003007 | heart morphogenesis |
| 3. B | GO:0045198 | establishment of epithelial cell apical/basal polarity |
| 3. B | GO:1902938 | regulation of intracellular calcium activated chloride channel activity |
| 3. B | GO:0050053 | levansucrase activity |
| 3. B | GO:0008933 | lytic transglycosylase activity |
| 3. B | GO:1902817 | negative regulation of protein localization to microtubule |
| 3. B | GO:0043056 | forward locomotion |
| 3. B | GO:0098932 | disruption by virus of host cell wall peptidoglycan during virus entry |
| 3. B | GO:0004713 | protein tyrosine kinase activity |
| 3. B | GO:0010950 | positive regulation of endopeptidase activity |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0150001 | primary dendrite |
| 3. B | GO:0045859 | regulation of protein kinase activity |
| 3. B | GO:0031674 | I band |
| 3. B | GO:0006941 | striated muscle contraction |
| 3. B | GO:1905406 | positive regulation of mitotic cohesin loading |
| 3. B | GO:0043197 | dendritic spine |
| 3. B | GO:0005102 | signaling receptor binding |
| 3. B | GO:0005606 | laminin-1 complex |
| 3. B | GO:0035011 | melanotic encapsulation of foreign target |
| 3. B | GO:0032700 | negative regulation of interleukin-17 production |
| 3. B | GO:0040017 | positive regulation of locomotion |
| 3. B | GO:0008022 | protein C-terminus binding |
| 3. B | GO:0048208 | COPII vesicle coating |
| 3. B | GO:0099001 | viral genome ejection through host cell envelope, long flexible tail mechanism |
| 3. B | GO:0009758 | carbohydrate utilization |
| 3. B | GO:1905664 | regulation of calcium ion import across plasma membrane |
| 3. B | GO:0002224 | toll-like receptor signaling pathway |
| 3. B | GO:0043621 | protein self-association |
| 3. B | GO:0051592 | response to calcium ion |
| 3. B | GO:0055008 | cardiac muscle tissue morphogenesis |
| 3. B | GO:0043010 | camera-type eye development |
| 3. B | GO:0031114 | regulation of microtubule depolymerization |
| 3. B | GO:1901897 | regulation of relaxation of cardiac muscle |
| 3. B | GO:0003146 | heart jogging |
| 3. B | GO:0043208 | glycosphingolipid binding |
| 3. B | GO:0003300 | cardiac muscle hypertrophy |
| 3. B | GO:0007155 | cell adhesion |
| 3. B | GO:0007512 | adult heart development |
| 3. B | GO:0050882 | voluntary musculoskeletal movement |
| 3. B | GO:0031433 | telethonin binding |
| 3. B | GO:0031594 | neuromuscular junction |
| 3. B | GO:0030155 | regulation of cell adhesion |
| 3. B | GO:0032703 | negative regulation of interleukin-2 production |
| 3. B | GO:0060445 | branching involved in salivary gland morphogenesis |
| 3. B | GO:0032224 | positive regulation of synaptic transmission, cholinergic |
| 3. B | GO:0048769 | sarcomerogenesis |
| 3. B | GO:0070885 | negative regulation of calcineurin-NFAT signaling cascade |
| 3. B | GO:0005604 | basement membrane |
| 3. B | GO:0050714 | positive regulation of protein secretion |
| 3. B | GO:0000794 | condensed nuclear chromosome |
| 3. B | GO:0035001 | dorsal trunk growth, open tracheal system |
| 3. B | GO:0021591 | ventricular system development |
| 3. B | GO:0036062 | presynaptic periactive zone |
| 3. B | GO:2000010 | positive regulation of protein localization to cell surface |
| 3. B | GO:0030241 | skeletal muscle myosin thick filament assembly |
| 3. B | GO:0090647 | modulation of age-related behavioral decline |
| 3. B | GO:1901379 | regulation of potassium ion transmembrane transport |
| 3. B | GO:0055002 | striated muscle cell development |
| 3. B | GO:0071921 | cohesin loading |
| 3. B | GO:0062023 | collagen-containing extracellular matrix |
| 3. B | GO:0048703 | embryonic viscerocranium morphogenesis |
| 3. B | GO:0034087 | establishment of mitotic sister chromatid cohesion |
| 3. B | GO:0035995 | detection of muscle stretch |
| 3. B | GO:1903829 | positive regulation of protein localization |
| 3. B | GO:0014037 | Schwann cell differentiation |
| 3. B | GO:0050790 | regulation of catalytic activity |
| 3. B | GO:0008093 | cytoskeletal anchor activity |
| 3. B | GO:0030506 | ankyrin binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q9NYA3 | Golgin subfamily A member 6A | 1.74e-11 | 2.39e-04 | 1.01e-29 |
| 1. PB | Q8N9W4 | Golgin subfamily A member 6-like protein 2 | 1.77e-07 | 5.01e-09 | 9.94e-138 |
| 1. PB | H0YM25 | Golgin subfamily A member 6-like protein 22 | 6.80e-13 | 5.40e-24 | 0.0 |
| 1. PB | Q62839 | Golgin subfamily A member 2 | 5.39e-10 | 1.28e-03 | 1.38e-33 |
| 1. PB | Q8N7Z2 | Golgin subfamily A member 6-like protein 1 | 0 | 1.30e-166 | 0.0 |
| 1. PB | Q921M4 | Golgin subfamily A member 2 | 9.42e-09 | 7.23e-03 | 4.76e-33 |
| 1. PB | Q585H6 | Flagellar attachment zone protein 1 | 4.25e-05 | 2.20e-02 | 0.017 |
| 1. PB | A0A1B0GV03 | Golgin subfamily A member 6-like protein 7 | 1.48e-12 | 2.79e-05 | 3.13e-106 |
| 1. PB | A6NEM1 | Golgin subfamily A member 6-like protein 9 | 5.15e-04 | 4.71e-02 | 3.38e-08 |
| 1. PB | A6NDN3 | Golgin subfamily A member 6B | 1.68e-10 | 8.00e-05 | 1.49e-28 |
| 1. PB | P0CG33 | Golgin subfamily A member 6D | 2.92e-11 | 3.40e-03 | 9.56e-29 |
| 1. PB | A6NDK9 | Golgin subfamily A member 6C | 3.60e-09 | 3.47e-05 | 3.77e-29 |
| 1. PB | A8MZA4 | Golgin subfamily A member 6-like protein 6 | 0.00e+00 | 5.74e-77 | 0.0 |
| 2. P | A2A6M5 | Calcium-binding and coiled-coil domain-containing protein 2 | 2.96e-04 | 1.65e-03 | NA |
| 2. P | Q9JL35 | High mobility group nucleosome-binding domain-containing protein 5 | 7.62e-01 | 4.27e-02 | NA |
| 2. P | Q5BJK8 | Golgi integral membrane protein 4 | 5.18e-06 | 2.25e-02 | NA |
| 2. P | Q9H094 | Neuroblastoma breakpoint family member 3 | 1.84e-02 | 8.54e-03 | NA |
| 2. P | Q9H321 | Variable charge X-linked protein 3B | 6.04e-01 | 9.21e-05 | NA |
| 2. P | Q4A0V8 | Uro-adherence factor A | 9.83e-01 | 2.16e-03 | NA |
| 2. P | Q5SRN2 | Testis-expressed basic protein 1 | 2.20e-01 | 2.03e-03 | NA |
| 2. P | O00461 | Golgi integral membrane protein 4 | 1.11e-07 | 6.50e-03 | NA |
| 2. P | Q5ZLS3 | E3 ubiquitin-protein ligase BRE1A | 1.34e-07 | 4.76e-02 | NA |
| 2. P | Q8BXA1 | Golgi integral membrane protein 4 | 1.20e-06 | 6.71e-03 | NA |
| 2. P | P0DPF3 | Neuroblastoma breakpoint family member 9 | 8.07e-02 | 8.54e-03 | NA |
| 2. P | Q66HF9 | Leucine-rich repeat flightless-interacting protein 1 | 3.39e-03 | 3.16e-02 | NA |
| 2. P | Q95WA4 | Spore wall protein 2 | 1.25e-02 | 5.38e-03 | NA |
| 2. P | Q5DTM8 | E3 ubiquitin-protein ligase BRE1A | 3.09e-07 | 5.16e-03 | NA |
| 2. P | Q5VTR2 | E3 ubiquitin-protein ligase BRE1A | 7.81e-08 | 1.84e-03 | NA |
| 2. P | Q9H320 | Variable charge X-linked protein 1 | 5.37e-01 | 3.08e-06 | NA |
| 2. P | A2VDP1 | E3 ubiquitin-protein ligase BRE1A | 1.10e-07 | 7.08e-03 | NA |
| 2. P | Q26005 | Ring-infected erythrocyte surface antigen (Fragment) | 8.81e-05 | 1.32e-02 | NA |
| 2. P | Q6RHW0 | Keratin, type I cytoskeletal 9 | 5.28e-06 | 4.31e-02 | NA |
| 2. P | Q86RN8 | Paramyosin | 6.27e-09 | 4.71e-02 | NA |
| 2. P | P51814 | Zinc finger protein 41 | 3.80e-01 | 4.95e-02 | NA |
| 2. P | O04492 | Double-stranded RNA-binding protein 1 | 3.89e-01 | 4.67e-02 | NA |
| 2. P | Q9NNX9 | Variable charge X-linked protein 3 | 6.59e-01 | 8.72e-03 | NA |
| 2. P | Q54KY8 | Putative mediator of RNA polymerase II transcription subunit 9 | 1.53e-02 | 1.78e-02 | NA |
| 2. P | Q06002 | Filensin | 1.61e-06 | 2.83e-05 | NA |
| 2. P | Q5MJ10 | Sperm protein associated with the nucleus on the X chromosome N2 | 3.36e-01 | 5.85e-03 | NA |
| 2. P | A6NEY3 | Putative golgin subfamily A member 6-like protein 3 | 1.82e-09 | 5.10e-06 | NA |
| 2. P | P82970 | High mobility group nucleosome-binding domain-containing protein 5 | 6.76e-01 | 3.18e-04 | NA |
| 2. P | Q8MUF6 | Paramyosin | 1.72e-12 | 4.67e-02 | NA |
| 2. P | D3YU32 | Testis-expressed protein 13C-1 | 3.38e-02 | 1.54e-02 | NA |
| 3. B | I6L899 | Golgin subfamily A member 8R | 2.65e-07 | NA | 2.83e-07 |
| 3. B | Q8WZ42 | Titin | NA | NA | 3.55e-07 |
| 3. B | A6NMD2 | Golgin subfamily A member 8J | 2.91e-07 | NA | 2.83e-06 |
| 3. B | Q00174 | Laminin subunit alpha | NA | NA | 0.003 |
| 3. B | F8WBI6 | Golgin subfamily A member 8N | 2.30e-07 | NA | 6.42e-10 |
| 3. B | Q08379 | Golgin subfamily A member 2 | 3.32e-10 | NA | 1.96e-39 |
| 3. B | A6NI86 | Golgin subfamily A member 6-like protein 10 | 3.89e-09 | NA | 5.14e-08 |
| 3. B | F1QBY1 | Nipped-B-like protein B | NA | NA | 0.008 |
| 3. B | Q60675 | Laminin subunit alpha-2 | NA | NA | 0.004 |
| 3. B | P24043 | Laminin subunit alpha-2 | NA | NA | 9.18e-05 |
| 3. B | H3BV12 | Golgin subfamily A member 8Q | 1.23e-07 | NA | 1.22e-09 |
| 3. B | O64046 | Probable tape measure protein | NA | NA | 0.001 |
| 3. B | Q21313 | Laminin-like protein epi-1 | NA | NA | 8.90e-06 |
| 3. B | H3BPF8 | Golgin subfamily A member 8S | 2.13e-08 | NA | 9.85e-20 |
| 3. B | Q70XJ9 | Levansucrase | 9.55e-01 | NA | 0.008 |
| 3. B | A6NN73 | Golgin subfamily A member 8C | 2.68e-07 | NA | 7.56e-17 |
| 3. B | A8MQT2 | Golgin subfamily A member 8B | 1.58e-07 | NA | 9.40e-10 |
| 3. B | P27177 | Major prion protein homolog | 2.68e-01 | NA | 2.03e-06 |
| 3. B | P27951 | IgA FC receptor | 6.50e-02 | NA | 0.032 |
| 3. B | Q54EQ9 | Putative uncharacterized protein DDB_G0291608 | 1.84e-01 | NA | 0.035 |
| 3. B | D6RF30 | Golgin subfamily A member 8K | 1.21e-07 | NA | 3.84e-06 |
| 3. B | Q6ZQQ6 | WD repeat-containing protein 87 | NA | NA | 3.55e-04 |
| 3. B | H3BQL2 | Golgin subfamily A member 8T | 1.14e-08 | NA | 1.28e-07 |
| 3. B | P19137 | Laminin subunit alpha-1 | NA | NA | 5.24e-05 |
| 3. B | A6NCC3 | Golgin subfamily A member 8O | 3.53e-07 | NA | 5.36e-10 |
| 3. B | A3LZ57 | COPII coat assembly protein SEC16 | 8.55e-01 | NA | 5.37e-04 |
| 3. B | P78559 | Microtubule-associated protein 1A | NA | NA | 2.02e-07 |
| 3. B | Q8ILR9 | Protein PF14_0175 | NA | NA | 0.010 |
| 3. B | O31976 | SPbeta prophage-derived uncharacterized transglycosylase YomI | 7.45e-03 | NA | 7.24e-04 |
| 3. B | A7E2F4 | Golgin subfamily A member 8A | 4.12e-08 | NA | 1.34e-06 |
| 3. B | Q4R9C9 | Coiled-coil domain-containing protein 70 | 8.78e-06 | NA | 0.015 |
| 3. B | H0YKK7 | Putative golgin subfamily A member 6-like protein 19 | 4.48e-10 | NA | 5.69e-08 |
| 3. B | A2ASS6 | Titin | NA | NA | 8.39e-06 |
| 3. B | A6NC78 | Putative golgin subfamily A member 8I | 4.38e-08 | NA | 8.11e-07 |
| 3. B | H3BSY2 | Golgin subfamily A member 8M | 2.89e-08 | NA | 8.54e-07 |
| 3. B | P25391 | Laminin subunit alpha-1 | NA | NA | 0.003 |