Summary

Q8N8A8

Homolog: Q8CHT6.
Function: Protein FAM169B.

Statistics

Total GO Annotation: 46
Unique PROST Go: 45
Unique BLAST Go: 1

Total Homologs: 53
Unique PROST Homologs: 49
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8CHT6 (Protein FAM169B) with a FATCAT P-Value: 2.42e-07 and RMSD of 2.48 angstrom. The sequence alignment identity is 32.0%.
Structural alignment shown in left. Query protein Q8N8A8 colored as red in alignment, homolog Q8CHT6 colored as blue. Query protein Q8N8A8 is also shown in right top, homolog Q8CHT6 showed in right bottom. They are colored based on secondary structures. 

  Q8N8A8 ---------------------------------------------------------------------------------------------------- 0
  Q8CHT6 MAVYKEAYPVDILEDDAEGYQAAAEAYYEMLREGAQTSAEVISLSTGEQVRLETSSLCFCTIYRDEPQHKILGLVNPQDTKTVVAVYLKESWWSIEDILR 100

  Q8N8A8 ---------MKVQSFGERVVLFILNAIIFGRLERNLDDDDMFFLPHSVKEQAKILWRRGAAVGFYTTKMKGRLCGDGTGACYLLPVFDTVFIRRKHWHRG 91
  Q8CHT6 TSDPTREGLMKVQSFGERIVLFVLNVIVFGRLERRLHIDDMFFLPHPAKEQAKILWKDGAAVAFYSVKMKGSLCGDGTGTCYLLPVLDTVFVRRKNRCQG 200

  Q8N8A8 LGTAMLRDFCETFPEDEALGVSCSMSPAMYQAHPGNSEDVSRHARTSQNDRPR----QPAPGD-GSKERM-------CGE-ELED--TKDDPECGVEEED 176
  Q8CHT6 LGTAMLRDFCDTFQGDEALGISCPISPAMYRV-------LRQFLLTCPGERGRLWEVEP-PGAWG-QQRVNIWLKVYLQERRLQDGSTV-HPKCS--EED 288

  Q8N8A8 AGLAGQPPGKLTR-SSP------------------------------------ 192
  Q8CHT6 T----DTPGQASQEDGPTQFNHGESHKEWAVGEPERTQNGRRCAQVCEEARQV 337

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0019799 tubulin N-acetyltransferase activity
2. P GO:0004402 histone acetyltransferase activity
2. P GO:0006334 nucleosome assembly
2. P GO:0005874 microtubule
2. P GO:0004468 lysine N-acetyltransferase activity, acting on acetyl phosphate as donor
2. P GO:0006474 N-terminal protein amino acid acetylation
2. P GO:0006473 protein acetylation
2. P GO:0031415 NatA complex
2. P GO:0008283 cell population proliferation
2. P GO:0005819 spindle
2. P GO:0006323 DNA packaging
2. P GO:0099018 restriction-modification system evasion by virus
2. P GO:0043966 histone H3 acetylation
2. P GO:0016573 histone acetylation
2. P GO:0030424 axon
2. P GO:1990190 peptide-glutamate-N-acetyltransferase activity
2. P GO:0005925 focal adhesion
2. P GO:0006475 internal protein amino acid acetylation
2. P GO:0017196 N-terminal peptidyl-methionine acetylation
2. P GO:0097014 ciliary plasm
2. P GO:0043967 histone H4 acetylation
2. P GO:0001966 thigmotaxis
2. P GO:0016746 acyltransferase activity
2. P GO:0008080 N-acetyltransferase activity
2. P GO:0017198 N-terminal peptidyl-serine acetylation
2. P GO:0005829 cytosol
2. P GO:0004596 peptide alpha-N-acetyltransferase activity
2. P GO:0006348
2. P GO:0070507 regulation of microtubule cytoskeleton organization
2. P GO:0042490 mechanoreceptor differentiation
2. P GO:0010485 H4 histone acetyltransferase activity
2. P GO:0031981 nuclear lumen
2. P GO:0000123 histone acetyltransferase complex
2. P GO:0007064 mitotic sister chromatid cohesion
2. P GO:2000719 negative regulation of maintenance of mitotic sister chromatid cohesion, centromeric
2. P GO:0000139 Golgi membrane
2. P GO:0048666 neuron development
2. P GO:0018002 N-terminal peptidyl-glutamic acid acetylation
2. P GO:0071929 alpha-tubulin acetylation
2. P GO:0005905 clathrin-coated pit
2. P GO:0061606 N-terminal protein amino acid propionylation
2. P GO:0031248 protein acetyltransferase complex
2. P GO:1990189 peptide-serine-N-acetyltransferase activity
2. P GO:0007059 chromosome segregation
2. P GO:0042803 protein homodimerization activity
3. B GO:0005637 nuclear inner membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8N8A8 Protein FAM169B 0 9.82e-131 7.06e-144
1. PB Q8CHT6 Protein FAM169B 2.42e-07 4.68e-06 7.25e-64
2. P Q9H7X0 N-alpha-acetyltransferase 60 2.73e-03 2.65e-05 NA
2. P Q01075 Protein gp14 NA 3.54e-03 NA
2. P Q8VVH1 Nodulation protein A 1.26e-04 6.21e-04 NA
2. P P41227 N-alpha-acetyltransferase 10 5.02e-03 1.63e-02 NA
2. P A8BM50 Alpha-tubulin N-acetyltransferase 8.75e-03 4.47e-02 NA
2. P Q57XX3 Alpha-tubulin N-acetyltransferase 8.82e-04 9.17e-11 NA
2. P Q17QK9 N-alpha-acetyltransferase 60 3.57e-03 2.88e-05 NA
2. P Q52839 Nodulation protein A 1.93e-04 2.28e-04 NA
2. P Q9BSU3 N-alpha-acetyltransferase 11 1.33e-03 4.20e-05 NA
2. P Q5DD96 Alpha-tubulin N-acetyltransferase 4.51e-04 3.63e-14 NA
2. P Q9NHD5 Probable N-acetyltransferase san 8.19e-04 2.13e-03 NA
2. P P02962 Nodulation protein A 1.83e-04 1.17e-02 NA
2. P P12779 Host-inducible protein A 2.82e-02 3.42e-02 NA
2. P B2RZF9 Alpha-tubulin N-acetyltransferase 1 1.61e-03 1.32e-11 NA
2. P P36416 N-terminal acetyltransferase complex ARD1 subunit homolog 4.65e-04 1.01e-05 NA
2. P P06018 Methylcarbamoylase mom NA 3.85e-03 NA
2. P Q9DBU2 N-alpha-acetyltransferase 60 2.51e-03 3.22e-06 NA
2. P Q23192 Alpha-tubulin N-acetyltransferase 2 8.44e-03 4.86e-14 NA
2. P Q9RAN9 Nodulation protein A 1.51e-04 2.28e-04 NA
2. P Q2KI14 N-alpha-acetyltransferase 10 9.03e-04 1.78e-02 NA
2. P P69959 Low calcium response locus protein R 7.41e-02 3.11e-04 NA
2. P O45100 Alpha-tubulin N-acetyltransferase 1 3.72e-04 6.77e-23 NA
2. P Q3UX61 N-alpha-acetyltransferase 11 3.03e-03 3.17e-05 NA
2. P Q5TM63 Alpha-tubulin N-acetyltransferase 1 6.86e-03 5.07e-08 NA
2. P Q4CQJ5 Alpha-tubulin N-acetyltransferase 1 1.11e-02 7.33e-08 NA
2. P O59806 Uncharacterized N-acetyltransferase C550.08 9.47e-02 1.61e-02 NA
2. P P72329 Nodulation protein A 1.75e-04 9.93e-03 NA
2. P A8E5V7 N-alpha-acetyltransferase 60 3.15e-03 1.10e-07 NA
2. P P0C2V7 Low calcium response locus protein R 8.16e-02 5.00e-03 NA
2. P Q4Q9X8 Alpha-tubulin N-acetyltransferase 2.98e-04 4.44e-04 NA
2. P Q767K7 Alpha-tubulin N-acetyltransferase 1 7.25e-03 7.52e-14 NA
2. P A4I1F7 Alpha-tubulin N-acetyltransferase 2.00e-03 4.16e-05 NA
2. P Q869X7 Histone acetyltransferase type B catalytic subunit DDB_G0275159 1.53e-03 1.64e-02 NA
2. P A8XKM2 Alpha-tubulin N-acetyltransferase 2 6.73e-03 2.63e-18 NA
2. P A3KPA3 N-alpha-acetyltransferase 60 3.00e-03 7.56e-06 NA
2. P Q4DTX9 Alpha-tubulin N-acetyltransferase 2 2.32e-03 4.76e-09 NA
2. P P69960 Low calcium response locus protein R 7.25e-02 3.11e-04 NA
2. P P08794 Methylcarbamoylase mom NA 3.78e-03 NA
2. P Q16Y34 Alpha-tubulin N-acetyltransferase 7.05e-03 1.79e-13 NA
2. P Q9W5X9 Alpha-tubulin N-acetyltransferase 2 8.85e-04 9.41e-13 NA
2. P A8XRF5 Alpha-tubulin N-acetyltransferase 1 6.75e-03 2.63e-18 NA
2. P Q3MHC1 N-alpha-acetyltransferase 60 3.40e-03 2.61e-06 NA
2. P P07347 N-terminal acetyltransferase A complex catalytic subunit ARD1 3.81e-03 3.96e-02 NA
2. P P39152 Uncharacterized protein YwlB 7.02e-05 2.43e-02 NA
2. P P50349 Nodulation protein A 8.43e-05 4.91e-04 NA
2. P A1JU75 Low calcium response locus protein R 4.73e-02 5.33e-03 NA
2. P Q6PH17 Alpha-tubulin N-acetyltransferase 1 8.10e-04 7.10e-14 NA
2. P Q58CX6 Alpha-tubulin N-acetyltransferase 1 5.96e-04 8.80e-06 NA
2. P B3RNE8 Alpha-tubulin N-acetyltransferase 1.59e-03 6.86e-06 NA
3. B Q9Y6X4 Soluble lamin-associated protein of 75 kDa 1.97e-03 NA 1.05e-27
3. B Q5XG69 Soluble lamin-associated protein of 75 kDa 1.01e-03 NA 8.44e-29