Results | PROST

Summary

Q8N9C0

Homolog: Q63518.
Function: Myosin-binding protein C, slow-type (Fragment).

Statistics

Total GO Annotation: 705
Unique PROST Go: 15
Unique BLAST Go: 611

Total Homologs: 373
Unique PROST Homologs: 0
Unique BLAST Homologs: 345

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q63518 (Myosin-binding protein C, slow-type (Fragment)) with a FATCAT P-Value: 3.99e-11 and RMSD of 2.84 angstrom. The sequence alignment identity is 14.8%.
Structural alignment shown in left. Query protein Q8N9C0 colored as red in alignment, homolog Q63518 colored as blue. Query protein Q8N9C0 is also shown in right top, homolog Q63518 showed in right bottom. They are colored based on secondary structures.

  Q8N9C0 MTTIHSRQMLQEHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNIPAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNAKPHISW 100
  Q63518 ---------------------------------------------------------------------------------------------------- 0

  Q8N9C0 KRESGIPIKESAKIFYDSINKEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVANEKEMLEILSKVPK 200
  Q63518 ---------------------------------------------------------------------------------------------------- 0

  Q8N9C0 KDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPLEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNV 300
  Q63518 ---------------------------------------------------------------------------------------------------- 0

  Q8N9C0 NMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVWKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFS 400
  Q63518 ---------------------------------------------------------------------------------------------------- 0

  Q8N9C0 AEAGNLVQKAQLTVDRIPIKFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTK--YSMNHEGKRAELIIEDAQLSDGGEYTVVAMQDGDP 498
  Q63518 -------------------------------------------------------EEIVPGPKSRYRIKVEGKKHTLIIEGATKADSAEYSV--MTTGG- 42

  Q8N9C0 TEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLN-DEKVEGVWLKDGKEITDLP---G--MQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTES 592
  Q63518 ---QSSAKLSVDLRPLKITTPLTDQTVKLGK--EVCLKCEISENVPGKWTKNG-----LPVQEGERLKVVHKGRIHKLVIANALIEDEGEYVF----TPD 128

  Q8N9C0 EASV------FIADPPTIDPSVLEALAA-HAITVKVGHTAHIKVPFRGKPLPKVTWYK-DG--MEVTEEERVSMERGEDQALLTISNCVREDSGLILLKL 682
  Q63518 AITVPLVCQIHVIDPPKI---ILDGLEADNTVTVIAGSKLRLEIPVTGEPPPKAIWSRADKAIMEGS--GRIRAESYPDSSTLVIDVAERDDSGVYNINL 223

  Q8N9C0 KNDHGSATAT--LHL--S-VLEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKC---TVD--GLLEDTEYE 772
  Q63518 KNEAGEAHASIKLRLWISLILR---LA--PNVTEVGDDWCIMNWEPPVYDGGSPILGYFIERKKKQSSRWMRLNFD-L----CKETTFEPKKMIEGVAYE 313

  Q8N9C0 FRVIAVNKAGPGQPSVPSSSVVAKDPV---KPPGLVQDLHVSDS-SNSSISLAWREP----AEGDPPSGYILEM----------------RAED--TKEW 846
  Q63518 VRIFAVNAIGISKPSMPSKPFV---PLAVTSPPTL---LAV-DSVTDSSVTMKWRPPDQIGAAG--LSGYVLEYCFEGSTSAKQSNENGEAANDLPAEDW 404

  Q8N9C0 SKCTKIPISGTC---YTVGGL-IERQKYFFRIRAVNEAGVGE------PVELDKGVRAMPP----PG-LTTT---------------------------- 903
  Q63518 SLQTQ---TGSTRPKFTITGLPTD-AKIFVRVKAINAAGASETKYYSQPI-LVKEI-IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD 498

  Q8N9C0 ---------------------------------------------------------------------------------------------------- 903
  Q63518 GAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLEVKVDKYVENASIDIQIVDRPGPPQAVTIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 598

  Q8N9C0 ----------------------- 903
  Q63518 EWFAVIEHYHRTNATITELVIGN 621

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0060168	positive regulation of adenosine receptor signaling pathway
1. PB	GO:0006942	regulation of striated muscle contraction
1. PB	GO:0021682	nerve maturation
1. PB	GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules
1. PB	GO:0021549	cerebellum development
1. PB	GO:0045121	membrane raft
1. PB	GO:0007399	nervous system development
1. PB	GO:0008307	structural constituent of muscle
1. PB	GO:0030424	axon
1. PB	GO:0007409	axonogenesis
1. PB	GO:0008366	axon ensheathment
1. PB	GO:0007605	sensory perception of sound
1. PB	GO:0031430	M band
1. PB	GO:0060467	negative regulation of fertilization
1. PB	GO:0099054	presynapse assembly
1. PB	GO:0031672	A band
1. PB	GO:0010954	positive regulation of protein processing
1. PB	GO:0045214	sarcomere organization
1. PB	GO:0032982	myosin filament
1. PB	GO:0032971	regulation of muscle filament sliding
1. PB	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation
1. PB	GO:0005737	cytoplasm
1. PB	GO:0031133	regulation of axon diameter
1. PB	GO:0019991	septate junction assembly
1. PB	GO:0007420	brain development
1. PB	GO:0070593	dendrite self-avoidance
1. PB	GO:0007612	learning
1. PB	GO:0043005	neuron projection
1. PB	GO:0010765	positive regulation of sodium ion transport
1. PB	GO:2000747	negative regulation of defecation rhythm
1. PB	GO:0044224	juxtaparanode region of axon
1. PB	GO:0048842	positive regulation of axon extension involved in axon guidance
1. PB	GO:0060048	cardiac muscle contraction
1. PB	GO:0007219	Notch signaling pathway
1. PB	GO:0043025	neuronal cell body
1. PB	GO:0005886	plasma membrane
1. PB	GO:0006936	muscle contraction
1. PB	GO:0071205	protein localization to juxtaparanode region of axon
1. PB	GO:0031034	myosin filament assembly
1. PB	GO:0061343	cell adhesion involved in heart morphogenesis
1. PB	GO:0005863	striated muscle myosin thick filament
1. PB	GO:0021853	cerebral cortex GABAergic interneuron migration
1. PB	GO:0048168	regulation of neuronal synaptic plasticity
1. PB	GO:0060857	establishment of glial blood-brain barrier
1. PB	GO:0022010	central nervous system myelination
1. PB	GO:0007411	axon guidance
1. PB	GO:0007160	cell-matrix adhesion
1. PB	GO:0007158	neuron cell-cell adhesion
1. PB	GO:0098688	parallel fiber to Purkinje cell synapse
1. PB	GO:0043209	myelin sheath
1. PB	GO:0032036	myosin heavy chain binding
1. PB	GO:0071206	establishment of protein localization to juxtaparanode region of axon
1. PB	GO:0036309	protein localization to M-band
1. PB	GO:0033563	dorsal/ventral axon guidance
1. PB	GO:0033268	node of Ranvier
1. PB	GO:0043621	protein self-association
1. PB	GO:0045163	clustering of voltage-gated potassium channels
1. PB	GO:0097512	cardiac myofibril
1. PB	GO:0048710	regulation of astrocyte differentiation
1. PB	GO:0007155	cell adhesion
1. PB	GO:0001764	neuron migration
1. PB	GO:0099025	anchored component of postsynaptic membrane
1. PB	GO:0035545	determination of left/right asymmetry in nervous system
1. PB	GO:0045665	negative regulation of neuron differentiation
1. PB	GO:0055010	ventricular cardiac muscle tissue morphogenesis
1. PB	GO:0097090	presynaptic membrane organization
1. PB	GO:0098982	GABA-ergic synapse
1. PB	GO:0031225	anchored component of membrane
1. PB	GO:0031175	neuron projection development
1. PB	GO:0010628	positive regulation of gene expression
1. PB	GO:0099026	anchored component of presynaptic membrane
1. PB	GO:0007413	axonal fasciculation
1. PB	GO:0045202	synapse
1. PB	GO:0017022	myosin binding
1. PB	GO:0098632	cell-cell adhesion mediator activity
1. PB	GO:0007628	adult walking behavior
1. PB	GO:0005918	septate junction
1. PB	GO:0010769	regulation of cell morphogenesis involved in differentiation
1. PB	GO:0010976	positive regulation of neuron projection development
2. P	GO:0002027	regulation of heart rate
2. P	GO:1903356	positive regulation of distal tip cell migration
2. P	GO:0045747	positive regulation of Notch signaling pathway
2. P	GO:0060562	epithelial tube morphogenesis
2. P	GO:0008016	regulation of heart contraction
2. P	GO:0040015	negative regulation of multicellular organism growth
2. P	GO:0035150	regulation of tube size
2. P	GO:0007527	adult somatic muscle development
2. P	GO:0030246	carbohydrate binding
2. P	GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity
2. P	GO:0031623	receptor internalization
2. P	GO:0090327	negative regulation of locomotion involved in locomotory behavior
2. P	GO:0000226	microtubule cytoskeleton organization
2. P	GO:0005523	tropomyosin binding
2. P	GO:0032781	positive regulation of ATP-dependent activity
3. B	GO:0030198	extracellular matrix organization
3. B	GO:0060021	roof of mouth development
3. B	GO:0001938	positive regulation of endothelial cell proliferation
3. B	GO:2001260	regulation of semaphorin-plexin signaling pathway
3. B	GO:0035790	platelet-derived growth factor receptor-alpha signaling pathway
3. B	GO:0019226	transmission of nerve impulse
3. B	GO:0014705	C zone
3. B	GO:0098797	plasma membrane protein complex
3. B	GO:0003148	outflow tract septum morphogenesis
3. B	GO:0009888	tissue development
3. B	GO:0030913	paranodal junction assembly
3. B	GO:0090037	positive regulation of protein kinase C signaling
3. B	GO:0021891	olfactory bulb interneuron development
3. B	GO:0042731	PH domain binding
3. B	GO:0031549	negative regulation of brain-derived neurotrophic factor receptor signaling pathway
3. B	GO:1990782	protein tyrosine kinase binding
3. B	GO:0004687	myosin light chain kinase activity
3. B	GO:0010640	regulation of platelet-derived growth factor receptor signaling pathway
3. B	GO:0007507	heart development
3. B	GO:0030539	male genitalia development
3. B	GO:0036324	vascular endothelial growth factor receptor-2 signaling pathway
3. B	GO:0001701	in utero embryonic development
3. B	GO:0005021	vascular endothelial growth factor-activated receptor activity
3. B	GO:0010966	regulation of phosphate transport
3. B	GO:0035017	cuticle pattern formation
3. B	GO:0030275	LRR domain binding
3. B	GO:0007044	cell-substrate junction assembly
3. B	GO:0001756	somitogenesis
3. B	GO:0032421	stereocilium bundle
3. B	GO:0060615	mammary gland bud formation
3. B	GO:0060412	ventricular septum morphogenesis
3. B	GO:0070372	regulation of ERK1 and ERK2 cascade
3. B	GO:0004725	protein tyrosine phosphatase activity
3. B	GO:0045663	positive regulation of myoblast differentiation
3. B	GO:2000573	positive regulation of DNA biosynthetic process
3. B	GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity
3. B	GO:0010712	regulation of collagen metabolic process
3. B	GO:0019903	protein phosphatase binding
3. B	GO:0008344	adult locomotory behavior
3. B	GO:0008038	neuron recognition
3. B	GO:0014722	regulation of skeletal muscle contraction by calcium ion signaling
3. B	GO:0030240	skeletal muscle thin filament assembly
3. B	GO:0032956	regulation of actin cytoskeleton organization
3. B	GO:0050885	neuromuscular process controlling balance
3. B	GO:0034067	protein localization to Golgi apparatus
3. B	GO:0009887	animal organ morphogenesis
3. B	GO:1900020	positive regulation of protein kinase C activity
3. B	GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
3. B	GO:0060009	Sertoli cell development
3. B	GO:0035230	cytoneme
3. B	GO:0106030	neuron projection fasciculation
3. B	GO:0002020	protease binding
3. B	GO:0001657	ureteric bud development
3. B	GO:0050770	regulation of axonogenesis
3. B	GO:0022405	hair cycle process
3. B	GO:0045340	mercury ion binding
3. B	GO:0033600	negative regulation of mammary gland epithelial cell proliferation
3. B	GO:2001214	positive regulation of vasculogenesis
3. B	GO:0060419	heart growth
3. B	GO:0055003	cardiac myofibril assembly
3. B	GO:0007417	central nervous system development
3. B	GO:2001222	regulation of neuron migration
3. B	GO:0050925	negative regulation of negative chemotaxis
3. B	GO:0060449	bud elongation involved in lung branching
3. B	GO:0038083	peptidyl-tyrosine autophosphorylation
3. B	GO:0097105	presynaptic membrane assembly
3. B	GO:2000251	positive regulation of actin cytoskeleton reorganization
3. B	GO:0061098	positive regulation of protein tyrosine kinase activity
3. B	GO:0007520	myoblast fusion
3. B	GO:1904404	response to formaldehyde
3. B	GO:0060219	camera-type eye photoreceptor cell differentiation
3. B	GO:0050953	sensory perception of light stimulus
3. B	GO:0016202	regulation of striated muscle tissue development
3. B	GO:0042065	glial cell growth
3. B	GO:0005161	platelet-derived growth factor receptor binding
3. B	GO:0021963	spinothalamic tract morphogenesis
3. B	GO:0008045	motor neuron axon guidance
3. B	GO:0099560	synaptic membrane adhesion
3. B	GO:0060548	negative regulation of cell death
3. B	GO:0051057	positive regulation of small GTPase mediated signal transduction
3. B	GO:0016477	cell migration
3. B	GO:0097108	hedgehog family protein binding
3. B	GO:0050804	modulation of chemical synaptic transmission
3. B	GO:1903902	positive regulation of viral life cycle
3. B	GO:0016199	axon midline choice point recognition
3. B	GO:1904237	positive regulation of substrate-dependent cell migration, cell attachment to substrate
3. B	GO:0099545	trans-synaptic signaling by trans-synaptic complex
3. B	GO:0031529	ruffle organization
3. B	GO:0005887	integral component of plasma membrane
3. B	GO:0071694	maintenance of protein location in extracellular region
3. B	GO:0048814	regulation of dendrite morphogenesis
3. B	GO:0040017	positive regulation of locomotion
3. B	GO:0070700	BMP receptor binding
3. B	GO:0001945	lymph vessel development
3. B	GO:0061144	alveolar secondary septum development
3. B	GO:0005178	integrin binding
3. B	GO:0035315	hair cell differentiation
3. B	GO:0090272	negative regulation of fibroblast growth factor production
3. B	GO:0030425	dendrite
3. B	GO:0072378	blood coagulation, fibrin clot formation
3. B	GO:1904783	positive regulation of NMDA glutamate receptor activity
3. B	GO:0005595	collagen type XII trimer
3. B	GO:0031012	extracellular matrix
3. B	GO:0005634	nucleus
3. B	GO:0035385	Roundabout signaling pathway
3. B	GO:0033622	integrin activation
3. B	GO:0010629	negative regulation of gene expression
3. B	GO:0050850	positive regulation of calcium-mediated signaling
3. B	GO:0046875	ephrin receptor binding
3. B	GO:0045494	photoreceptor cell maintenance
3. B	GO:0003401	axis elongation
3. B	GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity
3. B	GO:0090179	planar cell polarity pathway involved in neural tube closure
3. B	GO:0060059	embryonic retina morphogenesis in camera-type eye
3. B	GO:1900272	negative regulation of long-term synaptic potentiation
3. B	GO:0005516	calmodulin binding
3. B	GO:0060312	regulation of blood vessel remodeling
3. B	GO:1902178	fibroblast growth factor receptor apoptotic signaling pathway
3. B	GO:0048730	epidermis morphogenesis
3. B	GO:0051174	regulation of phosphorus metabolic process
3. B	GO:0004672	protein kinase activity
3. B	GO:0021885	forebrain cell migration
3. B	GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan
3. B	GO:0048769	sarcomerogenesis
3. B	GO:0007223	Wnt signaling pathway, calcium modulating pathway
3. B	GO:0043410	positive regulation of MAPK cascade
3. B	GO:0002053	positive regulation of mesenchymal cell proliferation
3. B	GO:0061047	positive regulation of branching involved in lung morphogenesis
3. B	GO:0048812	neuron projection morphogenesis
3. B	GO:0002175	protein localization to paranode region of axon
3. B	GO:0050839	cell adhesion molecule binding
3. B	GO:0010717	regulation of epithelial to mesenchymal transition
3. B	GO:0048762	mesenchymal cell differentiation
3. B	GO:0005018	platelet-derived growth factor alpha-receptor activity
3. B	GO:0071372	cellular response to follicle-stimulating hormone stimulus
3. B	GO:1905490	negative regulation of sensory neuron axon guidance
3. B	GO:0039706	co-receptor binding
3. B	GO:0048681	negative regulation of axon regeneration
3. B	GO:0060541	respiratory system development
3. B	GO:0032391	photoreceptor connecting cilium
3. B	GO:0005007	fibroblast growth factor-activated receptor activity
3. B	GO:0051965	positive regulation of synapse assembly
3. B	GO:0035924	cellular response to vascular endothelial growth factor stimulus
3. B	GO:0030241	skeletal muscle myosin thick filament assembly
3. B	GO:0016203	muscle attachment
3. B	GO:0060763	mammary duct terminal end bud growth
3. B	GO:0030133	transport vesicle
3. B	GO:0032688	negative regulation of interferon-beta production
3. B	GO:0019227	neuronal action potential propagation
3. B	GO:0042060	wound healing
3. B	GO:0060828	regulation of canonical Wnt signaling pathway
3. B	GO:0050768	negative regulation of neurogenesis
3. B	GO:0019838	growth factor binding
3. B	GO:0005577	fibrinogen complex
3. B	GO:0045211	postsynaptic membrane
3. B	GO:0030017	sarcomere
3. B	GO:0043491	protein kinase B signaling
3. B	GO:0060739	mesenchymal-epithelial cell signaling involved in prostate gland development
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0048407	platelet-derived growth factor binding
3. B	GO:0010737	protein kinase A signaling
3. B	GO:0097161	DH domain binding
3. B	GO:0032966	negative regulation of collagen biosynthetic process
3. B	GO:0031290	retinal ganglion cell axon guidance
3. B	GO:0048496	maintenance of animal organ identity
3. B	GO:0090090	negative regulation of canonical Wnt signaling pathway
3. B	GO:0002066	columnar/cuboidal epithelial cell development
3. B	GO:0030016	myofibril
3. B	GO:0018108	peptidyl-tyrosine phosphorylation
3. B	GO:0006929	substrate-dependent cell migration
3. B	GO:0050803	regulation of synapse structure or activity
3. B	GO:0060174	limb bud formation
3. B	GO:0060171	stereocilium membrane
3. B	GO:0051371	muscle alpha-actinin binding
3. B	GO:0035987	endodermal cell differentiation
3. B	GO:0060523	prostate epithelial cord elongation
3. B	GO:0060595	fibroblast growth factor receptor signaling pathway involved in mammary gland specification
3. B	GO:0005911	cell-cell junction
3. B	GO:0060463	lung lobe morphogenesis
3. B	GO:0042692	muscle cell differentiation
3. B	GO:0048036	central complex development
3. B	GO:0003272	endocardial cushion formation
3. B	GO:0008543	fibroblast growth factor receptor signaling pathway
3. B	GO:0010715	regulation of extracellular matrix disassembly
3. B	GO:0035604	fibroblast growth factor receptor signaling pathway involved in positive regulation of cell proliferation in bone marrow
3. B	GO:0060076	excitatory synapse
3. B	GO:0009986	cell surface
3. B	GO:0032808	lacrimal gland development
3. B	GO:0022612	gland morphogenesis
3. B	GO:0005030	neurotrophin receptor activity
3. B	GO:0035373	chondroitin sulfate proteoglycan binding
3. B	GO:2001108	positive regulation of Rho guanyl-nucleotide exchange factor activity
3. B	GO:0051150	regulation of smooth muscle cell differentiation
3. B	GO:0010595	positive regulation of endothelial cell migration
3. B	GO:0002244	hematopoietic progenitor cell differentiation
3. B	GO:0097493	structural molecule activity conferring elasticity
3. B	GO:0017147	Wnt-protein binding
3. B	GO:0098978	glutamatergic synapse
3. B	GO:0098885	modification of postsynaptic actin cytoskeleton
3. B	GO:0007185	transmembrane receptor protein tyrosine phosphatase signaling pathway
3. B	GO:0055013	cardiac muscle cell development
3. B	GO:1904646	cellular response to amyloid-beta
3. B	GO:1904800	negative regulation of neuron remodeling
3. B	GO:0060837	blood vessel endothelial cell differentiation
3. B	GO:0048403	brain-derived neurotrophic factor binding
3. B	GO:0003158	endothelium development
3. B	GO:0010977	negative regulation of neuron projection development
3. B	GO:0051250	negative regulation of lymphocyte activation
3. B	GO:0042995	cell projection
3. B	GO:0043121	neurotrophin binding
3. B	GO:0005919	pleated septate junction
3. B	GO:0046959	habituation
3. B	GO:0038091	positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway
3. B	GO:0043394	proteoglycan binding
3. B	GO:0048643	positive regulation of skeletal muscle tissue development
3. B	GO:1990696	USH2 complex
3. B	GO:0038023	signaling receptor activity
3. B	GO:0014012	peripheral nervous system axon regeneration
3. B	GO:0021631	optic nerve morphogenesis
3. B	GO:0033631	cell-cell adhesion mediated by integrin
3. B	GO:0002142	stereocilia ankle link complex
3. B	GO:0006470	protein dephosphorylation
3. B	GO:0003007	heart morphogenesis
3. B	GO:0048565	digestive tract development
3. B	GO:1905274	regulation of modification of postsynaptic actin cytoskeleton
3. B	GO:0035335	peptidyl-tyrosine dephosphorylation
3. B	GO:0005912	adherens junction
3. B	GO:0043056	forward locomotion
3. B	GO:0050771	negative regulation of axonogenesis
3. B	GO:0032154	cleavage furrow
3. B	GO:0005614	interstitial matrix
3. B	GO:0019806	bromide peroxidase activity
3. B	GO:0007161	calcium-independent cell-matrix adhesion
3. B	GO:0048608	reproductive structure development
3. B	GO:0042476	odontogenesis
3. B	GO:0045839	negative regulation of mitotic nuclear division
3. B	GO:0034122	negative regulation of toll-like receptor signaling pathway
3. B	GO:1902004	positive regulation of amyloid-beta formation
3. B	GO:0048598	embryonic morphogenesis
3. B	GO:0051901	positive regulation of mitochondrial depolarization
3. B	GO:0015629	actin cytoskeleton
3. B	GO:0033327	Leydig cell differentiation
3. B	GO:0060137	maternal process involved in parturition
3. B	GO:0031674	I band
3. B	GO:1904782	negative regulation of NMDA glutamate receptor activity
3. B	GO:0099645	neurotransmitter receptor localization to postsynaptic specialization membrane
3. B	GO:0030193	regulation of blood coagulation
3. B	GO:0045664	regulation of neuron differentiation
3. B	GO:0048557	embryonic digestive tract morphogenesis
3. B	GO:0007611	learning or memory
3. B	GO:0048803	imaginal disc-derived male genitalia morphogenesis
3. B	GO:0034446	substrate adhesion-dependent cell spreading
3. B	GO:0005539	glycosaminoglycan binding
3. B	GO:0099056	integral component of presynaptic membrane
3. B	GO:0043395	heparan sulfate proteoglycan binding
3. B	GO:0032584	growth cone membrane
3. B	GO:0060670	branching involved in labyrinthine layer morphogenesis
3. B	GO:0031432	titin binding
3. B	GO:0043548	phosphatidylinositol 3-kinase binding
3. B	GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway
3. B	GO:0031433	telethonin binding
3. B	GO:0022407	regulation of cell-cell adhesion
3. B	GO:0072359	circulatory system development
3. B	GO:0070527	platelet aggregation
3. B	GO:0060442	branching involved in prostate gland morphogenesis
3. B	GO:0099629	postsynaptic specialization of symmetric synapse
3. B	GO:0055062	phosphate ion homeostasis
3. B	GO:0005158	insulin receptor binding
3. B	GO:0001946	lymphangiogenesis
3. B	GO:0005604	basement membrane
3. B	GO:0060664	epithelial cell proliferation involved in salivary gland morphogenesis
3. B	GO:0043087	regulation of GTPase activity
3. B	GO:0042327	positive regulation of phosphorylation
3. B	GO:0016331	morphogenesis of embryonic epithelium
3. B	GO:0060501	positive regulation of epithelial cell proliferation involved in lung morphogenesis
3. B	GO:0048010	vascular endothelial growth factor receptor signaling pathway
3. B	GO:0050927	positive regulation of positive chemotaxis
3. B	GO:0031952	regulation of protein autophosphorylation
3. B	GO:0008284	positive regulation of cell population proliferation
3. B	GO:0071635	negative regulation of transforming growth factor beta production
3. B	GO:0036057	slit diaphragm
3. B	GO:0030513	positive regulation of BMP signaling pathway
3. B	GO:0042472	inner ear morphogenesis
3. B	GO:0035603	fibroblast growth factor receptor signaling pathway involved in hemopoiesis
3. B	GO:0070640	vitamin D3 metabolic process
3. B	GO:0035602	fibroblast growth factor receptor signaling pathway involved in negative regulation of apoptotic process in bone marrow cell
3. B	GO:1904881	cellular response to hydrogen sulfide
3. B	GO:0070507	regulation of microtubule cytoskeleton organization
3. B	GO:0004714	transmembrane receptor protein tyrosine kinase activity
3. B	GO:0062023	collagen-containing extracellular matrix
3. B	GO:0060116	vestibular receptor cell morphogenesis
3. B	GO:0007224	smoothened signaling pathway
3. B	GO:0002102	podosome
3. B	GO:0021527	spinal cord association neuron differentiation
3. B	GO:0010811	positive regulation of cell-substrate adhesion
3. B	GO:0045467	R7 cell development
3. B	GO:0046658	anchored component of plasma membrane
3. B	GO:0098686	hippocampal mossy fiber to CA3 synapse
3. B	GO:0046580	negative regulation of Ras protein signal transduction
3. B	GO:0042802	identical protein binding
3. B	GO:0060529	squamous basal epithelial stem cell differentiation involved in prostate gland acinus development
3. B	GO:0045773	positive regulation of axon extension
3. B	GO:0032474	otolith morphogenesis
3. B	GO:0061042	vascular wound healing
3. B	GO:0030506	ankyrin binding
3. B	GO:0045766	positive regulation of angiogenesis
3. B	GO:0017134	fibroblast growth factor binding
3. B	GO:0021860	pyramidal neuron development
3. B	GO:0033010	paranodal junction
3. B	GO:0019904	protein domain specific binding
3. B	GO:0048100	wing disc anterior/posterior pattern formation
3. B	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway
3. B	GO:0050775	positive regulation of dendrite morphogenesis
3. B	GO:0071476	cellular hypotonic response
3. B	GO:0060113	inner ear receptor cell differentiation
3. B	GO:0045862	positive regulation of proteolysis
3. B	GO:0035904	aorta development
3. B	GO:0005201	extracellular matrix structural constituent
3. B	GO:0030901	midbrain development
3. B	GO:0014820	tonic smooth muscle contraction
3. B	GO:0048786	presynaptic active zone
3. B	GO:0007254	JNK cascade
3. B	GO:0036332	placental growth factor-activated receptor activity
3. B	GO:0043083	synaptic cleft
3. B	GO:0060026	convergent extension
3. B	GO:0010172	embryonic body morphogenesis
3. B	GO:0038007	netrin-activated signaling pathway
3. B	GO:0030426	growth cone
3. B	GO:0048514	blood vessel morphogenesis
3. B	GO:0048804	imaginal disc-derived female genitalia morphogenesis
3. B	GO:0060365	coronal suture morphogenesis
3. B	GO:0072178	nephric duct morphogenesis
3. B	GO:0035260	internal genitalia morphogenesis
3. B	GO:0099179	regulation of synaptic membrane adhesion
3. B	GO:0006953	acute-phase response
3. B	GO:1902961	positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process
3. B	GO:0060484	lung-associated mesenchyme development
3. B	GO:0030018	Z disc
3. B	GO:0008582	regulation of synaptic assembly at neuromuscular junction
3. B	GO:0001569	branching involved in blood vessel morphogenesis
3. B	GO:0048597	post-embryonic camera-type eye morphogenesis
3. B	GO:0099061	integral component of postsynaptic density membrane
3. B	GO:0099170	postsynaptic modulation of chemical synaptic transmission
3. B	GO:0048704	embryonic skeletal system morphogenesis
3. B	GO:0098696	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane
3. B	GO:0050808	synapse organization
3. B	GO:0050896	response to stimulus
3. B	GO:0007416	synapse assembly
3. B	GO:0005524	ATP binding
3. B	GO:0030336	negative regulation of cell migration
3. B	GO:0030175	filopodium
3. B	GO:0070062	extracellular exosome
3. B	GO:0001775	cell activation
3. B	GO:0032060	bleb assembly
3. B	GO:0001618	virus receptor activity
3. B	GO:0070977	bone maturation
3. B	GO:0030324	lung development
3. B	GO:0010863	positive regulation of phospholipase C activity
3. B	GO:0060916	mesenchymal cell proliferation involved in lung development
3. B	GO:1990090	cellular response to nerve growth factor stimulus
3. B	GO:0048691	positive regulation of axon extension involved in regeneration
3. B	GO:0045651	positive regulation of macrophage differentiation
3. B	GO:0070100	negative regulation of chemokine-mediated signaling pathway
3. B	GO:0045296	cadherin binding
3. B	GO:1905606	regulation of presynapse assembly
3. B	GO:0070857	regulation of bile acid biosynthetic process
3. B	GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling
3. B	GO:0032940	secretion by cell
3. B	GO:0060298	positive regulation of sarcomere organization
3. B	GO:0060077	inhibitory synapse
3. B	GO:0005042	netrin receptor activity
3. B	GO:0030282	bone mineralization
3. B	GO:0001917	photoreceptor inner segment
3. B	GO:0022038	corpus callosum development
3. B	GO:0004713	protein tyrosine kinase activity
3. B	GO:0060667	branch elongation involved in salivary gland morphogenesis
3. B	GO:0072277	metanephric glomerular capillary formation
3. B	GO:0060060	post-embryonic retina morphogenesis in camera-type eye
3. B	GO:0010544	negative regulation of platelet activation
3. B	GO:0060269	centripetally migrating follicle cell migration
3. B	GO:0098883	synapse pruning
3. B	GO:0014816	skeletal muscle satellite cell differentiation
3. B	GO:0044295	axonal growth cone
3. B	GO:2000739	regulation of mesenchymal stem cell differentiation
3. B	GO:1901534	positive regulation of hematopoietic progenitor cell differentiation
3. B	GO:0060512	prostate gland morphogenesis
3. B	GO:0044294	dendritic growth cone
3. B	GO:0061298	retina vasculature development in camera-type eye
3. B	GO:0010839	negative regulation of keratinocyte proliferation
3. B	GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0097402	neuroblast migration
3. B	GO:1903051	negative regulation of proteolysis involved in cellular protein catabolic process
3. B	GO:0030285	integral component of synaptic vesicle membrane
3. B	GO:0044062	regulation of excretion
3. B	GO:1901532	regulation of hematopoietic progenitor cell differentiation
3. B	GO:0061000	negative regulation of dendritic spine development
3. B	GO:0021794	thalamus development
3. B	GO:0060998	regulation of dendritic spine development
3. B	GO:0070374	positive regulation of ERK1 and ERK2 cascade
3. B	GO:0050679	positive regulation of epithelial cell proliferation
3. B	GO:0097454	Schwann cell microvillus
3. B	GO:0055008	cardiac muscle tissue morphogenesis
3. B	GO:0032148	activation of protein kinase B activity
3. B	GO:0042490	mechanoreceptor differentiation
3. B	GO:0021847	ventricular zone neuroblast division
3. B	GO:0003197	endocardial cushion development
3. B	GO:0003723	RNA binding
3. B	GO:0098685	Schaffer collateral - CA1 synapse
3. B	GO:0030335	positive regulation of cell migration
3. B	GO:0097374	sensory neuron axon guidance
3. B	GO:0003300	cardiac muscle hypertrophy
3. B	GO:0003677	DNA binding
3. B	GO:0042803	protein homodimerization activity
3. B	GO:0048712	negative regulation of astrocyte differentiation
3. B	GO:0051015	actin filament binding
3. B	GO:0035475	angioblast cell migration involved in selective angioblast sprouting
3. B	GO:0001553	luteinization
3. B	GO:0008270	zinc ion binding
3. B	GO:0003184	pulmonary valve morphogenesis
3. B	GO:0001759	organ induction
3. B	GO:0038085	vascular endothelial growth factor binding
3. B	GO:0038084	vascular endothelial growth factor signaling pathway
3. B	GO:0007422	peripheral nervous system development
3. B	GO:0038033	positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway
3. B	GO:0033555	multicellular organismal response to stress
3. B	GO:0021510	spinal cord development
3. B	GO:0090557	establishment of endothelial intestinal barrier
3. B	GO:0033628	regulation of cell adhesion mediated by integrin
3. B	GO:0001725	stress fiber
3. B	GO:0021836	chemorepulsion involved in postnatal olfactory bulb interneuron migration
3. B	GO:0008589	regulation of smoothened signaling pathway
3. B	GO:0036062	presynaptic periactive zone
3. B	GO:0021987	cerebral cortex development
3. B	GO:0051393	alpha-actinin binding
3. B	GO:0097443	sorting endosome
3. B	GO:0098989	NMDA selective glutamate receptor signaling pathway
3. B	GO:0007162	negative regulation of cell adhesion
3. B	GO:1905812	regulation of motor neuron axon guidance
3. B	GO:0005739	mitochondrion
3. B	GO:0035481	positive regulation of Notch signaling pathway involved in heart induction
3. B	GO:0098609	cell-cell adhesion
3. B	GO:0043507	positive regulation of JUN kinase activity
3. B	GO:1903010	regulation of bone development
3. B	GO:0043406	positive regulation of MAP kinase activity
3. B	GO:0060414	aorta smooth muscle tissue morphogenesis
3. B	GO:0008046	axon guidance receptor activity
3. B	GO:0051896	regulation of protein kinase B signaling
3. B	GO:0035374	chondroitin sulfate binding
3. B	GO:0021769	orbitofrontal cortex development
3. B	GO:0021766	hippocampus development
3. B	GO:0005768	endosome
3. B	GO:1990890	netrin receptor binding
3. B	GO:0048671	negative regulation of collateral sprouting
3. B	GO:0001934	positive regulation of protein phosphorylation
3. B	GO:0048670	regulation of collateral sprouting
3. B	GO:0005001	transmembrane receptor protein tyrosine phosphatase activity
3. B	GO:0048705	skeletal system morphogenesis
3. B	GO:0097104	postsynaptic membrane assembly
3. B	GO:0051387	negative regulation of neurotrophin TRK receptor signaling pathway
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:0010575	positive regulation of vascular endothelial growth factor production
3. B	GO:0003416	endochondral bone growth
3. B	GO:0030517	negative regulation of axon extension
3. B	GO:1905563	negative regulation of vascular endothelial cell proliferation
3. B	GO:0042711	maternal behavior
3. B	GO:0005113	patched binding
3. B	GO:0050878	regulation of body fluid levels
3. B	GO:0031915	positive regulation of synaptic plasticity
3. B	GO:0048146	positive regulation of fibroblast proliferation
3. B	GO:0031901	early endosome membrane
3. B	GO:0060601	lateral sprouting from an epithelium
3. B	GO:0019056	modulation by virus of host transcription
3. B	GO:0043194	axon initial segment
3. B	GO:1900121	negative regulation of receptor binding
3. B	GO:0060996	dendritic spine development
3. B	GO:0120034	positive regulation of plasma membrane bounded cell projection assembly
3. B	GO:0003149	membranous septum morphogenesis
3. B	GO:0046777	protein autophosphorylation
3. B	GO:1990075	periciliary membrane compartment
3. B	GO:0051893	regulation of focal adhesion assembly
3. B	GO:0005005	transmembrane-ephrin receptor activity
3. B	GO:0009897	external side of plasma membrane
3. B	GO:0033564	anterior/posterior axon guidance
3. B	GO:0033270	paranode region of axon
3. B	GO:0048701	embryonic cranial skeleton morphogenesis
3. B	GO:0071288	cellular response to mercury ion
3. B	GO:0048640	negative regulation of developmental growth
3. B	GO:0097156	fasciculation of motor neuron axon
3. B	GO:0048170	positive regulation of long-term neuronal synaptic plasticity
3. B	GO:0001960	negative regulation of cytokine-mediated signaling pathway
3. B	GO:0045446	endothelial cell differentiation
3. B	GO:0060384	innervation
3. B	GO:0034164	negative regulation of toll-like receptor 9 signaling pathway
3. B	GO:0072499	photoreceptor cell axon guidance
3. B	GO:0060437	lung growth
3. B	GO:0034109	homotypic cell-cell adhesion
3. B	GO:0070371	ERK1 and ERK2 cascade
3. B	GO:0043235	receptor complex
3. B	GO:1903078	positive regulation of protein localization to plasma membrane
3. B	GO:0002042	cell migration involved in sprouting angiogenesis
3. B	GO:0005004	GPI-linked ephrin receptor activity
3. B	GO:0035265	organ growth
3. B	GO:0071300	cellular response to retinoic acid
3. B	GO:0050931	pigment cell differentiation
3. B	GO:0048813	dendrite morphogenesis
3. B	GO:0002040	sprouting angiogenesis
3. B	GO:0021957	corticospinal tract morphogenesis
3. B	GO:0036379	myofilament
3. B	GO:0061001	regulation of dendritic spine morphogenesis
3. B	GO:0030916	otic vesicle formation
3. B	GO:0035607	fibroblast growth factor receptor signaling pathway involved in orbitofrontal cortex development
3. B	GO:0045165	cell fate commitment
3. B	GO:1903386	negative regulation of homophilic cell adhesion
3. B	GO:1990384	hyaloid vascular plexus regression
3. B	GO:0060976	coronary vasculature development
3. B	GO:1990393	3M complex
3. B	GO:0048562	embryonic organ morphogenesis
3. B	GO:0010518	positive regulation of phospholipase activity
3. B	GO:0001928	regulation of exocyst assembly
3. B	GO:0008347	glial cell migration
3. B	GO:0003180	aortic valve morphogenesis
3. B	GO:0060915	mesenchymal cell differentiation involved in lung development
3. B	GO:0060688	regulation of morphogenesis of a branching structure
3. B	GO:0099175	regulation of postsynapse organization
3. B	GO:0003157	endocardium development
3. B	GO:0051964	negative regulation of synapse assembly
3. B	GO:0001944	vasculature development
3. B	GO:0003382	epithelial cell morphogenesis
3. B	GO:2000830	positive regulation of parathyroid hormone secretion
3. B	GO:0060045	positive regulation of cardiac muscle cell proliferation
3. B	GO:0048013	ephrin receptor signaling pathway
3. B	GO:0060527	prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis
3. B	GO:0005085	guanyl-nucleotide exchange factor activity
3. B	GO:0003334	keratinocyte development
3. B	GO:0021799	cerebral cortex radially oriented cell migration
3. B	GO:0045806	negative regulation of endocytosis
3. B	GO:0045162	clustering of voltage-gated sodium channels
3. B	GO:0030538	embryonic genitalia morphogenesis
3. B	GO:1905517	macrophage migration
3. B	GO:0097628	distal tip cell migration
3. B	GO:0030027	lamellipodium
3. B	GO:0048286	lung alveolus development
3. B	GO:1902036	regulation of hematopoietic stem cell differentiation
3. B	GO:0048665	neuron fate specification
3. B	GO:1901166	neural crest cell migration involved in autonomic nervous system development
3. B	GO:0060125	negative regulation of growth hormone secretion
3. B	GO:0008201	heparin binding
3. B	GO:0031103	axon regeneration
3. B	GO:0050807	regulation of synapse organization
3. B	GO:0099055	integral component of postsynaptic membrane
3. B	GO:0008092	cytoskeletal protein binding
3. B	GO:0060974	cell migration involved in heart formation
3. B	GO:0086080	protein binding involved in heterotypic cell-cell adhesion
3. B	GO:0032687	negative regulation of interferon-alpha production
3. B	GO:0033674	positive regulation of kinase activity
3. B	GO:1900748	positive regulation of vascular endothelial growth factor signaling pathway
3. B	GO:0002074	extraocular skeletal muscle development
3. B	GO:0043525	positive regulation of neuron apoptotic process
3. B	GO:0036323	vascular endothelial growth factor receptor-1 signaling pathway
3. B	GO:0110011	regulation of basement membrane organization
3. B	GO:1901214	regulation of neuron death
3. B	GO:0002141	stereocilia ankle link
3. B	GO:0003281	ventricular septum development
3. B	GO:0071679	commissural neuron axon guidance
3. B	GO:0090736	MATH domain binding
3. B	GO:0030673	axolemma
3. B	GO:0097485	neuron projection guidance
3. B	GO:0061564	axon development
3. B	GO:0016338	calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules
3. B	GO:0045989	positive regulation of striated muscle contraction
3. B	GO:0031345	negative regulation of cell projection organization
3. B	GO:0060349	bone morphogenesis
3. B	GO:0045598	regulation of fat cell differentiation
3. B	GO:0060445	branching involved in salivary gland morphogenesis
3. B	GO:0097482	muscle cell postsynaptic specialization
3. B	GO:0030537	larval behavior
3. B	GO:0042698	ovulation cycle
3. B	GO:0097708	intracellular vesicle
3. B	GO:0001525	angiogenesis
3. B	GO:0060997	dendritic spine morphogenesis
3. B	GO:0048845	venous blood vessel morphogenesis
3. B	GO:0050714	positive regulation of protein secretion
3. B	GO:0021952	central nervous system projection neuron axonogenesis
3. B	GO:0005794	Golgi apparatus
3. B	GO:0060068	vagina development
3. B	GO:0005925	focal adhesion
3. B	GO:0048679	regulation of axon regeneration
3. B	GO:0003016	respiratory system process
3. B	GO:0048755	branching morphogenesis of a nerve
3. B	GO:0021965	spinal cord ventral commissure morphogenesis
3. B	GO:0031102	neuron projection regeneration
3. B	GO:0007088	regulation of mitotic nuclear division
3. B	GO:0097155	fasciculation of sensory neuron axon
3. B	GO:0046872	metal ion binding
3. B	GO:0097151	positive regulation of inhibitory postsynaptic potential
3. B	GO:0099151	regulation of postsynaptic density assembly
3. B	GO:0003779	actin binding
3. B	GO:0090102	cochlea development
3. B	GO:0007528	neuromuscular junction development
3. B	GO:0106028	neuron projection retraction
3. B	GO:0001933	negative regulation of protein phosphorylation
3. B	GO:0034332	adherens junction organization
3. B	GO:0099557	trans-synaptic signaling by trans-synaptic complex, modulating synaptic transmission
3. B	GO:0035995	detection of muscle stretch
3. B	GO:0010842	retina layer formation
3. B	GO:0070307	lens fiber cell development
3. B	GO:0005003	ephrin receptor activity
3. B	GO:1905244	regulation of modification of synaptic structure
3. B	GO:1905489	regulation of sensory neuron axon guidance
3. B	GO:1904929	coreceptor activity involved in Wnt signaling pathway, planar cell polarity pathway
3. B	GO:0051702	biological process involved in interaction with symbiont

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	P97527	Contactin-5	2.26e-04	9.05e-06	9.91e-14
1. PB	Q61330	Contactin-2	2.05e-05	2.28e-03	5.10e-07
1. PB	Q07409	Contactin-3	1.19e-07	2.18e-02	8.14e-11
1. PB	P28685	Contactin-2	1.25e-06	5.49e-03	4.92e-10
1. PB	Q9VN14	Contactin	3.41e-03	8.24e-09	3.57e-05
1. PB	Q7ZW34	Contactin-5	4.76e-04	3.65e-04	2.67e-17
1. PB	Q69Z26	Contactin-4	4.28e-07	1.28e-04	4.20e-12
1. PB	Q12860	Contactin-1	5.54e-05	3.82e-04	3.94e-14
1. PB	Q62845	Contactin-4	1.04e-06	4.14e-04	1.12e-11
1. PB	Q02246	Contactin-2	1.59e-05	2.51e-02	1.47e-05
1. PB	P68500	Contactin-5	1.29e-04	5.47e-05	3.81e-13
1. PB	Q9P232	Contactin-3	2.45e-06	1.64e-02	3.26e-13
1. PB	O94779	Contactin-5	6.27e-04	5.43e-06	6.00e-15
1. PB	Q28106	Contactin-1	3.27e-06	3.57e-04	1.12e-13
1. PB	H2KZ60	Contactin rig-6	7.10e-04	1.96e-03	7.54e-06
1. PB	P12960	Contactin-1	5.78e-05	2.57e-05	2.76e-13
1. PB	Q9JMB8	Contactin-6	3.85e-06	8.54e-03	4.54e-13
1. PB	Q90688	Myosin-binding protein C, cardiac-type	7.98e-08	4.04e-04	1.19e-56
1. PB	P56741	Myosin-binding protein C, cardiac-type	4.97e-07	3.67e-03	6.00e-57
1. PB	P97528	Contactin-6	3.24e-06	1.78e-03	8.90e-13
1. PB	Q8IWV2	Contactin-4	3.53e-06	1.18e-04	2.76e-14
1. PB	A8DYP0	Obscurin	NA	2.39e-02	6.29e-15
1. PB	P14781	Contactin-1	1.44e-04	5.87e-04	6.22e-12
1. PB	Q9UQ52	Contactin-6	2.61e-06	5.74e-04	3.11e-15
1. PB	P22063	Contactin-2	1.58e-05	5.22e-05	2.50e-07
1. PB	Q63198	Contactin-1	4.25e-04	2.01e-05	2.29e-13
1. PB	Q8N9C0	Immunoglobulin superfamily member 22	0	3.13e-155	0.0
1. PB	Q90W79	Contactin-5	7.79e-07	4.74e-03	5.12e-17
3. B	Q6UXM1	Leucine-rich repeats and immunoglobulin-like domains protein 3	1.01e-01	NA	5.57e-06
3. B	P70193	Leucine-rich repeats and immunoglobulin-like domains protein 1	2.10e-01	NA	7.20e-07
3. B	O42414	Neurofascin	1.56e-04	NA	2.42e-04
3. B	Q8IVU1	Immunoglobulin superfamily DCC subclass member 3	2.42e-07	NA	3.17e-11
3. B	O73878	Ephrin type-B receptor 4b	1.68e-01	NA	0.001
3. B	Q52KR2	Leucine-rich repeats and immunoglobulin-like domains protein 2	6.80e-02	NA	1.43e-04
3. B	Q91845	Ephrin type-A receptor 4-A	7.12e-02	NA	1.51e-08
3. B	P16621	Tyrosine-protein phosphatase Lar	3.70e-03	NA	2.34e-06
3. B	P23468	Receptor-type tyrosine-protein phosphatase delta	8.53e-03	NA	6.17e-13
3. B	Q58DA5	Neurotrimin	3.64e-04	NA	0.004
3. B	Q290N5	Tyrosine-protein kinase-like otk	1.36e-03	NA	9.39e-08
3. B	B3MH43	Tyrosine-protein kinase-like otk	2.02e-03	NA	1.13e-05
3. B	Q98902	Neural cell adhesion molecule L1	5.34e-04	NA	1.73e-04
3. B	P54763	Ephrin type-B receptor 2	4.71e-02	NA	1.53e-05
3. B	Q9EQS9	Immunoglobulin superfamily DCC subclass member 4	9.73e-04	NA	6.13e-12
3. B	Q5VTT5	Myomesin-3	4.10e-04	NA	5.61e-24
3. B	Q967D7	Protein turtle	3.92e-02	NA	4.60e-17
3. B	Q8QHL3	Vascular endothelial growth factor receptor 1	1.55e-03	NA	6.33e-04
3. B	Q62407	Striated muscle-specific serine/threonine-protein kinase	NA	NA	1.98e-18
3. B	P54756	Ephrin type-A receptor 5	1.75e-01	NA	3.07e-06
3. B	O88599	Myosin-binding protein H	8.08e-05	NA	4.12e-17
3. B	O09127	Ephrin type-A receptor 8	1.07e-01	NA	5.02e-05
3. B	P36335	Neural cell adhesion molecule 1-B	1.97e-05	NA	7.51e-13
3. B	B4MR28	Tyrosine-protein kinase-like otk	1.85e-03	NA	3.84e-06
3. B	Q0WYX8	MAM domain-containing glycosylphosphatidylinositol anchor protein 1	3.15e-03	NA	0.037
3. B	Q3UQ28	Peroxidasin homolog	5.44e-02	NA	2.13e-11
3. B	O42422	Ephrin type-A receptor 7	1.01e-01	NA	0.019
3. B	Q6P1C6	Leucine-rich repeats and immunoglobulin-like domains protein 3	1.47e-01	NA	4.27e-05
3. B	O08680	Ephrin type-A receptor 3	1.05e-01	NA	1.50e-06
3. B	Q6MZW2	Follistatin-related protein 4	1.32e-01	NA	0.001
3. B	Q589G5	Protogenin	9.89e-06	NA	3.23e-07
3. B	P22607	Fibroblast growth factor receptor 3	2.49e-02	NA	0.011
3. B	Q61851	Fibroblast growth factor receptor 3	2.24e-02	NA	0.013
3. B	Q6AZB0	Brother of CDO	8.20e-05	NA	6.00e-06
3. B	Q9UPX0	Protein turtle homolog B	3.87e-05	NA	5.49e-08
3. B	Q9Z2I4	Roundabout homolog 3	2.75e-04	NA	4.61e-08
3. B	Q9I8X3	Fibroblast growth factor receptor 3	9.80e-03	NA	0.006
3. B	P16170	Neural cell adhesion molecule 1-A	1.73e-04	NA	5.43e-14
3. B	P18460	Fibroblast growth factor receptor 3	3.33e-02	NA	0.025
3. B	A4IGL7	Peroxidasin	5.73e-02	NA	1.06e-12
3. B	P50400	Endoglucanase D	5.36e-01	NA	0.017
3. B	Q05638	Exochitinase 1	1.87e-01	NA	0.028
3. B	O15146	Muscle, skeletal receptor tyrosine-protein kinase	5.27e-02	NA	0.013
3. B	Q09165	Mesocentin	NA	NA	0.024
3. B	O00533	Neural cell adhesion molecule L1-like protein	4.55e-04	NA	6.03e-10
3. B	B4F785	Pikachurin	2.61e-01	NA	8.65e-06
3. B	Q8N441	Fibroblast growth factor receptor-like 1	6.41e-03	NA	0.002
3. B	P26618	Platelet-derived growth factor receptor alpha	1.12e-02	NA	0.029
3. B	P13590	Neural cell adhesion molecule 1	2.26e-04	NA	1.45e-18
3. B	P53767	Vascular endothelial growth factor receptor 1	2.48e-03	NA	0.003
3. B	Q91287	Fibroblast growth factor receptor 3	8.06e-03	NA	0.002
3. B	P97603	Neogenin (Fragment)	4.54e-05	NA	5.51e-13
3. B	Q6VNS1	NT-3 growth factor receptor	1.99e-01	NA	0.013
3. B	D3YXG0	Hemicentin-1	NA	NA	3.77e-16
3. B	Q64604	Receptor-type tyrosine-protein phosphatase F	4.98e-04	NA	6.94e-13
3. B	Q07496	Ephrin type-A receptor 4	8.59e-02	NA	4.86e-09
3. B	P20241	Neuroglian	1.19e-04	NA	1.24e-07
3. B	B4HNW4	Tyrosine-protein kinase-like otk	9.53e-04	NA	6.29e-07
3. B	B3NS99	Tyrosine-protein kinase-like otk	2.83e-03	NA	1.38e-05
3. B	P54757	Ephrin type-A receptor 5	1.19e-01	NA	3.40e-05
3. B	Q8WX93	Palladin	4.29e-03	NA	6.98e-07
3. B	Q8AV58	Protein sidekick-1	1.80e-02	NA	1.98e-13
3. B	Q90Z04	Cell adhesion molecule-related/down-regulated by oncogenes	6.27e-04	NA	0.001
3. B	Q60847	Collagen alpha-1(XII) chain	NA	NA	0.002
3. B	Q8BLK3	Limbic system-associated membrane protein	3.32e-05	NA	1.95e-06
3. B	P35918	Vascular endothelial growth factor receptor 2	1.74e-03	NA	0.002
3. B	Q9ERC8	Down syndrome cell adhesion molecule homolog	1.39e-03	NA	6.48e-21
3. B	P0C5E3	Palladin (Fragment)	2.19e-03	NA	2.53e-06
3. B	P21802	Fibroblast growth factor receptor 2	4.99e-03	NA	3.12e-04
3. B	P24821	Tenascin	1.09e-01	NA	0.001
3. B	P35331	Neuronal cell adhesion molecule	2.08e-04	NA	1.33e-10
3. B	Q29116	Tenascin	6.64e-02	NA	0.026
3. B	P28828	Receptor-type tyrosine-protein phosphatase mu	1.87e-02	NA	0.015
3. B	P54755	Ephrin type-A receptor 5	1.43e-01	NA	8.58e-07
3. B	P17790	Basigin	9.85e-05	NA	0.006
3. B	Q02173	M-protein, striated muscle	3.28e-04	NA	3.26e-29
3. B	Q8AXY6	Muscle, skeletal receptor tyrosine protein kinase	1.21e-02	NA	0.004
3. B	Q98892	Opioid-binding protein/cell adhesion molecule homolog	3.55e-05	NA	4.60e-05
3. B	O35136	Neural cell adhesion molecule 2	3.55e-06	NA	4.79e-15
3. B	Q90773	Protein CEPU-1	9.08e-04	NA	0.024
3. B	P70211	Netrin receptor DCC	5.60e-06	NA	6.68e-21
3. B	P29318	Ephrin type-A receptor 3	1.42e-01	NA	1.71e-04
3. B	Q8N475	Follistatin-related protein 5	1.10e-01	NA	0.018
3. B	P20533	Chitinase A1	2.02e-01	NA	4.12e-05
3. B	Q2VWP7	Protogenin	2.11e-04	NA	1.73e-11
3. B	Q810U3	Neurofascin	4.76e-05	NA	3.90e-11
3. B	P11722	Fibronectin	6.42e-02	NA	0.025
3. B	Q9Y2H6	Fibronectin type-III domain-containing protein 3A	2.22e-03	NA	3.43e-07
3. B	Q8NDA2	Hemicentin-2	NA	NA	3.65e-15
3. B	Q13332	Receptor-type tyrosine-protein phosphatase S	8.84e-04	NA	9.71e-13
3. B	P21803	Fibroblast growth factor receptor 2	6.07e-02	NA	0.020
3. B	Q32MD9	Cell adhesion molecule-related/down-regulated by oncogenes	4.65e-05	NA	7.71e-05
3. B	Q99715	Collagen alpha-1(XII) chain	NA	NA	0.009
3. B	Q5IS82	NT-3 growth factor receptor	NA	NA	0.013
3. B	Q99PJ0	Neurotrimin	5.35e-04	NA	0.005
3. B	D3ZB51	Protein turtle homolog B	3.53e-05	NA	5.12e-08
3. B	G4SLH0	Titin homolog	NA	NA	3.91e-25
3. B	Q13449	Limbic system-associated membrane protein	3.09e-05	NA	3.01e-06
3. B	Q9JIF9	Myotilin	2.99e-02	NA	1.13e-09
3. B	F1NWE3	Receptor-type tyrosine-protein phosphatase S	2.02e-03	NA	2.30e-13
3. B	B8VIW9	Fibronectin type III domain-containing protein	8.01e-06	NA	6.67e-10
3. B	G5EG78	Peroxidasin homolog pxn-2	3.09e-01	NA	4.34e-05
3. B	O60229	Kalirin	NA	NA	6.56e-12
3. B	P29319	Ephrin type-A receptor 3	1.26e-01	NA	1.85e-06
3. B	G5EF96	Netrin receptor unc-40	1.54e-04	NA	2.98e-11
3. B	Q7TPD3	Roundabout homolog 2	1.36e-04	NA	5.80e-14
3. B	Q62813	Limbic system-associated membrane protein	5.80e-05	NA	2.06e-06
3. B	O73875	Ephrin type-B receptor 4a	1.45e-01	NA	0.001
3. B	A2A8L5	Receptor-type tyrosine-protein phosphatase F	1.01e-03	NA	5.43e-13
3. B	Q0PMG2	MAM domain-containing glycosylphosphatidylinositol anchor protein 1	3.72e-04	NA	1.85e-08
3. B	Q91147	Fibroblast growth factor receptor 2	1.33e-01	NA	7.89e-04
3. B	D3YYU8	Obscurin-like protein 1	3.20e-03	NA	4.91e-30
3. B	Q9JMH2	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1	4.12e-01	NA	0.019
3. B	E1C8P7	Down syndrome cell adhesion molecule-like protein 1 homolog	1.01e-04	NA	3.75e-11
3. B	Q92626	Peroxidasin homolog	6.38e-04	NA	1.56e-09
3. B	Q5IS37	NT-3 growth factor receptor	2.83e-01	NA	0.018
3. B	Q5DTJ9	Myopalladin	4.18e-03	NA	2.91e-05
3. B	Q91288	Fibroblast growth factor receptor 4	1.81e-02	NA	0.024
3. B	Q53EP0	Fibronectin type III domain-containing protein 3B	5.90e-03	NA	6.65e-06
3. B	O01761	Muscle M-line assembly protein unc-89	NA	NA	1.23e-29
3. B	Q1HLC0	Hemolin	2.07e-04	NA	0.031
3. B	Q95YM9	Fibroblast growth factor receptor	1.22e-01	NA	0.001
3. B	P28693	Ephrin type-B receptor 2	1.28e-01	NA	7.43e-04
3. B	Q8WZ42	Titin	NA	NA	3.91e-77
3. B	Q8BX90	Fibronectin type-III domain-containing protein 3A	1.82e-02	NA	1.24e-08
3. B	A2AAJ9	Obscurin	NA	NA	1.72e-38
3. B	P22455	Fibroblast growth factor receptor 4	3.44e-02	NA	0.004
3. B	Q5RF19	Interleukin-11 receptor subunit alpha	3.89e-03	NA	0.012
3. B	B0V2N1	Receptor-type tyrosine-protein phosphatase S	9.21e-04	NA	4.36e-13
3. B	Q60ZN5	Protein sidekick homolog	1.15e-02	NA	1.63e-10
3. B	Q1ENI8	Peroxidasin homolog pxn-1	8.84e-02	NA	0.008
3. B	Q01974	Tyrosine-protein kinase transmembrane receptor ROR2	2.96e-01	NA	0.004
3. B	Q8VHZ8	Down syndrome cell adhesion molecule homolog	1.24e-03	NA	5.11e-21
3. B	A0A087WV53	SPEG neighbor protein	2.23e-03	NA	6.41e-05
3. B	B4GBH0	Tyrosine-protein kinase-like otk	1.11e-03	NA	2.23e-08
3. B	Q6PDN3	Myosin light chain kinase, smooth muscle	1.88e-02	NA	6.54e-26
3. B	Q3UH53	Protein sidekick-1	1.87e-02	NA	4.59e-13
3. B	P52179	Myomesin-1	2.67e-02	NA	3.29e-30
3. B	G5EBF1	Protein sax-3	3.55e-05	NA	2.94e-21
3. B	P16419	Myosin-binding protein C, fast-type	1.39e-06	NA	1.24e-59
3. B	P22648	Fasciclin-2	3.68e-05	NA	0.031
3. B	Q90233	Myosin-binding protein C, cardiac-type (Fragment)	8.20e-04	NA	3.53e-20
3. B	Q03351	NT-3 growth factor receptor	2.74e-01	NA	0.012
3. B	Q9R044	Nephrin	3.72e-04	NA	0.020
3. B	Q90413	Fibroblast growth factor receptor 4	2.27e-02	NA	0.006
3. B	Q9Y6N7	Roundabout homolog 1	5.66e-05	NA	5.14e-14
3. B	Q9NR99	Matrix-remodeling-associated protein 5	NA	NA	1.83e-04
3. B	Q2EY13	Protogenin B (Fragment)	1.25e-05	NA	1.21e-11
3. B	Q96MS0	Roundabout homolog 3	5.75e-04	NA	6.32e-18
3. B	A2AJ76	Hemicentin-2	NA	NA	1.65e-19
3. B	A2ASS6	Titin	NA	NA	6.55e-77
3. B	Q28824	Myosin light chain kinase, smooth muscle	3.82e-02	NA	2.12e-13
3. B	P31836	Neural cell adhesion molecule 1	2.73e-06	NA	1.80e-13
3. B	Q62682	Contactin-3	1.20e-07	NA	1.19e-10
3. B	Q9BWV1	Brother of CDO	3.48e-05	NA	4.90e-06
3. B	Q78DX7	Proto-oncogene tyrosine-protein kinase ROS	2.26e-01	NA	0.015
3. B	P54759	Ephrin type-A receptor 7	9.27e-02	NA	0.008
3. B	A4IFW2	Receptor-type tyrosine-protein phosphatase F	8.33e-04	NA	2.26e-14
3. B	Q14324	Myosin-binding protein C, fast-type	6.53e-07	NA	7.40e-56
3. B	Q06418	Tyrosine-protein kinase receptor TYRO3	1.52e-04	NA	0.041
3. B	Q91ZT1	Vascular endothelial growth factor receptor 3	3.58e-03	NA	0.040
3. B	O75962	Triple functional domain protein	NA	NA	0.001
3. B	B4QC63	Tyrosine-protein kinase-like otk	8.81e-05	NA	1.56e-06
3. B	Q5XKE0	Myosin-binding protein C, fast-type	5.96e-08	NA	2.28e-55
3. B	Q90478	Neural cell adhesion molecule L1.1 (Fragment)	7.30e-06	NA	9.85e-10
3. B	Q92859	Neogenin	2.37e-05	NA	7.66e-15
3. B	B4KPU0	Tyrosine-protein kinase-like otk	9.14e-04	NA	0.001
3. B	Q9HCK4	Roundabout homolog 2	4.46e-04	NA	3.42e-14
3. B	O13146	Ephrin type-A receptor 3	2.21e-01	NA	0.003
3. B	P85171	MAM domain-containing glycosylphosphatidylinositol anchor protein 1	1.12e-04	NA	2.79e-09
3. B	A7MBJ4	Receptor-type tyrosine-protein phosphatase F	8.52e-04	NA	4.74e-13
3. B	Q498D6	Fibroblast growth factor receptor 4	2.92e-02	NA	0.003
3. B	O42127	Fibroblast growth factor receptor 3	4.21e-03	NA	0.005
3. B	P56276	Telokin	4.06e-04	NA	0.024
3. B	Q8TDY8	Immunoglobulin superfamily DCC subclass member 4	4.90e-04	NA	1.02e-10
3. B	Q2EY14	Protogenin A	1.62e-05	NA	1.63e-12
3. B	Q9Z138	Tyrosine-protein kinase transmembrane receptor ROR2	3.57e-01	NA	0.012
3. B	P0C5H6	Protein turtle homolog A	7.46e-04	NA	1.04e-11
3. B	Q3KNY0	Immunoglobulin-like and fibronectin type III domain-containing protein 1	NA	NA	4.69e-56
3. B	O89026	Roundabout homolog 1	6.56e-04	NA	3.79e-14
3. B	P43146	Netrin receptor DCC	5.63e-05	NA	9.54e-19
3. B	Q98919	Limbic system-associated membrane protein	4.73e-05	NA	1.42e-04
3. B	Q86TC9	Myopalladin	1.94e-03	NA	7.06e-06
3. B	P04937	Fibronectin	1.85e-02	NA	0.001
3. B	P70402	Myosin-binding protein H	1.83e-04	NA	1.23e-17
3. B	Q23551	Twitchin	NA	NA	1.06e-63
3. B	F1M0Z1	Triple functional domain protein	NA	NA	1.35e-04
3. B	O97394	Protein sidekick	1.10e-03	NA	1.86e-13
3. B	P11799	Myosin light chain kinase, smooth muscle	6.81e-03	NA	3.16e-24
3. B	P35969	Vascular endothelial growth factor receptor 1	3.31e-03	NA	0.004
3. B	B4N072	Interference hedgehog	2.99e-06	NA	0.005
3. B	A8WQH2	Peroxidasin homolog	NA	NA	0.012
3. B	P29322	Ephrin type-A receptor 8	9.90e-02	NA	7.18e-05
3. B	O88488	Phosphatidylinositol phosphatase PTPRQ	7.36e-02	NA	0.034
3. B	Q8BLI0	ADAMTS-like protein 1	2.77e-01	NA	0.044
3. B	P35916	Vascular endothelial growth factor receptor 3	3.32e-03	NA	0.008
3. B	Q696W0	Striated muscle preferentially expressed protein kinase	NA	NA	1.70e-17
3. B	Q6AWJ9	Tyrosine-protein kinase-like otk	4.27e-03	NA	2.99e-05
3. B	A1KZ92	Peroxidasin-like protein	3.67e-02	NA	1.02e-12
3. B	P29320	Ephrin type-A receptor 3	9.92e-02	NA	3.87e-06
3. B	O55005	Roundabout homolog 1	1.67e-04	NA	1.17e-12
3. B	Q63518	Myosin-binding protein C, slow-type (Fragment)	3.99e-11	NA	2.83e-51
3. B	Q9UBF9	Myotilin	4.29e-02	NA	1.55e-09
3. B	Q63HQ2	Pikachurin	2.56e-01	NA	7.94e-08
3. B	Q90344	Ephrin type-B receptor 2	1.44e-01	NA	6.91e-04
3. B	Q13203	Myosin-binding protein H	1.40e-04	NA	1.14e-19
3. B	P32736	Opioid-binding protein/cell adhesion molecule	6.82e-04	NA	8.97e-06
3. B	Q03142	Fibroblast growth factor receptor 4	4.64e-02	NA	0.001
3. B	P29294	Myosin light chain kinase, smooth muscle	1.47e-01	NA	3.68e-13
3. B	Q15772	Striated muscle preferentially expressed protein kinase	NA	NA	2.21e-18
3. B	Q03137	Ephrin type-A receptor 4	1.51e-01	NA	1.16e-07
3. B	P05548	CAVP-target protein	1.03e-04	NA	1.48e-07
3. B	P54760	Ephrin type-B receptor 4	1.96e-01	NA	2.14e-04
3. B	Q8K3K1	Usherin	NA	NA	0.014
3. B	A7LCJ3	Sialoadhesin	4.37e-02	NA	0.026
3. B	Q03364	Fibroblast growth factor receptor 2	8.08e-03	NA	0.001
3. B	Q05BQ1	Protein turtle homolog A	3.54e-04	NA	6.63e-13
3. B	Q8AXC7	Platelet-derived growth factor receptor alpha	1.97e-02	NA	0.003
3. B	Q9UMZ3	Phosphatidylinositol phosphatase PTPRQ	2.63e-02	NA	8.95e-05
3. B	P13595	Neural cell adhesion molecule 1	4.82e-05	NA	8.78e-10
3. B	Q18245	Ig-like and fibronectin type-III domain-containing protein C27B7.7	1.57e-02	NA	3.03e-06
3. B	Q58EX2	Protein sidekick-2	7.15e-03	NA	1.87e-12
3. B	Q8NFP4	MAM domain-containing glycosylphosphatidylinositol anchor protein 1	3.06e-04	NA	1.05e-07
3. B	Q05793	Basement membrane-specific heparan sulfate proteoglycan core protein	NA	NA	1.98e-04
3. B	Q4VA61	Down syndrome cell adhesion molecule-like protein 1 homolog	2.29e-03	NA	4.01e-12
3. B	F1NY98	Down syndrome cell adhesion molecule homolog	5.54e-03	NA	2.59e-21
3. B	Q9P2J2	Protein turtle homolog A	7.06e-04	NA	1.84e-08
3. B	Q96RW7	Hemicentin-1	NA	NA	5.75e-18
3. B	Q5PQM4	Myosin-binding protein H-like	7.16e-05	NA	4.56e-22
3. B	E9PZ19	Protein turtle homolog B	5.06e-05	NA	1.94e-07
3. B	Q18066	Disorganized muscle protein 1	5.48e-02	NA	8.28e-04
3. B	P32004	Neural cell adhesion molecule L1	1.43e-05	NA	1.98e-06
3. B	P97798	Neogenin	1.51e-05	NA	5.54e-14
3. B	H0UZ81	Fibronectin type III and SPRY domain-containing protein 2	9.99e-03	NA	0.031
3. B	Q28749	Fibronectin (Fragment)	6.45e-02	NA	0.026
3. B	Q63638	Striated muscle-specific serine/threonine-protein kinase	NA	NA	5.36e-19
3. B	Q4KMG0	Cell adhesion molecule-related/down-regulated by oncogenes	1.98e-05	NA	8.16e-05
3. B	O08775	Vascular endothelial growth factor receptor 2	1.29e-03	NA	0.004
3. B	P32018	Collagen alpha-1(XIV) chain	2.96e-02	NA	0.020
3. B	Q5RBN1	Fibronectin type-III domain-containing protein 3A	9.22e-03	NA	7.22e-07
3. B	Q505D9	Tripartite motif-containing protein 67	3.69e-01	NA	0.019
3. B	Q14982	Opioid-binding protein/cell adhesion molecule	4.37e-05	NA	7.52e-06
3. B	Q13308	Inactive tyrosine-protein kinase 7	5.51e-04	NA	9.00e-04
3. B	P55146	Tyrosine-protein kinase receptor TYRO3	6.32e-04	NA	0.024
3. B	Q9QZS7	Nephrin	9.68e-03	NA	0.030
3. B	A2ABU4	Myomesin-3	1.98e-03	NA	3.26e-25
3. B	Q9U4G1	Protein borderless	6.17e-06	NA	3.65e-08
3. B	Q16288	NT-3 growth factor receptor	1.74e-01	NA	0.017
3. B	P08922	Proto-oncogene tyrosine-protein kinase ROS	1.97e-01	NA	0.020
3. B	P29323	Ephrin type-B receptor 2	1.59e-01	NA	2.05e-05
3. B	Q8AV57	Protein sidekick-2	1.19e-02	NA	1.61e-11
3. B	P13591	Neural cell adhesion molecule 1	9.96e-06	NA	4.03e-13
3. B	Q9U308	Juxtamembrane domain-associated catenin	5.26e-01	NA	3.13e-13
3. B	O94856	Neurofascin	1.16e-04	NA	9.35e-11
3. B	Q64487	Receptor-type tyrosine-protein phosphatase delta	2.64e-04	NA	7.04e-12
3. B	Q00872	Myosin-binding protein C, slow-type	1.31e-06	NA	1.51e-66
3. B	O35158	Cell adhesion molecule-related/down-regulated by oncogenes	5.82e-04	NA	5.59e-05
3. B	P11276	Fibronectin	1.33e-02	NA	0.005
3. B	P28827	Receptor-type tyrosine-protein phosphatase mu	2.76e-02	NA	7.59e-04
3. B	Q8TD84	Down syndrome cell adhesion molecule-like protein 1	5.79e-04	NA	2.93e-12
3. B	P54764	Ephrin type-A receptor 4	2.15e-02	NA	1.63e-07
3. B	P97924	Kalirin	NA	NA	2.50e-12
3. B	P35917	Vascular endothelial growth factor receptor 3	4.05e-03	NA	0.022
3. B	Q6V4S5	Protein sidekick-2	1.15e-02	NA	2.11e-12
3. B	Q1LUA6	Triple functional domain protein	NA	NA	0.008
3. B	Q97Z97	Kelch domain-containing protein SSO1033	1.04e-02	NA	0.002
3. B	O75147	Obscurin-like protein 1	6.72e-03	NA	2.34e-32
3. B	P46630	T-cell surface glycoprotein CD4	4.24e-03	NA	0.039
3. B	Q0KL02	Triple functional domain protein	NA	NA	9.39e-05
3. B	Q810U4	Neuronal cell adhesion molecule	9.09e-05	NA	4.33e-08
3. B	Q5STE3	Follistatin-related protein 4	5.57e-01	NA	0.001
3. B	Q7Z5N4	Protein sidekick-1	3.06e-03	NA	2.56e-13
3. B	Q10656	Myoblast growth factor receptor egl-15	1.16e-02	NA	0.009
3. B	Q8BYN5	FSD1-like protein	6.88e-01	NA	0.004
3. B	Q8BKG3	Inactive tyrosine-protein kinase 7	3.17e-04	NA	0.018
3. B	O94898	Leucine-rich repeats and immunoglobulin-like domains protein 2	7.39e-02	NA	9.80e-05
3. B	A1L4K1	Fibronectin type III and SPRY domain-containing protein 2	2.96e-02	NA	1.63e-04
3. B	Q5IS61	Opioid-binding protein/cell adhesion molecule	1.17e-05	NA	7.52e-06
3. B	P11627	Neural cell adhesion molecule L1	1.57e-04	NA	1.24e-06
3. B	O61460	Ephrin receptor 1	2.41e-01	NA	7.04e-04
3. B	Q91048	Inactive tyrosine-protein kinase 7	1.98e-03	NA	0.002
3. B	P0C5E4	Phosphatidylinositol phosphatase PTPRQ	2.24e-01	NA	0.026
3. B	P98160	Basement membrane-specific heparan sulfate proteoglycan core protein	NA	NA	2.91e-05
3. B	P10586	Receptor-type tyrosine-protein phosphatase F	9.47e-03	NA	4.14e-13
3. B	Q05695	Neural cell adhesion molecule L1	1.79e-04	NA	2.24e-05
3. B	P18461	Fibroblast growth factor receptor 2	9.78e-03	NA	0.001
3. B	P17948	Vascular endothelial growth factor receptor 1	1.58e-03	NA	0.001
3. B	Q86VF2	Immunoglobulin-like and fibronectin type III domain-containing protein 1	5.56e-08	NA	1.95e-106
3. B	P70232	Neural cell adhesion molecule L1-like protein	6.17e-04	NA	1.24e-06
3. B	Q9PUF6	Platelet-derived growth factor receptor alpha	1.59e-02	NA	0.004
3. B	P54296	Myomesin-2	3.02e-02	NA	6.05e-30
3. B	P20786	Platelet-derived growth factor receptor alpha	1.54e-02	NA	5.02e-04
3. B	Q6NWW9	Fibronectin type III domain-containing protein 3B	6.73e-03	NA	0.003
3. B	P97685	Neurofascin	3.33e-05	NA	2.95e-11
3. B	Q9I7U4	Titin	NA	NA	8.57e-52
3. B	P54761	Ephrin type-B receptor 4	1.17e-01	NA	0.002
3. B	Q9BXM9	FSD1-like protein	6.88e-01	NA	0.001
3. B	A2CG49	Kalirin	NA	NA	1.89e-12
3. B	Q14626	Interleukin-11 receptor subunit alpha	3.91e-03	NA	0.015
3. B	Q8AXB3	Vascular endothelial growth factor receptor kdr-like	1.29e-03	NA	0.036
3. B	Q91286	Fibroblast growth factor receptor 2	1.33e-02	NA	2.75e-04
3. B	O60469	Down syndrome cell adhesion molecule	1.17e-04	NA	5.49e-22
3. B	Q9N3X8	Protein sidekick homolog	4.93e-03	NA	1.43e-11
3. B	Q92823	Neuronal cell adhesion molecule	2.86e-04	NA	1.30e-08
3. B	Q9BMN8	Tyrosine-protein phosphatase Lar-like	1.23e-02	NA	0.007
3. B	Q15746	Myosin light chain kinase, smooth muscle	8.79e-02	NA	7.01e-21
3. B	Q8BQC3	Immunoglobulin superfamily DCC subclass member 3	7.11e-06	NA	4.84e-10
3. B	O70468	Myosin-binding protein C, cardiac-type	2.73e-09	NA	8.63e-57
3. B	Q5VST9	Obscurin	NA	NA	2.34e-41
3. B	Q2EY15	Protogenin	1.99e-05	NA	9.80e-12
3. B	Q2VWP9	Protogenin	8.06e-05	NA	2.58e-12
3. B	Q03696	Neuronal-glial cell adhesion molecule	7.24e-04	NA	2.20e-05
3. B	Q9P121	Neurotrimin	1.03e-05	NA	0.002
3. B	Q8AXZ4	Contactin-1a	6.05e-04	NA	3.19e-07
3. B	Q14896	Myosin-binding protein C, cardiac-type	3.66e-08	NA	3.82e-57
3. B	P28192	Tyrosine-protein phosphatase 4	1.90e-02	NA	1.65e-04
3. B	Q4VBE4	Pikachurin	1.91e-01	NA	2.59e-06
3. B	Q64605	Receptor-type tyrosine-protein phosphatase S	8.74e-04	NA	5.25e-13
3. B	Q9VS29	Down syndrome cell adhesion molecule-like protein Dscam2	2.20e-02	NA	8.46e-12
3. B	P11834	Opioid-binding protein/cell adhesion molecule	5.61e-04	NA	9.62e-06
3. B	Q5IFJ9	NT-3 growth factor receptor	2.93e-01	NA	0.018
3. B	Q91743	Fibroblast growth factor receptor 4	1.58e-02	NA	0.049
3. B	Q6WRI0	Immunoglobulin superfamily member 10	1.05e-01	NA	5.99e-11
3. B	Q05623	Myosin-binding protein H	1.91e-03	NA	9.20e-17
3. B	Q8BZ52	Fibronectin type III and SPRY domain-containing protein 2	1.03e-02	NA	4.10e-04
3. B	Q63155	Netrin receptor DCC	9.54e-06	NA	2.24e-20
3. B	P34082	Fasciclin-2	1.49e-05	NA	1.45e-05
3. B	Q91694	Ephrin type-A receptor 4-B	1.13e-01	NA	5.71e-07
3. B	Q2QI47	Usherin	NA	NA	0.013
3. B	Q9ET54	Palladin	4.95e-03	NA	1.50e-06
3. B	O15394	Neural cell adhesion molecule 2	5.29e-06	NA	3.15e-14
3. B	O75445	Usherin	NA	NA	0.002
3. B	Q62234	Myomesin-1	3.39e-02	NA	7.60e-31
3. B	Q5FW53	Myosin-binding protein H-like	7.18e-05	NA	1.17e-21
3. B	B4P5Q9	Tyrosine-protein kinase-like otk	2.80e-04	NA	1.75e-05
3. B	D3ZZ80	Obscurin-like protein 1	6.54e-04	NA	1.97e-29
3. B	Q9EPX2	Papilin	1.48e-01	NA	3.67e-05
3. B	Q96JA1	Leucine-rich repeats and immunoglobulin-like domains protein 1	1.63e-01	NA	4.44e-06
3. B	P13596	Neural cell adhesion molecule 1	2.59e-04	NA	3.75e-12
3. B	Q5ZJP5	Fibronectin type-III domain-containing protein 3a	1.35e-01	NA	8.46e-09
3. B	B3MKS0	Interference hedgehog	5.21e-05	NA	1.85e-04
3. B	A3KN33	Pikachurin	3.42e-01	NA	1.73e-04
3. B	Q8BFR2	Follistatin-related protein 5	1.22e-01	NA	0.016
3. B	A2RUH7	Myosin-binding protein H-like	7.66e-05	NA	9.80e-22
3. B	Q90610	Neogenin (Fragment)	2.14e-06	NA	1.98e-11