Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
Q28658
(Small proline-rich protein 3) with a FATCAT P-Value: 6.92e-06 and RMSD of 2.82 angstrom. The sequence alignment identity is 16.7%.
Structural alignment shown in left. Query protein Q8N9U9 colored as red in alignment, homolog Q28658 colored as blue.
Query protein Q8N9U9 is also shown in right top, homolog Q28658 showed in right bottom. They are colored based on secondary structures.
Q8N9U9 --------------------------------------------MASPFGRLTDQKGRGH---PAGSGGVEV-NGGSARAAFSGGGRRVLSGGGRTAF-G 51 Q28658 MSSYQQKQPFTPPPQPQQHQVKQPCQPPPQDTFVPITKDPCHPNVPSP-GN-TNIAEQGYVKIPE-QGSIKVPDTGYTKIPDSGNTK--VPESGCTSVPG 95 Q8N9U9 GG-------GRTAFGDGGRTAFGVGGRTAFGGGGRTAFGGGGRTAFGVGGRTAF-GGGERVSLLSPGWSALARSWLTASSASRVQAILLPQP-----PE- 137 Q28658 SGYSVVPQPGYTKVPDQGYTKVPESGCTSVPGSGYSVVPQPGYTKVPESGCTSVPGPGYP-TVPQPGYTKVPESGCTSVPGSGYS--VIPQPSYTKVPES 192 Q8N9U9 --------------------------------------- 137 Q28658 GCTSVPGPGYPTVPQPGYTKVQEPNPSIVTPGLSQKKTK 231
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0008585 | female gonad development |
| 2. P | GO:0048471 | perinuclear region of cytoplasm |
| 2. P | GO:0018149 | peptide cross-linking |
| 2. P | GO:0050832 | defense response to fungus |
| 2. P | GO:1903573 | negative regulation of response to endoplasmic reticulum stress |
| 2. P | GO:0030216 | keratinocyte differentiation |
| 2. P | GO:0042151 | nematocyst |
| 2. P | GO:0045943 | positive regulation of transcription by RNA polymerase I |
| 2. P | GO:0062038 | positive regulation of pheromone response MAPK cascade |
| 2. P | GO:0070972 | protein localization to endoplasmic reticulum |
| 2. P | GO:0048511 | rhythmic process |
| 2. P | GO:0032516 | positive regulation of phosphoprotein phosphatase activity |
| 2. P | GO:0031424 | keratinization |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:1990441 | negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress |
| 2. P | GO:0032005 | signal transduction involved in positive regulation of conjugation with cellular fusion |
| 2. P | GO:0005198 | structural molecule activity |
| 2. P | GO:0010514 | induction of conjugation with cellular fusion |
| 2. P | GO:0000772 | mating pheromone activity |
| 2. P | GO:0006915 | apoptotic process |
| 2. P | GO:0030968 | endoplasmic reticulum unfolded protein response |
| 2. P | GO:0035308 | negative regulation of protein dephosphorylation |
| 2. P | GO:0019903 | protein phosphatase binding |
| 2. P | GO:0030280 | structural constituent of skin epidermis |
| 2. P | GO:0005882 | intermediate filament |
| 2. P | GO:0019888 | protein phosphatase regulator activity |
| 2. P | GO:0008544 | epidermis development |
| 2. P | GO:0000164 | protein phosphatase type 1 complex |
| 2. P | GO:0031640 | killing of cells of another organism |
| 2. P | GO:0036496 | regulation of translational initiation by eIF2 alpha dephosphorylation |
| 2. P | GO:1902310 | positive regulation of peptidyl-serine dephosphorylation |
| 2. P | GO:0008157 | protein phosphatase 1 binding |
| 2. P | GO:1903917 | positive regulation of endoplasmic reticulum stress-induced eIF2 alpha dephosphorylation |
| 2. P | GO:0060734 | regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation |
| 2. P | GO:0005741 | mitochondrial outer membrane |
| 2. P | GO:0032515 | negative regulation of phosphoprotein phosphatase activity |
| 2. P | GO:0031142 | induction of conjugation upon nitrogen starvation |
| 2. P | GO:0009877 | nodulation |
| 2. P | GO:0070262 | peptidyl-serine dephosphorylation |
| 2. P | GO:1903912 | negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation |
| 2. P | GO:0110044 | regulation of cell cycle switching, mitotic to meiotic cell cycle |
| 2. P | GO:0001533 | cornified envelope |
| 3. B | GO:0006405 | RNA export from nucleus |
| 3. B | GO:0051155 | positive regulation of striated muscle cell differentiation |
| 3. B | GO:0044614 | nuclear pore cytoplasmic filaments |
| 3. B | GO:0031965 | nuclear membrane |
| 3. B | GO:2001056 | positive regulation of cysteine-type endopeptidase activity |
| 3. B | GO:0006406 | mRNA export from nucleus |
| 3. B | GO:0017056 | structural constituent of nuclear pore |
| 3. B | GO:0006606 | protein import into nucleus |
| 3. B | GO:0007165 | signal transduction |
| 3. B | GO:0000973 | posttranscriptional tethering of RNA polymerase II gene DNA at nuclear periphery |
| 3. B | GO:0005635 | nuclear envelope |
| 3. B | GO:0048573 | photoperiodism, flowering |
| 3. B | GO:1902446 | regulation of shade avoidance |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8N9U9 | Putative uncharacterized protein SPANXA2-OT1 | 0 | 7.74e-147 | 4.64e-85 |
| 2. P | C9JFL3 | Proline, histidine and glycine-rich protein 1 | 8.67e-01 | 2.97e-02 | NA |
| 2. P | P16844 | Uncharacterized protein UL15A | NA | 1.91e-02 | NA |
| 2. P | Q9D226 | Keratin-associated protein 5-3 | 9.91e-03 | 1.44e-02 | NA |
| 2. P | P13492 | Antigen 10-3 | 1.23e-01 | 8.24e-04 | NA |
| 2. P | Q2KI51 | Protein phosphatase 1 regulatory subunit 15A | 9.41e-01 | 4.22e-02 | NA |
| 2. P | P0CL29 | Putative uncharacterized protein YML133W-A | 4.61e-03 | 4.22e-12 | NA |
| 2. P | Q3LI59 | Keratin-associated protein 21-2 | 6.25e-01 | 1.01e-03 | NA |
| 2. P | P17564 | Protein phosphatase 1 regulatory subunit 15A | 8.49e-01 | 3.14e-02 | NA |
| 2. P | P0CL31 | Putative uncharacterized protein YPL283W-A | 4.66e-03 | 4.22e-12 | NA |
| 2. P | P75318 | Uncharacterized protein MPN_465 | 2.13e-01 | 1.28e-03 | NA |
| 2. P | P27058 | Systemin | 7.63e-01 | 8.56e-03 | NA |
| 2. P | P0CL30 | Putative uncharacterized protein YNL339W-A | 4.61e-03 | 4.22e-12 | NA |
| 2. P | P0DMZ8 | U-actitoxin-Avd13a/b | 9.32e-01 | 2.44e-02 | NA |
| 2. P | Q11116 | Uncharacterized protein C03B1.10 | 6.15e-02 | 2.06e-04 | NA |
| 2. P | P22528 | Cornifin-B | 5.68e-01 | 9.52e-06 | NA |
| 2. P | Q9UBC9 | Small proline-rich protein 3 | 7.14e-01 | 3.92e-02 | NA |
| 2. P | P35322 | Cornifin | 6.71e-01 | 1.18e-03 | NA |
| 2. P | Q09134 | Abscisic acid and environmental stress-inducible protein | 4.78e-03 | 1.84e-02 | NA |
| 2. P | P12347 | Period clock protein | 8.10e-03 | 7.84e-05 | NA |
| 2. P | F7VJQ1 | Alternative prion protein | 1.39e-01 | 1.78e-13 | NA |
| 2. P | Q55FX9 | Putative uncharacterized protein DDB_G0268542 | 4.51e-01 | 2.92e-04 | NA |
| 2. P | A6P331 | As-peptide 126 | NA | 2.18e-02 | NA |
| 2. P | Q8WY50 | Placenta-specific protein 4 | 1.12e-01 | 2.73e-02 | NA |
| 2. P | P35323 | Cornifin | 5.90e-01 | 1.41e-04 | NA |
| 2. P | Q925I0 | Keratin-associated protein 19-2 | 2.48e-03 | 2.04e-03 | NA |
| 2. P | Q28658 | Small proline-rich protein 3 | 6.92e-06 | 3.40e-03 | NA |
| 2. P | Q03293 | Period circadian protein (Fragment) | 1.69e-02 | 2.42e-02 | NA |
| 2. P | P39221 | Protein YabQ | 3.07e-02 | 2.31e-03 | NA |
| 2. P | Q925H6 | Keratin-associated protein 19-3 | 8.98e-01 | 2.83e-02 | NA |
| 2. P | Q09180 | Pro-P-factor | 6.49e-01 | 2.18e-02 | NA |
| 2. P | Q9BYP8 | Keratin-associated protein 17-1 | 9.15e-01 | 1.05e-02 | NA |
| 2. P | Q26287 | Period circadian protein (Fragment) | 8.28e-01 | 7.74e-04 | NA |
| 2. P | Q62266 | Cornifin-A | 7.13e-01 | 3.85e-02 | NA |
| 2. P | O70555 | Small proline-rich protein 2D | 4.97e-01 | 1.87e-03 | NA |
| 2. P | Q02400 | Late embryogenesis abundant protein B19.3 | 2.70e-01 | 5.97e-03 | NA |
| 2. P | Q62267 | Cornifin-B | 6.78e-01 | 2.26e-03 | NA |
| 2. P | Q04537 | Period circadian protein (Fragment) | 1.69e-03 | 2.74e-05 | NA |
| 2. P | Q1ELU4 | M-zodatoxin-Lt4b | 3.69e-01 | 1.05e-03 | NA |
| 2. P | Q9Y6Z5 | Putative uncharacterized protein AFDN-DT | 8.62e-01 | 8.98e-03 | NA |
| 2. P | Q6GZT0 | Uncharacterized protein 046L | NA | 6.39e-03 | NA |
| 2. P | Q925H2 | Keratin-associated protein 19-1 | 9.43e-01 | 2.19e-04 | NA |
| 2. P | P38466 | Uncharacterized mitochondrial protein ymf23 | 6.82e-01 | 4.59e-02 | NA |
| 2. P | O95177 | Uncharacterized protein GAS8-AS1 | 5.35e-01 | 1.61e-06 | NA |
| 2. P | Q1ELU5 | M-zodatoxin-Lt4a | 3.11e-01 | 1.73e-06 | NA |
| 2. P | P04672 | Nodulin-44 | 5.59e-01 | 8.47e-05 | NA |
| 2. P | P36042 | Putative uncharacterized protein YKL202W | 6.28e-02 | 1.46e-04 | NA |
| 2. P | Q95P23 | Enterin neuropeptides | 7.10e-01 | 2.00e-02 | NA |
| 2. P | Q8SVY9 | Uncharacterized protein ECU03_1610 | 1.79e-01 | 1.18e-02 | NA |
| 2. P | P35321 | Cornifin-A | 6.74e-01 | 3.46e-05 | NA |
| 2. P | Q9JJL0 | Testis-specific gene A8 protein | 8.33e-01 | 5.31e-03 | NA |
| 2. P | P0CL28 | Putative uncharacterized protein YGR296C-A | 4.62e-03 | 4.22e-12 | NA |
| 2. P | Q26289 | Period circadian protein (Fragment) | 2.20e-02 | 4.80e-04 | NA |
| 2. P | Q05191 | Late embryogenesis abundant protein B19.4 | 3.26e-01 | 5.38e-04 | NA |
| 2. P | A0A0U5GHH9 | Austinoid biosynthesis cluster protein W | NA | 4.03e-03 | NA |
| 2. P | F7VJQ2 | Alternative prion protein | 9.35e-02 | 3.90e-11 | NA |
| 2. P | P0CL27 | Putative uncharacterized protein YER190C-A | 4.62e-03 | 4.22e-12 | NA |
| 2. P | P43537 | Uncharacterized membrane protein YFL067W | 3.15e-01 | 2.64e-05 | NA |
| 3. B | Q8CIT9 | Suprabasin | 2.73e-01 | NA | 0.004 |
| 3. B | Q5T6R2 | Putative phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2P1 | 7.28e-01 | NA | 1.85e-05 |
| 3. B | Q6P3R8 | Serine/threonine-protein kinase Nek5 | 9.35e-01 | NA | 0.011 |
| 3. B | Q495B1 | Ankyrin repeat and death domain-containing protein 1A | 8.49e-01 | NA | 4.38e-07 |
| 3. B | Q8RY25 | Nuclear pore complex protein NUP98A | 9.94e-01 | NA | 0.032 |