Summary

Q8N9U9

Homolog: Q28658.
Function: Small proline-rich protein 3.

Statistics

Total GO Annotation: 55
Unique PROST Go: 42
Unique BLAST Go: 13

Total Homologs: 63
Unique PROST Homologs: 57
Unique BLAST Homologs: 5

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q28658 (Small proline-rich protein 3) with a FATCAT P-Value: 6.92e-06 and RMSD of 2.82 angstrom. The sequence alignment identity is 16.7%.
Structural alignment shown in left. Query protein Q8N9U9 colored as red in alignment, homolog Q28658 colored as blue. Query protein Q8N9U9 is also shown in right top, homolog Q28658 showed in right bottom. They are colored based on secondary structures. 

  Q8N9U9 --------------------------------------------MASPFGRLTDQKGRGH---PAGSGGVEV-NGGSARAAFSGGGRRVLSGGGRTAF-G 51
  Q28658 MSSYQQKQPFTPPPQPQQHQVKQPCQPPPQDTFVPITKDPCHPNVPSP-GN-TNIAEQGYVKIPE-QGSIKVPDTGYTKIPDSGNTK--VPESGCTSVPG 95

  Q8N9U9 GG-------GRTAFGDGGRTAFGVGGRTAFGGGGRTAFGGGGRTAFGVGGRTAF-GGGERVSLLSPGWSALARSWLTASSASRVQAILLPQP-----PE- 137
  Q28658 SGYSVVPQPGYTKVPDQGYTKVPESGCTSVPGSGYSVVPQPGYTKVPESGCTSVPGPGYP-TVPQPGYTKVPESGCTSVPGSGYS--VIPQPSYTKVPES 192

  Q8N9U9 --------------------------------------- 137
  Q28658 GCTSVPGPGYPTVPQPGYTKVQEPNPSIVTPGLSQKKTK 231

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0008585 female gonad development
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0018149 peptide cross-linking
2. P GO:0050832 defense response to fungus
2. P GO:1903573 negative regulation of response to endoplasmic reticulum stress
2. P GO:0030216 keratinocyte differentiation
2. P GO:0042151 nematocyst
2. P GO:0045943 positive regulation of transcription by RNA polymerase I
2. P GO:0062038 positive regulation of pheromone response MAPK cascade
2. P GO:0070972 protein localization to endoplasmic reticulum
2. P GO:0048511 rhythmic process
2. P GO:0032516 positive regulation of phosphoprotein phosphatase activity
2. P GO:0031424 keratinization
2. P GO:0016021 integral component of membrane
2. P GO:1990441 negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
2. P GO:0032005 signal transduction involved in positive regulation of conjugation with cellular fusion
2. P GO:0005198 structural molecule activity
2. P GO:0010514 induction of conjugation with cellular fusion
2. P GO:0000772 mating pheromone activity
2. P GO:0006915 apoptotic process
2. P GO:0030968 endoplasmic reticulum unfolded protein response
2. P GO:0035308 negative regulation of protein dephosphorylation
2. P GO:0019903 protein phosphatase binding
2. P GO:0030280 structural constituent of skin epidermis
2. P GO:0005882 intermediate filament
2. P GO:0019888 protein phosphatase regulator activity
2. P GO:0008544 epidermis development
2. P GO:0000164 protein phosphatase type 1 complex
2. P GO:0031640 killing of cells of another organism
2. P GO:0036496 regulation of translational initiation by eIF2 alpha dephosphorylation
2. P GO:1902310 positive regulation of peptidyl-serine dephosphorylation
2. P GO:0008157 protein phosphatase 1 binding
2. P GO:1903917 positive regulation of endoplasmic reticulum stress-induced eIF2 alpha dephosphorylation
2. P GO:0060734 regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
2. P GO:0005741 mitochondrial outer membrane
2. P GO:0032515 negative regulation of phosphoprotein phosphatase activity
2. P GO:0031142 induction of conjugation upon nitrogen starvation
2. P GO:0009877 nodulation
2. P GO:0070262 peptidyl-serine dephosphorylation
2. P GO:1903912 negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
2. P GO:0110044 regulation of cell cycle switching, mitotic to meiotic cell cycle
2. P GO:0001533 cornified envelope
3. B GO:0006405 RNA export from nucleus
3. B GO:0051155 positive regulation of striated muscle cell differentiation
3. B GO:0044614 nuclear pore cytoplasmic filaments
3. B GO:0031965 nuclear membrane
3. B GO:2001056 positive regulation of cysteine-type endopeptidase activity
3. B GO:0006406 mRNA export from nucleus
3. B GO:0017056 structural constituent of nuclear pore
3. B GO:0006606 protein import into nucleus
3. B GO:0007165 signal transduction
3. B GO:0000973 posttranscriptional tethering of RNA polymerase II gene DNA at nuclear periphery
3. B GO:0005635 nuclear envelope
3. B GO:0048573 photoperiodism, flowering
3. B GO:1902446 regulation of shade avoidance

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8N9U9 Putative uncharacterized protein SPANXA2-OT1 0 7.74e-147 4.64e-85
2. P C9JFL3 Proline, histidine and glycine-rich protein 1 8.67e-01 2.97e-02 NA
2. P P16844 Uncharacterized protein UL15A NA 1.91e-02 NA
2. P Q9D226 Keratin-associated protein 5-3 9.91e-03 1.44e-02 NA
2. P P13492 Antigen 10-3 1.23e-01 8.24e-04 NA
2. P Q2KI51 Protein phosphatase 1 regulatory subunit 15A 9.41e-01 4.22e-02 NA
2. P P0CL29 Putative uncharacterized protein YML133W-A 4.61e-03 4.22e-12 NA
2. P Q3LI59 Keratin-associated protein 21-2 6.25e-01 1.01e-03 NA
2. P P17564 Protein phosphatase 1 regulatory subunit 15A 8.49e-01 3.14e-02 NA
2. P P0CL31 Putative uncharacterized protein YPL283W-A 4.66e-03 4.22e-12 NA
2. P P75318 Uncharacterized protein MPN_465 2.13e-01 1.28e-03 NA
2. P P27058 Systemin 7.63e-01 8.56e-03 NA
2. P P0CL30 Putative uncharacterized protein YNL339W-A 4.61e-03 4.22e-12 NA
2. P P0DMZ8 U-actitoxin-Avd13a/b 9.32e-01 2.44e-02 NA
2. P Q11116 Uncharacterized protein C03B1.10 6.15e-02 2.06e-04 NA
2. P P22528 Cornifin-B 5.68e-01 9.52e-06 NA
2. P Q9UBC9 Small proline-rich protein 3 7.14e-01 3.92e-02 NA
2. P P35322 Cornifin 6.71e-01 1.18e-03 NA
2. P Q09134 Abscisic acid and environmental stress-inducible protein 4.78e-03 1.84e-02 NA
2. P P12347 Period clock protein 8.10e-03 7.84e-05 NA
2. P F7VJQ1 Alternative prion protein 1.39e-01 1.78e-13 NA
2. P Q55FX9 Putative uncharacterized protein DDB_G0268542 4.51e-01 2.92e-04 NA
2. P A6P331 As-peptide 126 NA 2.18e-02 NA
2. P Q8WY50 Placenta-specific protein 4 1.12e-01 2.73e-02 NA
2. P P35323 Cornifin 5.90e-01 1.41e-04 NA
2. P Q925I0 Keratin-associated protein 19-2 2.48e-03 2.04e-03 NA
2. P Q28658 Small proline-rich protein 3 6.92e-06 3.40e-03 NA
2. P Q03293 Period circadian protein (Fragment) 1.69e-02 2.42e-02 NA
2. P P39221 Protein YabQ 3.07e-02 2.31e-03 NA
2. P Q925H6 Keratin-associated protein 19-3 8.98e-01 2.83e-02 NA
2. P Q09180 Pro-P-factor 6.49e-01 2.18e-02 NA
2. P Q9BYP8 Keratin-associated protein 17-1 9.15e-01 1.05e-02 NA
2. P Q26287 Period circadian protein (Fragment) 8.28e-01 7.74e-04 NA
2. P Q62266 Cornifin-A 7.13e-01 3.85e-02 NA
2. P O70555 Small proline-rich protein 2D 4.97e-01 1.87e-03 NA
2. P Q02400 Late embryogenesis abundant protein B19.3 2.70e-01 5.97e-03 NA
2. P Q62267 Cornifin-B 6.78e-01 2.26e-03 NA
2. P Q04537 Period circadian protein (Fragment) 1.69e-03 2.74e-05 NA
2. P Q1ELU4 M-zodatoxin-Lt4b 3.69e-01 1.05e-03 NA
2. P Q9Y6Z5 Putative uncharacterized protein AFDN-DT 8.62e-01 8.98e-03 NA
2. P Q6GZT0 Uncharacterized protein 046L NA 6.39e-03 NA
2. P Q925H2 Keratin-associated protein 19-1 9.43e-01 2.19e-04 NA
2. P P38466 Uncharacterized mitochondrial protein ymf23 6.82e-01 4.59e-02 NA
2. P O95177 Uncharacterized protein GAS8-AS1 5.35e-01 1.61e-06 NA
2. P Q1ELU5 M-zodatoxin-Lt4a 3.11e-01 1.73e-06 NA
2. P P04672 Nodulin-44 5.59e-01 8.47e-05 NA
2. P P36042 Putative uncharacterized protein YKL202W 6.28e-02 1.46e-04 NA
2. P Q95P23 Enterin neuropeptides 7.10e-01 2.00e-02 NA
2. P Q8SVY9 Uncharacterized protein ECU03_1610 1.79e-01 1.18e-02 NA
2. P P35321 Cornifin-A 6.74e-01 3.46e-05 NA
2. P Q9JJL0 Testis-specific gene A8 protein 8.33e-01 5.31e-03 NA
2. P P0CL28 Putative uncharacterized protein YGR296C-A 4.62e-03 4.22e-12 NA
2. P Q26289 Period circadian protein (Fragment) 2.20e-02 4.80e-04 NA
2. P Q05191 Late embryogenesis abundant protein B19.4 3.26e-01 5.38e-04 NA
2. P A0A0U5GHH9 Austinoid biosynthesis cluster protein W NA 4.03e-03 NA
2. P F7VJQ2 Alternative prion protein 9.35e-02 3.90e-11 NA
2. P P0CL27 Putative uncharacterized protein YER190C-A 4.62e-03 4.22e-12 NA
2. P P43537 Uncharacterized membrane protein YFL067W 3.15e-01 2.64e-05 NA
3. B Q8CIT9 Suprabasin 2.73e-01 NA 0.004
3. B Q5T6R2 Putative phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2P1 7.28e-01 NA 1.85e-05
3. B Q6P3R8 Serine/threonine-protein kinase Nek5 9.35e-01 NA 0.011
3. B Q495B1 Ankyrin repeat and death domain-containing protein 1A 8.49e-01 NA 4.38e-07
3. B Q8RY25 Nuclear pore complex protein NUP98A 9.94e-01 NA 0.032