Results | PROST

Summary

Q8N9W4

Homolog: Q8N7Z2.
Function: Golgin subfamily A member 6-like protein 1.

Statistics

Total GO Annotation: 202
Unique PROST Go: 29
Unique BLAST Go: 170

Total Homologs: 75
Unique PROST Homologs: 21
Unique BLAST Homologs: 47

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8N7Z2 (Golgin subfamily A member 6-like protein 1) with a FATCAT P-Value: 1.32e-07 and RMSD of 5.12 angstrom. The sequence alignment identity is 35.4%.
Structural alignment shown in left. Query protein Q8N9W4 colored as red in alignment, homolog Q8N7Z2 colored as blue. Query protein Q8N9W4 is also shown in right top, homolog Q8N7Z2 showed in right bottom. They are colored based on secondary structures.

  Q8N9W4 --------------------------------------MWP-QPHLPPHPMMSEKTRQNKLAEAKKKFTDYR-QWNIAGVGTRATDTKKKKINNGTNPET 60
  Q8N7Z2 MLMWPQPHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPHL-PTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTN-PSVGTAASDTKKKKINNGTNPET 98

  Q8N9W4 TTSEGCHSPEDTQQNRAQLKEEKKASHQHQEALRREIEAQDHTIRILTCQKTELETALYYSQDAARKFEDGNLGTPSSFNLALSQAFRGSPLGCVSTSLI 160
  Q8N7Z2 TTSGGCHSPED----------EQKASHQHQEALRRELEAQVHTIRILTCQKTELQMALYYSQHAVKQLE------------------------------- 157

  Q8N9W4 PGESKDLAGRLHHSWHFAGELQRALSAVSTWHKKADRYIEELTKERDALSLELYRNTITNEELKKKNAELQEKLRLAESEKSEIQLNVKELKRKLERAKF 260
  Q8N7Z2 -GEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTKERDALSLELYRNTITDEELKEKNAKLQEKLQLVESEKSEIQLNVKELKRKLERAKL 256

  Q8N9W4 LLPQ-------------VQT---------------NTL---QEE-MWRQEEELREQEKKIRKQEEKMWRQEERLREQEGKMR-------EQEEKMRRQE- 320
  Q8N7Z2 LLPQQQLQAEADHLGKELQSVSAKLQAQVEENELWNRLNQQQEEKMWRQEEKIQEWEEKIQEQEEKIREQEEKIREQEEKMRRQEEMMWEKEEKMRRQEE 356

  Q8N9W4 ---------KRLREQ--EKE--LR-------EQEKELREQ--K-----KLREQEEQMQEQEEKMW-------EQEEKMREQEEKMWRQEERLWEQEKQMR 386
  Q8N7Z2 MMWEKEEKMRRLEEMMWEKEEKIRELEEKMHEQEK-IREQEEKRQEEEKIREQEKR-QEQEAKMWRQEEKIREQEEKIREQEKKMWRQEEKIHEQEK-IR 453

  Q8N9W4 EQEQKMRDQEERMWEQDERLREKE------ERMREQEKMWEQVEKM-REEKKMQEQEKKTRDQEEKM-QEEERIREREKKMREEEETMREQEEKMQKQEE 478
  Q8N7Z2 E-EEKRQEQEE-MWRQEEKIREQEEIWRQKEKMHEQEKIRKQEEKVWRQEEKMHDQEEKIREQEEKMWRQEEKIREQEEKIREQEEKIREQEEMMQEQEE 551

  Q8N9W4 NMWEQEEK-------EWQQQRLPEQKEKLWEQ-EKMQEQEEKIWEQEEKIRDQEE--------MWGQEKKMWRQ-EKMREQEDVETGGEAAGAGEADVGA 561
  Q8N7Z2 KMGEQEEKMQEQEKMRRQEEKIREQEEKIREQKEKIREQEEKIWEQEEKIREQEEMMQEQEEKMWEQEEKMCEQEEKMQEQEE-KMRRQEEKMWEQEVRL 650

  Q8N9W4 GGEDAGSGAEDVGPGGEDVGAGREAAGEGGENAGAEEDVAAGGEDAGGEEDAGAGEEDMGPGGEDARGGEDAGAGEEDAGGGGDDAGAGGEDAGAGREDA 661
  Q8N7Z2 RQQE-----EKMQEHQEHL----EAAI------------------------------------------------------------------------- 668

  Q8N9W4 GAGGEDVGAGREDAGAGGEDVGAGGEDVGAGRRRCGSSRGCRNRRRSCGNTRRCRSRRSGAEDVGPEGEDVGAGREAAGEGGENAGAEDVAAGGEDAGEE 761
  Q8N7Z2 ---------------------------------------------------------------------------------------------------- 668

  Q8N9W4 EDAGGEDAGAAREDAGAGGDDVGAGREDAGAGGEDVGAGGEDAGAGGEDAGAGGEDAGPGGEDAGAGGEDAGPGGEDAGAGGEDAGPGGEDVGPGGEDVG 861
  Q8N7Z2 ---------------------------------------------------------------------------------------------------- 668

  Q8N9W4 AGGEDVGAGGDAREGGEDTRSEREDAGEAARARGAVLRALPPSLQSSL 909
  Q8N7Z2 ------------------------------------------------ 668

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0005201	extracellular matrix structural constituent
1. PB	GO:0032580	Golgi cisterna membrane
1. PB	GO:0005801	cis-Golgi network
2. P	GO:0030198	extracellular matrix organization
2. P	GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific
2. P	GO:0003682	chromatin binding
2. P	GO:0016032	viral process
2. P	GO:0000775	chromosome, centromeric region
2. P	GO:0000122	negative regulation of transcription by RNA polymerase II
2. P	GO:0006357	regulation of transcription by RNA polymerase II
2. P	GO:0031492	nucleosomal DNA binding
2. P	GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
2. P	GO:0005796	Golgi lumen
2. P	GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
2. P	GO:0010008	endosome membrane
2. P	GO:0006325	chromatin organization
2. P	GO:0030238	male sex determination
2. P	GO:0030016	myofibril
2. P	GO:0010628	positive regulation of gene expression
2. P	GO:0031274	positive regulation of pseudopodium assembly
2. P	GO:0051092	positive regulation of NF-kappaB transcription factor activity
2. P	GO:0034090	maintenance of meiotic sister chromatid cohesion
2. P	GO:0009653	anatomical structure morphogenesis
2. P	GO:0030133	transport vesicle
2. P	GO:0032982	myosin filament
2. P	GO:0030139	endocytic vesicle
2. P	GO:0030838	positive regulation of actin filament polymerization
2. P	GO:0007548	sex differentiation
2. P	GO:0007266	Rho protein signal transduction
2. P	GO:0000785	chromatin
2. P	GO:0016459	myosin complex
2. P	GO:0005654	nucleoplasm
3. B	GO:1990535	neuron projection maintenance
3. B	GO:0007391	dorsal closure
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0010737	protein kinase A signaling
3. B	GO:0005881	cytoplasmic microtubule
3. B	GO:0060050	positive regulation of protein glycosylation
3. B	GO:0097224	sperm connecting piece
3. B	GO:0090161	Golgi ribbon formation
3. B	GO:0004706	JUN kinase kinase kinase activity
3. B	GO:0005874	microtubule
3. B	GO:0060438	trachea development
3. B	GO:0005608	laminin-3 complex
3. B	GO:0009888	tissue development
3. B	GO:1901588	dendritic microtubule
3. B	GO:0044409	entry into host
3. B	GO:0002011	morphogenesis of an epithelial sheet
3. B	GO:0043083	synaptic cleft
3. B	GO:0008307	structural constituent of muscle
3. B	GO:0033186	CAF-1 complex
3. B	GO:1901253	negative regulation of intracellular transport of viral material
3. B	GO:0098882	structural constituent of presynaptic active zone
3. B	GO:0048106	establishment of thoracic bristle planar orientation
3. B	GO:1990716	axonemal central apparatus
3. B	GO:0051371	muscle alpha-actinin binding
3. B	GO:0046843	dorsal appendage formation
3. B	GO:0032091	negative regulation of protein binding
3. B	GO:0030334	regulation of cell migration
3. B	GO:0030687	preribosome, large subunit precursor
3. B	GO:0031430	M band
3. B	GO:0048804	imaginal disc-derived female genitalia morphogenesis
3. B	GO:0007394	dorsal closure, elongation of leading edge cells
3. B	GO:0045995	regulation of embryonic development
3. B	GO:0097091	synaptic vesicle clustering
3. B	GO:0097229	sperm end piece
3. B	GO:0007030	Golgi organization
3. B	GO:0008569	minus-end-directed microtubule motor activity
3. B	GO:0042464	dosage compensation by hypoactivation of X chromosome
3. B	GO:1990426	mitotic recombination-dependent replication fork processing
3. B	GO:0031672	A band
3. B	GO:0008017	microtubule binding
3. B	GO:0045214	sarcomere organization
3. B	GO:0007020	microtubule nucleation
3. B	GO:0051645	Golgi localization
3. B	GO:0043256	laminin complex
3. B	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
3. B	GO:0043194	axon initial segment
3. B	GO:0030240	skeletal muscle thin filament assembly
3. B	GO:0035633	maintenance of blood-brain barrier
3. B	GO:0099526	presynapse to nucleus signaling pathway
3. B	GO:0042805	actinin binding
3. B	GO:0030018	Z disc
3. B	GO:0090166	Golgi disassembly
3. B	GO:0060441	epithelial tube branching involved in lung morphogenesis
3. B	GO:0099642	retrograde axonal protein transport
3. B	GO:1990718	axonemal central pair projection
3. B	GO:0009887	animal organ morphogenesis
3. B	GO:0097493	structural molecule activity conferring elasticity
3. B	GO:0048749	compound eye development
3. B	GO:0051293	establishment of spindle localization
3. B	GO:0110136	protein-RNA complex remodeling
3. B	GO:0055013	cardiac muscle cell development
3. B	GO:0002737	negative regulation of plasmacytoid dendritic cell cytokine production
3. B	GO:0044307	dendritic branch
3. B	GO:0005859	muscle myosin complex
3. B	GO:0099641	anterograde axonal protein transport
3. B	GO:0008356	asymmetric cell division
3. B	GO:0045505	dynein intermediate chain binding
3. B	GO:0016324	apical plasma membrane
3. B	GO:0010507	negative regulation of autophagy
3. B	GO:0003341	cilium movement
3. B	GO:0002020	protease binding
3. B	GO:0007098	centrosome cycle
3. B	GO:0006335	DNA replication-dependent chromatin assembly
3. B	GO:0019901	protein kinase binding
3. B	GO:0007400	neuroblast fate determination
3. B	GO:0051959	dynein light intermediate chain binding
3. B	GO:0060048	cardiac muscle contraction
3. B	GO:0000922	spindle pole
3. B	GO:0060419	heart growth
3. B	GO:0055003	cardiac myofibril assembly
3. B	GO:0035321	maintenance of imaginal disc-derived wing hair orientation
3. B	GO:0007288	sperm axoneme assembly
3. B	GO:0061304	retinal blood vessel morphogenesis
3. B	GO:0005865	striated muscle thin filament
3. B	GO:0035418	protein localization to synapse
3. B	GO:0006936	muscle contraction
3. B	GO:0090306	meiotic spindle assembly
3. B	GO:0045198	establishment of epithelial cell apical/basal polarity
3. B	GO:0061676	importin-alpha family protein binding
3. B	GO:0050208	polysialic-acid O-acetyltransferase activity
3. B	GO:1902817	negative regulation of protein localization to microtubule
3. B	GO:0071361	cellular response to ethanol
3. B	GO:0043056	forward locomotion
3. B	GO:0004713	protein tyrosine kinase activity
3. B	GO:0008586	imaginal disc-derived wing vein morphogenesis
3. B	GO:0051225	spindle assembly
3. B	GO:0007411	axon guidance
3. B	GO:0002064	epithelial cell development
3. B	GO:0035455	response to interferon-alpha
3. B	GO:0007379	segment specification
3. B	GO:0150001	primary dendrite
3. B	GO:0061512	protein localization to cilium
3. B	GO:0045859	regulation of protein kinase activity
3. B	GO:0031674	I band
3. B	GO:0006941	striated muscle contraction
3. B	GO:1904158	axonemal central apparatus assembly
3. B	GO:1990225	rhoptry neck
3. B	GO:0005606	laminin-1 complex
3. B	GO:0072686	mitotic spindle
3. B	GO:0072382	minus-end-directed vesicle transport along microtubule
3. B	GO:0070160	tight junction
3. B	GO:0030134	COPII-coated ER to Golgi transport vesicle
3. B	GO:0006486	protein glycosylation
3. B	GO:0002224	toll-like receptor signaling pathway
3. B	GO:0043621	protein self-association
3. B	GO:0048803	imaginal disc-derived male genitalia morphogenesis
3. B	GO:0051592	response to calcium ion
3. B	GO:0031507	heterochromatin assembly
3. B	GO:0055008	cardiac muscle tissue morphogenesis
3. B	GO:0007403	glial cell fate determination
3. B	GO:0031114	regulation of microtubule depolymerization
3. B	GO:0097225	sperm midpiece
3. B	GO:1901897	regulation of relaxation of cardiac muscle
3. B	GO:0090307	mitotic spindle assembly
3. B	GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane
3. B	GO:0099139	cheating during chimeric sorocarp development
3. B	GO:0003300	cardiac muscle hypertrophy
3. B	GO:0043208	glycosphingolipid binding
3. B	GO:0007512	adult heart development
3. B	GO:0007018	microtubule-based movement
3. B	GO:0050882	voluntary musculoskeletal movement
3. B	GO:0031433	telethonin binding
3. B	GO:0030286	dynein complex
3. B	GO:0044650	adhesion of symbiont to host cell
3. B	GO:0005522	profilin binding
3. B	GO:0030155	regulation of cell adhesion
3. B	GO:0051289	protein homotetramerization
3. B	GO:0060445	branching involved in salivary gland morphogenesis
3. B	GO:0032224	positive regulation of synaptic transmission, cholinergic
3. B	GO:0048769	sarcomerogenesis
3. B	GO:0035222	wing disc pattern formation
3. B	GO:0005604	basement membrane
3. B	GO:0050714	positive regulation of protein secretion
3. B	GO:0034341	response to interferon-gamma
3. B	GO:0000794	condensed nuclear chromosome
3. B	GO:0046789	host cell surface receptor binding
3. B	GO:0046529	imaginal disc fusion, thorax closure
3. B	GO:0021591	ventricular system development
3. B	GO:0044647	host-symbiont bicellular tight junction
3. B	GO:0030317	flagellated sperm motility
3. B	GO:2000010	positive regulation of protein localization to cell surface
3. B	GO:2000200	regulation of ribosomal subunit export from nucleus
3. B	GO:0005875	microtubule associated complex
3. B	GO:0030241	skeletal muscle myosin thick filament assembly
3. B	GO:0097228	sperm principal piece
3. B	GO:0003777	microtubule motor activity
3. B	GO:1904071	presynaptic active zone assembly
3. B	GO:0098609	cell-cell adhesion
3. B	GO:0055002	striated muscle cell development
3. B	GO:0000137	Golgi cis cisterna
3. B	GO:0035456	response to interferon-beta
3. B	GO:0020008	rhoptry
3. B	GO:0035995	detection of muscle stretch
3. B	GO:1903829	positive regulation of protein localization
3. B	GO:0014037	Schwann cell differentiation
3. B	GO:0050790	regulation of catalytic activity
3. B	GO:0008093	cytoskeletal anchor activity
3. B	GO:0019905	syntaxin binding
3. B	GO:0048788	cytoskeleton of presynaptic active zone
3. B	GO:0030506	ankyrin binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q8N9W4	Golgin subfamily A member 6-like protein 2	0	3.11e-136	0.0
1. PB	H0YM25	Golgin subfamily A member 6-like protein 22	1.79e-02	3.32e-15	7.32e-139
1. PB	Q8N7Z2	Golgin subfamily A member 6-like protein 1	1.32e-07	5.84e-07	2.05e-141
1. PB	A0A1B0GV03	Golgin subfamily A member 6-like protein 7	5.33e-06	1.23e-14	1.16e-153
1. PB	A6NEM1	Golgin subfamily A member 6-like protein 9	5.00e-03	1.07e-03	1.11e-09
1. PB	A6NEY3	Putative golgin subfamily A member 6-like protein 3	1.57e-07	3.34e-03	2.95e-09
1. PB	A8MZA4	Golgin subfamily A member 6-like protein 6	6.62e-06	2.71e-12	1.86e-141
2. P	Q9JL35	High mobility group nucleosome-binding domain-containing protein 5	2.68e-01	6.53e-05	NA
2. P	Q5BJK8	Golgi integral membrane protein 4	5.45e-05	1.70e-02	NA
2. P	F8W0I5	Nuclear pore complex-interacting protein family member B12	3.62e-01	2.22e-03	NA
2. P	O00461	Golgi integral membrane protein 4	4.59e-04	1.46e-02	NA
2. P	Q66HF9	Leucine-rich repeat flightless-interacting protein 1	1.41e-02	1.71e-08	NA
2. P	Q95WA4	Spore wall protein 2	2.32e-02	2.49e-03	NA
2. P	Q86RN8	Paramyosin	3.11e-04	7.04e-03	NA
2. P	Q26005	Ring-infected erythrocyte surface antigen (Fragment)	1.22e-04	5.50e-03	NA
2. P	Q08D19	Golgi integral membrane protein 4	2.98e-02	8.30e-04	NA
2. P	P14348	Small capsomere-interacting protein	NA	4.90e-02	NA
2. P	Q49537	Variant surface antigen E	6.76e-01	2.75e-02	NA
2. P	Q91W92	Cdc42 effector protein 1	4.30e-01	3.33e-02	NA
2. P	Q62565	Sex-determining region Y protein	2.41e-02	4.48e-02	NA
2. P	B4F777	High mobility group nucleosome-binding domain-containing protein 5	2.26e-01	1.10e-02	NA
2. P	Q3UZ39	Leucine-rich repeat flightless-interacting protein 1	2.14e-01	3.63e-07	NA
2. P	F4J3S1	SHUGOSHIN 1	4.55e-02	2.91e-02	NA
2. P	P82970	High mobility group nucleosome-binding domain-containing protein 5	1.89e-01	1.67e-03	NA
2. P	D3YU32	Testis-expressed protein 13C-1	3.09e-02	3.61e-02	NA
2. P	Q6NSX1	Coiled-coil domain-containing protein 70	9.58e-05	4.06e-02	NA
2. P	Q9BMM8	Paramyosin	1.34e-03	2.73e-02	NA
2. P	A0A1B0GUY1	MARCO-like protein	3.52e-01	1.03e-02	NA
3. B	A6NEF3	Golgin subfamily A member 6-like protein 4	6.51e-07	NA	5.21e-09
3. B	Q8WZ42	Titin	NA	NA	0.004
3. B	Q80W93	Hydrocephalus-inducing protein	NA	NA	1.94e-04
3. B	Q9NYA3	Golgin subfamily A member 6A	2.21e-06	NA	2.54e-39
3. B	Q0II65	Coiled-coil domain-containing protein 70	5.01e-04	NA	0.040
3. B	A7NHM5	Ribonuclease Y	4.60e-03	NA	0.045
3. B	Q08379	Golgin subfamily A member 2	2.44e-03	NA	3.85e-36
3. B	A6NI86	Golgin subfamily A member 6-like protein 10	3.60e-06	NA	1.79e-09
3. B	O94248	Midasin	NA	NA	2.32e-06
3. B	Q5JR59	Microtubule-associated tumor suppressor candidate 2	8.54e-04	NA	0.010
3. B	Q4G0P3	Hydrocephalus-inducing protein homolog	NA	NA	1.02e-07
3. B	P24043	Laminin subunit alpha-2	NA	NA	0.013
3. B	A6NDN3	Golgin subfamily A member 6B	9.77e-06	NA	5.02e-36
3. B	P0CG33	Golgin subfamily A member 6D	2.13e-07	NA	1.03e-37
3. B	Q8IDX6	Reticulocyte-binding protein homolog 2a	NA	NA	1.09e-18
3. B	Q12019	Midasin	NA	NA	1.62e-04
3. B	Q8IID4	Dynein heavy chain-like protein PF11_0240	NA	NA	0.005
3. B	Q3UHD3	Microtubule-associated tumor suppressor candidate 2 homolog	1.79e-04	NA	0.006
3. B	H3BPF8	Golgin subfamily A member 8S	3.54e-02	NA	4.10e-14
3. B	Q8IBG1	Dynein heavy chain-like protein	NA	NA	0.012
3. B	Q5CZC0	Fibrous sheath-interacting protein 2	NA	NA	0.002
3. B	A2ARZ3	Fibrous sheath-interacting protein 2	NA	NA	0.002
3. B	D6RF30	Golgin subfamily A member 8K	3.42e-05	NA	0.008
3. B	Q6ZQQ6	WD repeat-containing protein 87	NA	NA	0.001
3. B	H3BQL2	Golgin subfamily A member 8T	4.60e-04	NA	0.004
3. B	P19137	Laminin subunit alpha-1	NA	NA	0.044
3. B	C0H5F4	Reticulocyte-binding protein homolog 2b	NA	NA	2.27e-04
3. B	Q6WRU0	Bone marrow stromal antigen 2	9.28e-05	NA	0.034
3. B	G5EBL3	Sex determination and dosage compensation protein sdc-2	NA	NA	4.41e-05
3. B	Q8ILR9	Protein PF14_0175	NA	NA	4.57e-08
3. B	P78559	Microtubule-associated protein 1A	NA	NA	6.83e-08
3. B	A1ADJ6	Polysialic acid O-acetyltransferase	1.88e-01	NA	4.13e-08
3. B	Q62839	Golgin subfamily A member 2	2.03e-05	NA	3.28e-27
3. B	Q27171	Dynein heavy chain, cytoplasmic	NA	NA	0.010
3. B	A6NDK9	Golgin subfamily A member 6C	2.36e-04	NA	4.13e-38
3. B	A7E2F4	Golgin subfamily A member 8A	1.61e-01	NA	0.003
3. B	Q8SX83	Protein split ends	NA	NA	0.005
3. B	Q95UN8	Mitogen-activated protein kinase kinase kinase	2.05e-01	NA	0.012
3. B	H0YKK7	Putative golgin subfamily A member 6-like protein 19	1.12e-06	NA	1.75e-09
3. B	A2ASS6	Titin	NA	NA	0.019
3. B	A6NC78	Putative golgin subfamily A member 8I	1.64e-05	NA	8.61e-05
3. B	Q6ZR08	Dynein axonemal heavy chain 12	NA	NA	0.022
3. B	Q921M4	Golgin subfamily A member 2	7.72e-05	NA	5.43e-28
3. B	Q9Y6V0	Protein piccolo	NA	NA	0.029
3. B	Q1MTN9	Chromatin assembly factor 1 subunit rlf2	1.84e-01	NA	6.24e-06
3. B	Q8IBP1	Uncharacterized membrane protein	NA	NA	5.84e-05
3. B	Q54G14	Uncharacterized protein DDB_G0290685	8.12e-02	NA	0.004