Summary

Q8NA03

Homolog: Q95LY3.
Function: Fibrous sheath-interacting protein 1.

Statistics

Total GO Annotation: 98
Unique PROST Go: 97
Unique BLAST Go: 1

Total Homologs: 71
Unique PROST Homologs: 65
Unique BLAST Homologs: 4

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q95LY3 (Fibrous sheath-interacting protein 1) with a FATCAT P-Value: 6.47e-06 and RMSD of 15.64 angstrom. The sequence alignment identity is 92.1%.
Structural alignment shown in left. Query protein Q8NA03 colored as red in alignment, homolog Q95LY3 colored as blue. Query protein Q8NA03 is also shown in right top, homolog Q95LY3 showed in right bottom. They are colored based on secondary structures. 

  Q8NA03 MDIIKGNLDGISKPASNSRIRPGSRSSNASLEVLSTEPGSFKVDTASNLNSGKEDHSESSNTENRRTSNDDKQESCSEKIKLAEEGSDEDLDLVQHQIIS 100
  Q95LY3 MDIIKGNLDGISKPASNSRIRPGSRSSNASLEVLSTEPASCKVDTASNLNSGKEDHSESSNTENRRTSNDDKRESCSEKIKLAEEGSDEDLDLVQRQIIP 100

  Q8NA03 ECSDEPKLKELDSQLQDAIQKMKKLDKILAKKQRREKEIKKQGLEMRIKLWEEIKSAKYSEAWQSKEEMENTKKFLSLTAVSEETVGPSHEEEDTFSSVF 200
  Q95LY3 ECSDEHKLEELDSQLQDAIQKMKKLDKILAKTQRREKEIKKQGLEMRIKLWEEIKSAKYSEAWQSKEEMENTKKFLSLTAASEETVGPSHENEDSFSSVF 200

  Q8NA03 HTQIPPEEYEMQMQKLNKDFTCDVERNESLIKSGKKPFSNTEKIELRGKHNQDFIKRNIELAKESRNPVVMVDREKKRLVELLKDLDEKDSGLSSSEGDQ 300
  Q95LY3 HTQIPPEEYEKQMQKLSKDFTCDVERNESLIKAGKKPFSNTEKIELRGKHNQDFIKRNIELAKESRNPVVMIEREKKRLVELLKDLDEKDSGLSSSEGDQ 300

  Q8NA03 SGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPTISSFSPRLENRNNQKPDRDGERNMEVTPGEKILRNTKEQRDLHNRLREIDEKLKMMKENVLEST 400
  Q95LY3 SGWVVPVKGYALAVTQHQQLAEIDIKLQELSAASPAISSFSPRLENQNNQEPDLDGEKNMEVTPGEKVLRNTKEQRDLRIRLREIDEKLRMMKENVLQST 400

  Q8NA03 SCLSEEQLKCLLDECILKQKSIIKLSSERKKEDIEDVTPVFPQLSRSIISKLLNESETKVQKTEVEDADMLESEECEASKGYYLTKALTGHNMSEALVTE 500
  Q95LY3 SRLSEEQLKCLLDECIVKQKSIIKLSSEGENEDIEDVIPMFPQLSRSIISKLLNESGTKVQKTEAEDADMLESAEREASKGYYLTKALTGHRMSEALVTE 500

  Q8NA03 AENMKCLQFSK-DVIISDTKDYFMSKTLGIGRLKRPSFLDDPLYGISVSLSSEDQHLKLSSPENTIADEQETKDAAEECKEP 581
  Q95LY3 VENMKCLQFSKND-IISDTKDYFMSKTLGIGRLKRPSFLDDPLYGITVSLSSEDQHLKLNSPEKTKADEQETKDAAEECKEP 581

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0017134 fibroblast growth factor binding
2. P GO:0080092 regulation of pollen tube growth
2. P GO:2000280 regulation of root development
2. P GO:0010369 chromocenter
2. P GO:0030659 cytoplasmic vesicle membrane
2. P GO:0097298 regulation of nucleus size
2. P GO:0019904 protein domain specific binding
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:0051028 mRNA transport
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0008298 intracellular mRNA localization
2. P GO:0016477 cell migration
2. P GO:0007530 sex determination
2. P GO:0005874 microtubule
2. P GO:0034501 protein localization to kinetochore
2. P GO:0009630 gravitropism
2. P GO:0000923 equatorial microtubule organizing center
2. P GO:1905907 negative regulation of amyloid fibril formation
2. P GO:0005085 guanyl-nucleotide exchange factor activity
2. P GO:0036158 outer dynein arm assembly
2. P GO:0035024 negative regulation of Rho protein signal transduction
2. P GO:0035020 regulation of Rac protein signal transduction
2. P GO:2000146 negative regulation of cell motility
2. P GO:0000132 establishment of mitotic spindle orientation
2. P GO:0034451 centriolar satellite
2. P GO:0040008 regulation of growth
2. P GO:0051495 positive regulation of cytoskeleton organization
2. P GO:0043515 kinetochore binding
2. P GO:0031021 interphase microtubule organizing center
2. P GO:0035630 bone mineralization involved in bone maturation
2. P GO:0007533 mating type switching
2. P GO:2000145 regulation of cell motility
2. P GO:0009860 pollen tube growth
2. P GO:0016272 prefoldin complex
2. P GO:0061099 negative regulation of protein tyrosine kinase activity
2. P GO:0000375 RNA splicing, via transesterification reactions
2. P GO:0005634 nucleus
2. P GO:0007030 Golgi organization
2. P GO:0000242 pericentriolar material
2. P GO:0007099 centriole replication
2. P GO:0036064 ciliary basal body
2. P GO:0004860 protein kinase inhibitor activity
2. P GO:0005789 endoplasmic reticulum membrane
2. P GO:0006997 nucleus organization
2. P GO:0098535 de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P GO:0007155 cell adhesion
2. P GO:2001108 positive regulation of Rho guanyl-nucleotide exchange factor activity
2. P GO:1990498 mitotic spindle microtubule
2. P GO:0007097 nuclear migration
2. P GO:0060294 cilium movement involved in cell motility
2. P GO:0019899 enzyme binding
2. P GO:0048749 compound eye development
2. P GO:0005774 vacuolar membrane
2. P GO:1990825 sequence-specific mRNA binding
2. P GO:0005815 microtubule organizing center
2. P GO:0051301 cell division
2. P GO:1902405 mitotic actomyosin contractile ring localization
2. P GO:0098536 deuterosome
2. P GO:1902584 positive regulation of response to water deprivation
2. P GO:0007098 centrosome cycle
2. P GO:0051011 microtubule minus-end binding
2. P GO:0036157 outer dynein arm
2. P GO:0080009 mRNA methylation
2. P GO:0000922 spindle pole
2. P GO:0000444 MIS12/MIND type complex
2. P GO:0048309 endoplasmic reticulum inheritance
2. P GO:0060271 cilium assembly
2. P GO:0009958 positive gravitropism
2. P GO:0099070 static microtubule bundle
2. P GO:0031252 cell leading edge
2. P GO:0000940 outer kinetochore
2. P GO:0044691 tooth eruption
2. P GO:0005652 nuclear lamina
2. P GO:0043015 gamma-tubulin binding
2. P GO:2000012 regulation of auxin polar transport
2. P GO:0005813 centrosome
2. P GO:0032991 protein-containing complex
2. P GO:0000795 synaptonemal complex
2. P GO:0005694 chromosome
2. P GO:0070652 HAUS complex
2. P GO:0035735 intraciliary transport involved in cilium assembly
2. P GO:0036396 RNA N6-methyladenosine methyltransferase complex
2. P GO:0000137 Golgi cis cisterna
2. P GO:0051298 centrosome duplication
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0005801 cis-Golgi network
2. P GO:0001540 amyloid-beta binding
2. P GO:0035556 intracellular signal transduction
2. P GO:0044183 protein folding chaperone
2. P GO:0032580 Golgi cisterna membrane
2. P GO:0005912 adherens junction
2. P GO:0000801 central element
2. P GO:0031024 interphase microtubule organizing center assembly
2. P GO:0034453 microtubule anchoring
2. P GO:0045453 bone resorption
2. P GO:0006914 autophagy
2. P GO:0070868 obsolete heterochromatin organization involved in chromatin silencing
3. B GO:0031514 motile cilium

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8NA03 Fibrous sheath-interacting protein 1 0 1.38e-129 0.0
1. PB Q95LY3 Fibrous sheath-interacting protein 1 6.47e-06 5.15e-52 0.0
2. P A6NI56 Coiled-coil domain-containing protein 154 3.01e-02 8.95e-03 NA
2. P A6NMD2 Golgin subfamily A member 8J 1.10e-02 3.17e-02 NA
2. P Q6NRX3 Afadin- and alpha-actinin-binding protein B 2.28e-02 4.05e-02 NA
2. P Q86T90 Protein hinderin 1.89e-01 1.60e-04 NA
2. P C7GY13 SWI5-dependent HO expression protein 3 1.56e-02 1.52e-03 NA
2. P B3LN26 SWI5-dependent HO expression protein 3 1.18e-01 5.50e-03 NA
2. P O94986 Centrosomal protein of 152 kDa 3.02e-01 3.00e-02 NA
2. P Q9Z852 Uncharacterized protein CPn_0499/CP_0255/CPj0499/CpB0519 6.21e-02 2.24e-02 NA
2. P Q9CZP7 Hsp90 co-chaperone Cdc37-like 1 9.13e-03 2.15e-02 NA
2. P Q2TA00 Coiled-coil domain-containing protein 83 1.25e-02 5.18e-05 NA
2. P D6RF30 Golgin subfamily A member 8K 1.78e-02 4.36e-03 NA
2. P A8JF70 Outer dynein arm protein 1 1.45e-01 1.23e-02 NA
2. P Q6NZK5 Protein hinderin 1.72e-01 9.12e-04 NA
2. P Q9Y2D8 Afadin- and alpha-actinin-binding protein 4.80e-02 2.52e-04 NA
2. P Q9PK02 Uncharacterized protein TC_0671 3.39e-02 1.34e-03 NA
2. P A6NCC3 Golgin subfamily A member 8O 1.66e-03 1.58e-03 NA
2. P B0BN18 Prefoldin subunit 2 1.19e-01 4.61e-02 NA
2. P Q5U584 SH3 domain-binding protein 5-like 1.05e-02 4.92e-03 NA
2. P Q32LK9 Synaptonemal complex central element protein 1 1.48e-02 4.12e-02 NA
2. P A7E2F4 Golgin subfamily A member 8A 9.33e-02 4.20e-03 NA
2. P Q9I969 Beta-taxilin 1.36e-01 4.38e-02 NA
2. P Q9USP7 Uncharacterized protein C902.06 2.21e-01 6.86e-03 NA
2. P Q0JJ05 Nuclear matrix constituent protein 1b 8.37e-02 2.59e-02 NA
2. P A6NC78 Putative golgin subfamily A member 8I 2.41e-02 2.43e-03 NA
2. P Q923A2 Protein Spindly 1.01e-02 2.39e-02 NA
2. P Q3KR99 Protein Spindly 2.25e-02 6.80e-03 NA
2. P Q9FLH0 Protein CROWDED NUCLEI 4 6.93e-02 7.00e-04 NA
2. P Q95K40 Coiled-coil domain-containing protein 83 3.32e-03 2.06e-06 NA
2. P Q8CGZ2 Afadin- and alpha-actinin-binding protein 1.24e-01 9.27e-05 NA
2. P I6L899 Golgin subfamily A member 8R 1.46e-02 8.02e-03 NA
2. P Q8VDS7 Centrosomal protein CEP57L1 2.87e-02 2.70e-02 NA
2. P O70591 Prefoldin subunit 2 1.16e-01 4.81e-02 NA
2. P F8WBI6 Golgin subfamily A member 8N 1.33e-02 1.57e-03 NA
2. P Q28XY0 Pre-mRNA-splicing regulator female-lethal(2)D 2.32e-02 1.93e-02 NA
2. P H3BV12 Golgin subfamily A member 8Q 3.93e-03 4.82e-04 NA
2. P D3UEM3 SWI5-dependent HO expression protein 3 8.29e-03 5.50e-03 NA
2. P A6ZL74 SWI5-dependent HO expression protein 3 1.81e-02 1.52e-03 NA
2. P Q5IF00 Autophagy-related protein 28 5.72e-02 1.70e-02 NA
2. P H3BPF8 Golgin subfamily A member 8S 3.74e-02 9.96e-05 NA
2. P A4IH82 SH3 domain-binding protein 5-like 3.37e-03 2.62e-03 NA
2. P Q6RUT8 Coiled-coil domain-containing protein 154 4.06e-02 3.08e-02 NA
2. P Q8IWF9 Coiled-coil domain-containing protein 83 7.12e-03 2.23e-05 NA
2. P A2BGP7 Coiled-coil domain-containing protein 125 7.07e-02 2.63e-02 NA
2. P Q96EA4 Protein Spindly 6.17e-02 9.20e-03 NA
2. P Q93ZY2 Rop guanine nucleotide exchange factor 1 1.27e-01 4.69e-02 NA
2. P Q96IY1 Kinetochore-associated protein NSL1 homolog 1.46e-01 1.60e-02 NA
2. P Q8N0S2 Synaptonemal complex central element protein 1 1.36e-02 3.37e-02 NA
2. P Q8VC66 Afadin- and alpha-actinin-binding protein 5.84e-03 2.15e-03 NA
2. P H2KYP0 PAC-1 interacting and coiled-coil domain-containing protein 1 7.07e-03 9.63e-03 NA
2. P Q58G53 Protein LAZY 2 4.06e-01 1.36e-02 NA
2. P Q8CEE0 Centrosomal protein of 57 kDa 3.47e-02 4.73e-02 NA
2. P B5VE90 SWI5-dependent HO expression protein 3 2.91e-02 5.06e-03 NA
2. P Q4R7H3 Protein Spindly 1.63e-02 1.01e-02 NA
2. P Q9D786 HAUS augmin-like complex subunit 5 9.37e-03 3.64e-02 NA
2. P Q5BIX7 Protein Spindly-A 4.42e-02 3.91e-02 NA
2. P Q9SVQ3 Rop guanine nucleotide exchange factor 9 2.93e-01 3.74e-02 NA
2. P Q1KS66 Rop guanine nucleotide exchange factor 10 7.90e-02 2.80e-03 NA
2. P Q2YDE5 Putative coiled-coil domain-containing protein 196 7.80e-02 1.36e-03 NA
2. P Q7L8J4 SH3 domain-binding protein 5-like 9.43e-02 3.43e-02 NA
2. P Q4R7J8 Synaptonemal complex central element protein 1 8.45e-03 3.14e-03 NA
2. P P38272 SWI5-dependent HO expression protein 3 4.88e-03 8.47e-03 NA
2. P C5E4H7 Spindle pole body component SPC42 3.00e-02 1.73e-03 NA
2. P C4R159 Autophagy-related protein 28 1.36e-02 1.70e-02 NA
2. P Q08DR9 Protein Spindly 2.45e-02 4.57e-02 NA
2. P H3BSY2 Golgin subfamily A member 8M 1.36e-02 2.27e-03 NA
3. B Q9D3V5 Fibrous sheath-interacting protein 1 5.33e-04 NA 5.20e-144
3. B Q566N9 Fibrous sheath-interacting protein 1 3.63e-03 NA 7.50e-16
3. B A1L2Y1 Fibrous sheath-interacting protein 1 5.69e-04 NA 3.47e-49
3. B Q66H16 Fibrous sheath-interacting protein 1 1.06e-03 NA 4.61e-135