Results | PROST

Summary

Q8NA23

Homolog: Q75BY3.
Function: Pre-mRNA-splicing factor PRP46.

Statistics

Total GO Annotation: 758
Unique PROST Go: 102
Unique BLAST Go: 317

Total Homologs: 1352
Unique PROST Homologs: 222
Unique BLAST Homologs: 704

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q75BY3 (Pre-mRNA-splicing factor PRP46) with a FATCAT P-Value: 0.0 and RMSD of 3.26 angstrom. The sequence alignment identity is 21.4%.
Structural alignment shown in left. Query protein Q8NA23 colored as red in alignment, homolog Q75BY3 colored as blue. Query protein Q8NA23 is also shown in right top, homolog Q75BY3 showed in right bottom. They are colored based on secondary structures.

  Q8NA23 M------LLLRCQLKQAPPQKVSFRFCVVMGKQQSKLKHSTYKYGRPDEIIEERIQTK--AFQEYSPAHMDTVSVVAALNSDLCVS--GGKDKTVVAYNW 90
  Q75BY3 MNEHSDDVYVRARLRN--------QF----G-------YMTW---VP-EYVEDRISSKKGILQRYED-YQQKQAKAQEVKTDSLVKYEGAKD--V----- 69

  Q8NA23 KTGNVVKRFKGHEHEITKVACIPKSSQFFSASRDRMVMMWDLHGSSQPRQQLCGHAMVVTG----LAVSP-DSSQLCTGSRDNTLLLWDVVTGQSVERAS 185
  Q75BY3 -PRNLLRIYRG-EAD-T--SALARYEEVVS-QKPQ----W--HAPWKLTRVINGH----TGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGK-L-KVT 151

  Q8NA23 VSRNVVT--HLCWVPREPYILQTSEDKTLRLWD-SRGLQVAHMFPAKQHIQTYCEV-SVDGHKCISCSNGFGGEGCEATLWDLRQTRNRICE--YKGH-- 277
  Q75BY3 LQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERN-TVVRDF----H-GTLSGVHSVDLHPSLDLIVSAGRDSV-VRVWDI---RSRSCVLTLAGHRG 241

  Q8NA23 -FQTVASCVFLPRALALMPLIATSSHDCKVKIW----------------N-QD-----T-----GAC---LFTLSL-DGSGPLT---SLAVGDAISLLCA 342
  Q75BY3 PINKV-RC--LP----VDPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFSFASACTDDIRSWKLVDGQ-LLTNFNSEALGIVNTLAC- 332

  Q8NA23 SFNR-GIHL--------LR-MDHSQGLELQ--EVAAF----------------------------------------------------------- 367
  Q75BY3 --NQDGV-LFAGGDTGELSFFDYKTGHKFQKLETTAMPGSLESEKGVLASTFDRTGLRLLTCERDKSIKIWKHIDGATQDSHPGLPWNPSLVRQRF 425

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0021540	corpus callosum morphogenesis
1. PB	GO:0006336	DNA replication-independent chromatin assembly
1. PB	GO:2000781	positive regulation of double-strand break repair
1. PB	GO:0019226	transmission of nerve impulse
1. PB	GO:0000122	negative regulation of transcription by RNA polymerase II
1. PB	GO:0005874	microtubule
1. PB	GO:0005080	protein kinase C binding
1. PB	GO:1902610	response to N-phenylthiourea
1. PB	GO:0042800	histone methyltransferase activity (H3-K4 specific)
1. PB	GO:0006338	chromatin remodeling
1. PB	GO:2000543	positive regulation of gastrulation
1. PB	GO:0006325	chromatin organization
1. PB	GO:0008327	methyl-CpG binding
1. PB	GO:0031965	nuclear membrane
1. PB	GO:1904851	positive regulation of establishment of protein localization to telomere
1. PB	GO:1903260	protein localization to mating projection tip
1. PB	GO:1905786	positive regulation of anaphase-promoting complex-dependent catabolic process
1. PB	GO:0000972	transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery
1. PB	GO:0008344	adult locomotory behavior
1. PB	GO:0120293	dynein axonemal particle
1. PB	GO:0032420	stereocilium
1. PB	GO:1904867	protein localization to Cajal body
1. PB	GO:0045722	positive regulation of gluconeogenesis
1. PB	GO:0050885	neuromuscular process controlling balance
1. PB	GO:0005869	dynactin complex
1. PB	GO:0110136	protein-RNA complex remodeling
1. PB	GO:0051301	cell division
1. PB	GO:0006337	nucleosome disassembly
1. PB	GO:0006335	DNA replication-dependent chromatin assembly
1. PB	GO:0005782	peroxisomal matrix
1. PB	GO:0003735	structural constituent of ribosome
1. PB	GO:0043025	neuronal cell body
1. PB	GO:0010997	anaphase-promoting complex binding
1. PB	GO:0000109	nucleotide-excision repair complex
1. PB	GO:0061883	clathrin-dependent endocytosis involved in vitellogenesis
1. PB	GO:0070840	dynein complex binding
1. PB	GO:2001162	positive regulation of histone H3-K79 methylation
1. PB	GO:1905168	positive regulation of double-strand break repair via homologous recombination
1. PB	GO:0051649	establishment of localization in cell
1. PB	GO:0090594	inflammatory response to wounding
1. PB	GO:0090181	regulation of cholesterol metabolic process
1. PB	GO:0005671	obsolete Ada2/Gcn5/Ada3 transcription activator complex
1. PB	GO:0045138	nematode male tail tip morphogenesis
1. PB	GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process
1. PB	GO:0050765	negative regulation of phagocytosis
1. PB	GO:0061003	positive regulation of dendritic spine morphogenesis
1. PB	GO:0017145	stem cell division
1. PB	GO:0008611	ether lipid biosynthetic process
1. PB	GO:0005053	peroxisome matrix targeting signal-2 binding
1. PB	GO:0043130	ubiquitin binding
1. PB	GO:0001667	ameboidal-type cell migration
1. PB	GO:0010154	fruit development
1. PB	GO:0048814	regulation of dendrite morphogenesis
1. PB	GO:0048511	rhythmic process
1. PB	GO:0071215	cellular response to abscisic acid stimulus
1. PB	GO:0000209	protein polyubiquitination
1. PB	GO:0005834	heterotrimeric G-protein complex
1. PB	GO:0030425	dendrite
1. PB	GO:0000375	RNA splicing, via transesterification reactions
1. PB	GO:0005634	nucleus
1. PB	GO:0014909	smooth muscle cell migration
1. PB	GO:0000123	histone acetyltransferase complex
1. PB	GO:0048527	lateral root development
1. PB	GO:0031682	G-protein gamma-subunit binding
1. PB	GO:0000118	histone deacetylase complex
1. PB	GO:0030515	snoRNA binding
1. PB	GO:0005681	spliceosomal complex
1. PB	GO:0034504	protein localization to nucleus
1. PB	GO:0051012	microtubule sliding
1. PB	GO:0001764	neuron migration
1. PB	GO:0030971	receptor tyrosine kinase binding
1. PB	GO:0003682	chromatin binding
1. PB	GO:0030178	negative regulation of Wnt signaling pathway
1. PB	GO:0071339	MLL1 complex
1. PB	GO:0007312	oocyte nucleus migration involved in oocyte dorsal/ventral axis specification
1. PB	GO:0032350	regulation of hormone metabolic process
1. PB	GO:0005840	ribosome
1. PB	GO:0007294	germarium-derived oocyte fate determination
1. PB	GO:0071007	U2-type catalytic step 2 spliceosome
1. PB	GO:0030576	Cajal body organization
1. PB	GO:0045495	pole plasm
1. PB	GO:0051299	centrosome separation
1. PB	GO:0047391	alkylglycerophosphoethanolamine phosphodiesterase activity
1. PB	GO:0000974	Prp19 complex
1. PB	GO:1903033	positive regulation of microtubule plus-end binding
1. PB	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
1. PB	GO:0005662	DNA replication factor A complex
1. PB	GO:0005635	nuclear envelope
1. PB	GO:0040013	negative regulation of locomotion
1. PB	GO:0043982	histone H4-K8 acetylation
1. PB	GO:2000728	regulation of mRNA export from nucleus in response to heat stress
1. PB	GO:0050772	positive regulation of axonogenesis
1. PB	GO:0051434	BH3 domain binding
1. PB	GO:0051081	nuclear membrane disassembly
1. PB	GO:0031465	Cul4B-RING E3 ubiquitin ligase complex
1. PB	GO:0010026	trichome differentiation
1. PB	GO:0071870	cellular response to catecholamine stimulus
1. PB	GO:0043966	histone H3 acetylation
1. PB	GO:0001675	acrosome assembly
1. PB	GO:2001034	positive regulation of double-strand break repair via nonhomologous end joining
1. PB	GO:1901386	negative regulation of voltage-gated calcium channel activity
1. PB	GO:0048545	response to steroid hormone
1. PB	GO:0030687	preribosome, large subunit precursor
1. PB	GO:0030723	ovarian fusome organization
1. PB	GO:0007298	border follicle cell migration
1. PB	GO:0055087	Ski complex
1. PB	GO:0005929	cilium
1. PB	GO:0034399	nuclear periphery
1. PB	GO:0007097	nuclear migration
1. PB	GO:0005737	cytoplasm
1. PB	GO:0007281	germ cell development
1. PB	GO:0005815	microtubule organizing center
1. PB	GO:2001244	positive regulation of intrinsic apoptotic signaling pathway
1. PB	GO:0051642	centrosome localization
1. PB	GO:0005847	mRNA cleavage and polyadenylation specificity factor complex
1. PB	GO:0032040	small-subunit processome
1. PB	GO:0043005	neuron projection
1. PB	GO:0031616	spindle pole centrosome
1. PB	GO:0030308	negative regulation of cell growth
1. PB	GO:0031023	microtubule organizing center organization
1. PB	GO:0001403	invasive growth in response to glucose limitation
1. PB	GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
1. PB	GO:0000922	spindle pole
1. PB	GO:0005848	mRNA cleavage stimulating factor complex
1. PB	GO:0007212	dopamine receptor signaling pathway
1. PB	GO:0042622	photoreceptor outer segment membrane
1. PB	GO:0060770	negative regulation of epithelial cell proliferation involved in prostate gland development
1. PB	GO:0000380	alternative mRNA splicing, via spliceosome
1. PB	GO:0051219	phosphoprotein binding
1. PB	GO:0051225	spindle assembly
1. PB	GO:0043984	histone H4-K16 acetylation
1. PB	GO:0051901	positive regulation of mitochondrial depolarization
1. PB	GO:0034501	protein localization to kinetochore
1. PB	GO:0009967	positive regulation of signal transduction
1. PB	GO:0046662	regulation of oviposition
1. PB	GO:0006378	mRNA polyadenylation
1. PB	GO:0090660	cerebrospinal fluid circulation
1. PB	GO:0045292	mRNA cis splicing, via spliceosome
1. PB	GO:0033137	negative regulation of peptidyl-serine phosphorylation
1. PB	GO:0035861	site of double-strand break
1. PB	GO:1990630	IRE1-RACK1-PP2A complex
1. PB	GO:0034514	mitochondrial unfolded protein response
1. PB	GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
1. PB	GO:1990447	U2 snRNP binding
1. PB	GO:0046329	negative regulation of JNK cascade
1. PB	GO:0080008	Cul4-RING E3 ubiquitin ligase complex
1. PB	GO:0071363	cellular response to growth factor stimulus
1. PB	GO:0030332	cyclin binding
1. PB	GO:0090176	microtubule cytoskeleton organization involved in establishment of planar polarity
1. PB	GO:0016593	Cdc73/Paf1 complex
1. PB	GO:0005828	kinetochore microtubule
1. PB	GO:0009908	flower development
1. PB	GO:0043087	regulation of GTPase activity
1. PB	GO:0001961	positive regulation of cytokine-mediated signaling pathway
1. PB	GO:0009411	response to UV
1. PB	GO:0031334	positive regulation of protein-containing complex assembly
1. PB	GO:0016581	NuRD complex
1. PB	GO:0045739	positive regulation of DNA repair
1. PB	GO:0000781	chromosome, telomeric region
1. PB	GO:0031514	motile cilium
1. PB	GO:0005875	microtubule associated complex
1. PB	GO:0030513	positive regulation of BMP signaling pathway
1. PB	GO:0051276	chromosome organization
1. PB	GO:0005813	centrosome
1. PB	GO:0007186	G protein-coupled receptor signaling pathway
1. PB	GO:0070034	telomerase RNA binding
1. PB	GO:0005697	telomerase holoenzyme complex
1. PB	GO:0070507	regulation of microtubule cytoskeleton organization
1. PB	GO:0090207	regulation of triglyceride metabolic process
1. PB	GO:0031124	mRNA 3'-end processing
1. PB	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
1. PB	GO:0005938	cell cortex
1. PB	GO:0005654	nucleoplasm
1. PB	GO:1905191	positive regulation of metaphase/anaphase transition of meiosis II
1. PB	GO:0031497	chromatin assembly
1. PB	GO:0035327
1. PB	GO:0047496	vesicle transport along microtubule
1. PB	GO:0033186	CAF-1 complex
1. PB	GO:0046843	dorsal appendage formation
1. PB	GO:0016567	protein ubiquitination
1. PB	GO:0046469	platelet activating factor metabolic process
1. PB	GO:0044877	protein-containing complex binding
1. PB	GO:0030426	growth cone
1. PB	GO:0005576	extracellular region
1. PB	GO:0051343	positive regulation of cyclic-nucleotide phosphodiesterase activity
1. PB	GO:0016319	mushroom body development
1. PB	GO:0007405	neuroblast proliferation
1. PB	GO:1990757	ubiquitin ligase activator activity
1. PB	GO:0097431	mitotic spindle pole
1. PB	GO:1904668	positive regulation of ubiquitin protein ligase activity
1. PB	GO:0000012	single strand break repair
1. PB	GO:0008247	1-alkyl-2-acetylglycerophosphocholine esterase complex
1. PB	GO:0007303	cytoplasmic transport, nurse cell to oocyte
1. PB	GO:0034511	U3 snoRNA binding
1. PB	GO:0001650	fibrillar center
1. PB	GO:2000114	regulation of establishment of cell polarity
1. PB	GO:0042826	histone deacetylase binding
1. PB	GO:0005886	plasma membrane
1. PB	GO:0040035	hermaphrodite genitalia development
1. PB	GO:0045879	negative regulation of smoothened signaling pathway
1. PB	GO:0009792	embryo development ending in birth or egg hatching
1. PB	GO:0031145	anaphase-promoting complex-dependent catabolic process
1. PB	GO:0051571	positive regulation of histone H3-K4 methylation
1. PB	GO:0005730	nucleolus
1. PB	GO:0006412	translation
1. PB	GO:0035097	histone methyltransferase complex
1. PB	GO:0075296	positive regulation of ascospore formation
1. PB	GO:0043547	positive regulation of GTPase activity
1. PB	GO:0016589	NURF complex
1. PB	GO:2000280	regulation of root development
1. PB	GO:0098789	pre-mRNA cleavage required for polyadenylation
1. PB	GO:0008298	intracellular mRNA localization
1. PB	GO:0097361	CIA complex
1. PB	GO:0032203	telomere formation via telomerase
1. PB	GO:0051130	positive regulation of cellular component organization
1. PB	GO:0051383	kinetochore organization
1. PB	GO:0048142	germarium-derived cystoblast division
1. PB	GO:0005078	MAP-kinase scaffold activity
1. PB	GO:0019827	stem cell population maintenance
1. PB	GO:0051661	maintenance of centrosome location
1. PB	GO:0042273	ribosomal large subunit biogenesis
1. PB	GO:0030473	nuclear migration along microtubule
1. PB	GO:0042052	rhabdomere development
1. PB	GO:0043143	regulation of translation by machinery localization
1. PB	GO:0001891	phagocytic cup
1. PB	GO:0051660	establishment of centrosome localization
1. PB	GO:0080135	regulation of cellular response to stress
1. PB	GO:0003677	DNA binding
1. PB	GO:0031101	fin regeneration
1. PB	GO:0043473	pigmentation
1. PB	GO:0048471	perinuclear region of cytoplasm
1. PB	GO:0046784	viral mRNA export from host cell nucleus
1. PB	GO:0090724	central region of growth cone
1. PB	GO:0097027	ubiquitin-protein transferase activator activity
1. PB	GO:0051973	positive regulation of telomerase activity
1. PB	GO:0030507	spectrin binding
1. PB	GO:0000398	mRNA splicing, via spliceosome
1. PB	GO:0034719	SMN-Sm protein complex
1. PB	GO:0000235	astral microtubule
1. PB	GO:0060528	secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
1. PB	GO:2000574	obsolete regulation of microtubule motor activity
1. PB	GO:0046716	muscle cell cellular homeostasis
1. PB	GO:0038026	reelin-mediated signaling pathway
1. PB	GO:1904115	axon cytoplasm
1. PB	GO:0007004	telomere maintenance via telomerase
1. PB	GO:1900087	positive regulation of G1/S transition of mitotic cell cycle
1. PB	GO:0070370	cellular heat acclimation
1. PB	GO:0010118	stomatal movement
1. PB	GO:0032797	SMN complex
1. PB	GO:0040019	positive regulation of embryonic development
1. PB	GO:0005680	anaphase-promoting complex
1. PB	GO:0051726	regulation of cell cycle
1. PB	GO:0016607	nuclear speck
1. PB	GO:0034337	RNA folding
1. PB	GO:0071407	cellular response to organic cyclic compound
1. PB	GO:0000776	kinetochore
1. PB	GO:0070176	DRM complex
1. PB	GO:0007315	pole plasm assembly
1. PB	GO:0021819	layer formation in cerebral cortex
1. PB	GO:0035591	signaling adaptor activity
1. PB	GO:0008090	retrograde axonal transport
1. PB	GO:0007369	gastrulation
1. PB	GO:0005881	cytoplasmic microtubule
1. PB	GO:0001934	positive regulation of protein phosphorylation
1. PB	GO:0005643	nuclear pore
1. PB	GO:0051898	negative regulation of protein kinase B signaling
1. PB	GO:0070545	PeBoW complex
1. PB	GO:0006406	mRNA export from nucleus
1. PB	GO:0000132	establishment of mitotic spindle orientation
1. PB	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
1. PB	GO:0044666	MLL3/4 complex
1. PB	GO:0042998	positive regulation of Golgi to plasma membrane protein transport
1. PB	GO:0009991	response to extracellular stimulus
1. PB	GO:0034709	methylosome
1. PB	GO:0072593	reactive oxygen species metabolic process
1. PB	GO:0090666	scaRNA localization to Cajal body
1. PB	GO:0016558	protein import into peroxisome matrix
1. PB	GO:0007165	signal transduction
1. PB	GO:0009867	jasmonic acid mediated signaling pathway
1. PB	GO:0007059	chromosome segregation
1. PB	GO:0043622	cortical microtubule organization
1. PB	GO:0043981	histone H4-K5 acetylation
1. PB	GO:0006405	RNA export from nucleus
1. PB	GO:0006333	chromatin assembly or disassembly
1. PB	GO:0048854	brain morphogenesis
1. PB	GO:0030277	maintenance of gastrointestinal epithelium
1. PB	GO:0072499	photoreceptor cell axon guidance
1. PB	GO:0032880	regulation of protein localization
1. PB	GO:0033597	mitotic checkpoint complex
1. PB	GO:0031252	cell leading edge
1. PB	GO:1905392	plant organ morphogenesis
1. PB	GO:0035098	ESC/E(Z) complex
1. PB	GO:0048813	dendrite morphogenesis
1. PB	GO:0071013	catalytic step 2 spliceosome
1. PB	GO:0009845	seed germination
1. PB	GO:0060236	regulation of mitotic spindle organization
1. PB	GO:0048188	Set1C/COMPASS complex
1. PB	GO:0044297	cell body
1. PB	GO:2000582	obsolete positive regulation of microtubule motor activity, plus-end-directed
1. PB	GO:0090671	telomerase RNA localization to Cajal body
1. PB	GO:1902773	GTPase activator complex
1. PB	GO:0140582	adenylate cyclase-activating G protein-coupled cAMP receptor signaling pathway
1. PB	GO:0051010	microtubule plus-end binding
1. PB	GO:0043021	ribonucleoprotein complex binding
1. PB	GO:0021895	cerebral cortex neuron differentiation
1. PB	GO:0051020	GTPase binding
1. PB	GO:0036035	osteoclast development
1. PB	GO:0015030	Cajal body
1. PB	GO:0060117	auditory receptor cell development
1. PB	GO:0051568	histone H3-K4 methylation
1. PB	GO:0098532	histone H3-K27 trimethylation
1. PB	GO:0000466	maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
1. PB	GO:0048135	female germ-line cyst formation
1. PB	GO:0000445	THO complex part of transcription export complex
1. PB	GO:1990756	ubiquitin ligase-substrate adaptor activity
1. PB	GO:0031464	Cul4A-RING E3 ubiquitin ligase complex
1. PB	GO:0042393	histone binding
1. PB	GO:0030286	dynein complex
1. PB	GO:1903725	regulation of phospholipid metabolic process
1. PB	GO:0045598	regulation of fat cell differentiation
1. PB	GO:0097680	double-strand break repair via classical nonhomologous end joining
1. PB	GO:0009723	response to ethylene
1. PB	GO:0080182	histone H3-K4 trimethylation
1. PB	GO:0008380	RNA splicing
1. PB	GO:0010659	cardiac muscle cell apoptotic process
1. PB	GO:0051302	regulation of cell division
1. PB	GO:0032991	protein-containing complex
1. PB	GO:0030381	chorion-containing eggshell pattern formation
1. PB	GO:0005829	cytosol
1. PB	GO:0046872	metal ion binding
1. PB	GO:0045842	positive regulation of mitotic metaphase/anaphase transition
1. PB	GO:0090102	cochlea development
1. PB	GO:0042249	establishment of planar polarity of embryonic epithelium
1. PB	GO:0042169	SH2 domain binding
1. PB	GO:1903208	negative regulation of hydrogen peroxide-induced neuron death
1. PB	GO:0030292	protein tyrosine kinase inhibitor activity
1. PB	GO:0051572	negative regulation of histone H3-K4 methylation
1. PB	GO:0072344	rescue of stalled ribosome
1. PB	GO:0046982	protein heterodimerization activity
2. P	GO:0048364	root development
2. P	GO:0021766	hippocampus development
2. P	GO:0007094	mitotic spindle assembly checkpoint signaling
2. P	GO:0051028	mRNA transport
2. P	GO:0030374	nuclear receptor coactivator activity
2. P	GO:0003380	establishment or maintenance of cytoskeleton polarity involved in gastrulation
2. P	GO:0000346	transcription export complex
2. P	GO:1902365	positive regulation of protein localization to spindle pole body
2. P	GO:0070734	histone H3-K27 methylation
2. P	GO:0009788	negative regulation of abscisic acid-activated signaling pathway
2. P	GO:0050829	defense response to Gram-negative bacterium
2. P	GO:0032091	negative regulation of protein binding
2. P	GO:0000502	proteasome complex
2. P	GO:1903775	regulation of DNA double-strand break processing
2. P	GO:0043577	chemotropism
2. P	GO:0051321	meiotic cell cycle
2. P	GO:0002091	negative regulation of receptor internalization
2. P	GO:0007191	adenylate cyclase-activating dopamine receptor signaling pathway
2. P	GO:0033698	Rpd3L complex
2. P	GO:0019903	protein phosphatase binding
2. P	GO:0044222	anammoxosome
2. P	GO:1903463	regulation of mitotic cell cycle DNA replication
2. P	GO:0005246	calcium channel regulator activity
2. P	GO:0140627	ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
2. P	GO:0043022	ribosome binding
2. P	GO:0005677	chromatin silencing complex
2. P	GO:0006283	transcription-coupled nucleotide-excision repair
2. P	GO:2000001	regulation of DNA damage checkpoint
2. P	GO:0006342
2. P	GO:0007349	cellularization
2. P	GO:0006397	mRNA processing
2. P	GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway
2. P	GO:0016571	histone methylation
2. P	GO:0045505	dynein intermediate chain binding
2. P	GO:0010525	regulation of transposition, RNA-mediated
2. P	GO:0060041	retina development in camera-type eye
2. P	GO:1904691	negative regulation of type B pancreatic cell proliferation
2. P	GO:0043078	polar nucleus
2. P	GO:0007447	imaginal disc pattern formation
2. P	GO:0010506	regulation of autophagy
2. P	GO:0048510	regulation of timing of transition from vegetative to reproductive phase
2. P	GO:0031428	box C/D RNP complex
2. P	GO:0006348
2. P	GO:0006913	nucleocytoplasmic transport
2. P	GO:0031939	obsolete negative regulation of chromatin silencing at telomere
2. P	GO:0048573	photoperiodism, flowering
2. P	GO:0042058	regulation of epidermal growth factor receptor signaling pathway
2. P	GO:0120171	Cdc24p-Far1p-Gbetagamma complex
2. P	GO:1902805	positive regulation of synaptic vesicle transport
2. P	GO:0070913	Ddb1-Wdr21 complex
2. P	GO:0050909	sensory perception of taste
2. P	GO:1990298	bub1-bub3 complex
2. P	GO:0051983	regulation of chromosome segregation
2. P	GO:0031080	nuclear pore outer ring
2. P	GO:0051087	chaperone binding
2. P	GO:0008608	attachment of spindle microtubules to kinetochore
2. P	GO:0004402	histone acetyltransferase activity
2. P	GO:1903341	regulation of meiotic DNA double-strand break formation
2. P	GO:0070286	axonemal dynein complex assembly
2. P	GO:0036158	outer dynein arm assembly
2. P	GO:0070914	UV-damage excision repair
2. P	GO:0072357	PTW/PP1 phosphatase complex
2. P	GO:0090696	post-embryonic plant organ development
2. P	GO:0032527	protein exit from endoplasmic reticulum
2. P	GO:0051865	protein autoubiquitination
2. P	GO:0005092	GDP-dissociation inhibitor activity
2. P	GO:0007611	learning or memory
2. P	GO:0030496	midbody
2. P	GO:2001173	regulation of histone H2B conserved C-terminal lysine ubiquitination
2. P	GO:1903024	positive regulation of ascospore-type prospore membrane formation
2. P	GO:0048383	mesectoderm development
2. P	GO:0061670	evoked neurotransmitter secretion
2. P	GO:0043204	perikaryon
2. P	GO:0031592	centrosomal corona
2. P	GO:0035064	methylated histone binding
2. P	GO:0070912	Ddb1-Ckn1 complex
2. P	GO:0070210	Rpd3L-Expanded complex
2. P	GO:1905301	regulation of macropinocytosis
2. P	GO:0000070	mitotic sister chromatid segregation
2. P	GO:1903138	negative regulation of cell wall integrity MAPK cascade
2. P	GO:0000347	THO complex
2. P	GO:0010973	positive regulation of division septum assembly
2. P	GO:1900035	negative regulation of cellular response to heat
2. P	GO:0060027	convergent extension involved in gastrulation
2. P	GO:0034452	dynactin binding
2. P	GO:0030706	germarium-derived oocyte differentiation
2. P	GO:0035518	histone H2A monoubiquitination
2. P	GO:0060290	transdifferentiation
2. P	GO:0045931	positive regulation of mitotic cell cycle
2. P	GO:0021987	cerebral cortex development
2. P	GO:0030968	endoplasmic reticulum unfolded protein response
2. P	GO:0006290	pyrimidine dimer repair
2. P	GO:0061685	diphthine methylesterase activity
2. P	GO:0016243	regulation of autophagosome size
2. P	GO:0010224	response to UV-B
2. P	GO:0032221	Rpd3S/Clr6-CII complex
2. P	GO:0098654	CENP-A recruiting complex
2. P	GO:0010906	regulation of glucose metabolic process
2. P	GO:0010674	negative regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle
2. P	GO:0045773	positive regulation of axon extension
2. P	GO:0045201	maintenance of neuroblast polarity
2. P	GO:0071333	cellular response to glucose stimulus
3. B	GO:0036120	cellular response to platelet-derived growth factor stimulus
3. B	GO:1902510	regulation of apoptotic DNA fragmentation
3. B	GO:0060021	roof of mouth development
3. B	GO:0090141	positive regulation of mitochondrial fission
3. B	GO:0043614	multi-eIF complex
3. B	GO:0000244	spliceosomal tri-snRNP complex assembly
3. B	GO:0008283	cell population proliferation
3. B	GO:0006368	transcription elongation from RNA polymerase II promoter
3. B	GO:1901800	positive regulation of proteasomal protein catabolic process
3. B	GO:0030992	intraciliary transport particle B
3. B	GO:1905861	intranuclear rod assembly
3. B	GO:0032796	uropod organization
3. B	GO:0060307	regulation of ventricular cardiac muscle cell membrane repolarization
3. B	GO:1903673	mitotic cleavage furrow formation
3. B	GO:0007541	sex determination, primary response to X:A ratio
3. B	GO:0010267	primary ta-siRNA processing
3. B	GO:2000234	positive regulation of rRNA processing
3. B	GO:0008017	microtubule binding
3. B	GO:0009553	embryo sac development
3. B	GO:0004842	ubiquitin-protein transferase activity
3. B	GO:0031313	extrinsic component of endosome membrane
3. B	GO:0005615	extracellular space
3. B	GO:0032956	regulation of actin cytoskeleton organization
3. B	GO:0035264	multicellular organism growth
3. B	GO:0043224	nuclear SCF ubiquitin ligase complex
3. B	GO:0005667	transcription regulator complex
3. B	GO:0016579	protein deubiquitination
3. B	GO:0007634	optokinetic behavior
3. B	GO:0016282	eukaryotic 43S preinitiation complex
3. B	GO:0071217	cellular response to external biotic stimulus
3. B	GO:0017053	transcription repressor complex
3. B	GO:0061700	GATOR2 complex
3. B	GO:0097428	protein maturation by iron-sulfur cluster transfer
3. B	GO:0005198	structural molecule activity
3. B	GO:0019985	translesion synthesis
3. B	GO:0005826	actomyosin contractile ring
3. B	GO:0072520	seminiferous tubule development
3. B	GO:0040011	locomotion
3. B	GO:0033598	mammary gland epithelial cell proliferation
3. B	GO:2000393	negative regulation of lamellipodium morphogenesis
3. B	GO:0030836	positive regulation of actin filament depolymerization
3. B	GO:0090114	COPII-coated vesicle budding
3. B	GO:0051539	4 iron, 4 sulfur cluster binding
3. B	GO:0007015	actin filament organization
3. B	GO:0006367	transcription initiation from RNA polymerase II promoter
3. B	GO:0006334	nucleosome assembly
3. B	GO:0016477	cell migration
3. B	GO:0006886	intracellular protein transport
3. B	GO:0043521	regulation of myosin II filament disassembly
3. B	GO:0071906	CRD domain binding
3. B	GO:0000349	generation of catalytic spliceosome for first transesterification step
3. B	GO:0005819	spindle
3. B	GO:0031529	ruffle organization
3. B	GO:0031589	cell-substrate adhesion
3. B	GO:0031037	myosin II filament disassembly
3. B	GO:0045638	negative regulation of myeloid cell differentiation
3. B	GO:0036170	filamentous growth of a population of unicellular organisms in response to starvation
3. B	GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
3. B	GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0009968	negative regulation of signal transduction
3. B	GO:2000217	regulation of invasive growth in response to glucose limitation
3. B	GO:0036064	ciliary basal body
3. B	GO:0005930	axoneme
3. B	GO:0009825	multidimensional cell growth
3. B	GO:0009933	meristem structural organization
3. B	GO:0043297	apical junction assembly
3. B	GO:0034388	Pwp2p-containing subcomplex of 90S preribosome
3. B	GO:1903013	response to differentiation-inducing factor 1
3. B	GO:0030157	pancreatic juice secretion
3. B	GO:0016905	myosin heavy chain kinase activity
3. B	GO:2000394	positive regulation of lamellipodium morphogenesis
3. B	GO:0030127	COPII vesicle coat
3. B	GO:0098792	xenophagy
3. B	GO:0005525	GTP binding
3. B	GO:0010992	ubiquitin recycling
3. B	GO:1990266	neutrophil migration
3. B	GO:0030043	actin filament fragmentation
3. B	GO:1903146	regulation of autophagy of mitochondrion
3. B	GO:0030834	regulation of actin filament depolymerization
3. B	GO:0015630	microtubule cytoskeleton
3. B	GO:0016575	histone deacetylation
3. B	GO:0008352	katanin complex
3. B	GO:0071817	MMXD complex
3. B	GO:0043327	chemotaxis to cAMP
3. B	GO:0008013	beta-catenin binding
3. B	GO:2000024	regulation of leaf development
3. B	GO:1990907	beta-catenin-TCF complex
3. B	GO:0016055	Wnt signaling pathway
3. B	GO:0000245	spliceosomal complex assembly
3. B	GO:0038202	TORC1 signaling
3. B	GO:0051082	unfolded protein binding
3. B	GO:0090090	negative regulation of canonical Wnt signaling pathway
3. B	GO:0051510	regulation of unidimensional cell growth
3. B	GO:0007029	endoplasmic reticulum organization
3. B	GO:0048568	embryonic organ development
3. B	GO:0048872	homeostasis of number of cells
3. B	GO:1990716	axonemal central apparatus
3. B	GO:0061502	early endosome to recycling endosome transport
3. B	GO:0003714	transcription corepressor activity
3. B	GO:0045741	positive regulation of epidermal growth factor-activated receptor activity
3. B	GO:0010272	response to silver ion
3. B	GO:0048713	regulation of oligodendrocyte differentiation
3. B	GO:0001826	inner cell mass cell differentiation
3. B	GO:0030838	positive regulation of actin filament polymerization
3. B	GO:0055082	cellular chemical homeostasis
3. B	GO:0140297	DNA-binding transcription factor binding
3. B	GO:0034396	negative regulation of transcription from RNA polymerase II promoter in response to iron
3. B	GO:0006891	intra-Golgi vesicle-mediated transport
3. B	GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:1902525	regulation of protein monoubiquitination
3. B	GO:0006310	DNA recombination
3. B	GO:0033276	transcription factor TFTC complex
3. B	GO:0007019	microtubule depolymerization
3. B	GO:2001224	positive regulation of neuron migration
3. B	GO:1904672	regulation of somatic stem cell population maintenance
3. B	GO:0070534	protein K63-linked ubiquitination
3. B	GO:0061630	ubiquitin protein ligase activity
3. B	GO:0005884	actin filament
3. B	GO:0030595	leukocyte chemotaxis
3. B	GO:0000417	HIR complex
3. B	GO:0000387	spliceosomal snRNP assembly
3. B	GO:0009507	chloroplast
3. B	GO:0043527	tRNA methyltransferase complex
3. B	GO:0000421	autophagosome membrane
3. B	GO:0007219	Notch signaling pathway
3. B	GO:0010073	meristem maintenance
3. B	GO:0001732	formation of cytoplasmic translation initiation complex
3. B	GO:0061525	hindgut development
3. B	GO:2001205	negative regulation of osteoclast development
3. B	GO:0007064	mitotic sister chromatid cohesion
3. B	GO:0060590	ATPase regulator activity
3. B	GO:0045159	myosin II binding
3. B	GO:0031339	negative regulation of vesicle fusion
3. B	GO:0007095	mitotic G2 DNA damage checkpoint signaling
3. B	GO:0034315	regulation of Arp2/3 complex-mediated actin nucleation
3. B	GO:0005741	mitochondrial outer membrane
3. B	GO:1902183	regulation of shoot apical meristem development
3. B	GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling
3. B	GO:0048026	positive regulation of mRNA splicing, via spliceosome
3. B	GO:0016236	macroautophagy
3. B	GO:0032430	positive regulation of phospholipase A2 activity
3. B	GO:0002446	neutrophil mediated immunity
3. B	GO:0035973	aggrephagy
3. B	GO:0009944	polarity specification of adaxial/abaxial axis
3. B	GO:1903003	positive regulation of protein deubiquitination
3. B	GO:0043551	regulation of phosphatidylinositol 3-kinase activity
3. B	GO:0003700	DNA-binding transcription factor activity
3. B	GO:0031507	heterochromatin assembly
3. B	GO:0045309	protein phosphorylated amino acid binding
3. B	GO:0051126	negative regulation of actin nucleation
3. B	GO:0010393	galacturonan metabolic process
3. B	GO:0000266	mitochondrial fission
3. B	GO:0007099	centriole replication
3. B	GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling
3. B	GO:0140026	contractile vacuole dissociation from plasma membrane
3. B	GO:0090307	mitotic spindle assembly
3. B	GO:0000045	autophagosome assembly
3. B	GO:0005765	lysosomal membrane
3. B	GO:0006909	phagocytosis
3. B	GO:0000433	carbon catabolite repression of transcription from RNA polymerase II promoter by glucose
3. B	GO:0040020	regulation of meiotic nuclear division
3. B	GO:0038180	nerve growth factor signaling pathway
3. B	GO:0016021	integral component of membrane
3. B	GO:0031929	TOR signaling
3. B	GO:0046425	regulation of receptor signaling pathway via JAK-STAT
3. B	GO:0097525	spliceosomal snRNP complex
3. B	GO:0030621	U4 snRNA binding
3. B	GO:0012507	ER to Golgi transport vesicle membrane
3. B	GO:0002102	podosome
3. B	GO:0030117	membrane coat
3. B	GO:0031648	protein destabilization
3. B	GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process
3. B	GO:0090135	actin filament branching
3. B	GO:0002188	translation reinitiation
3. B	GO:0030674	protein-macromolecule adaptor activity
3. B	GO:0031932	TORC2 complex
3. B	GO:0034450	ubiquitin-ubiquitin ligase activity
3. B	GO:0045862	positive regulation of proteolysis
3. B	GO:0003743	translation initiation factor activity
3. B	GO:0051013	microtubule severing
3. B	GO:0005656	nuclear pre-replicative complex
3. B	GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
3. B	GO:0006693	prostaglandin metabolic process
3. B	GO:0070986	left/right axis specification
3. B	GO:0071672	negative regulation of smooth muscle cell chemotaxis
3. B	GO:0048359	mucilage metabolic process involved in seed coat development
3. B	GO:0120095	vacuole-isolation membrane contact site
3. B	GO:1900045	negative regulation of protein K63-linked ubiquitination
3. B	GO:0030914
3. B	GO:0006413	translational initiation
3. B	GO:0022618	ribonucleoprotein complex assembly
3. B	GO:0071540	eukaryotic translation initiation factor 3 complex, eIF3e
3. B	GO:0005524	ATP binding
3. B	GO:0034455	t-UTP complex
3. B	GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation
3. B	GO:0030036	actin cytoskeleton organization
3. B	GO:0019005	SCF ubiquitin ligase complex
3. B	GO:0046540	U4/U6 x U5 tri-snRNP complex
3. B	GO:0010072	primary shoot apical meristem specification
3. B	GO:0071005	U2-type precatalytic spliceosome
3. B	GO:0061739	protein lipidation involved in autophagosome assembly
3. B	GO:0008104	protein localization
3. B	GO:0031931	TORC1 complex
3. B	GO:2001235	positive regulation of apoptotic signaling pathway
3. B	GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
3. B	GO:0090129	positive regulation of synapse maturation
3. B	GO:0039689	negative stranded viral RNA replication
3. B	GO:0034141	positive regulation of toll-like receptor 3 signaling pathway
3. B	GO:0030864	cortical actin cytoskeleton
3. B	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
3. B	GO:0042753	positive regulation of circadian rhythm
3. B	GO:0090344	negative regulation of cell aging
3. B	GO:0016005	phospholipase A2 activator activity
3. B	GO:0048711	positive regulation of astrocyte differentiation
3. B	GO:0008022	protein C-terminus binding
3. B	GO:0032036	myosin heavy chain binding
3. B	GO:0072686	mitotic spindle
3. B	GO:0072432	response to G1 DNA damage checkpoint signaling
3. B	GO:0003720	telomerase activity
3. B	GO:0071011	precatalytic spliceosome
3. B	GO:0070971	endoplasmic reticulum exit site
3. B	GO:1903026	negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding
3. B	GO:0045014	carbon catabolite repression of transcription by glucose
3. B	GO:0000381	regulation of alternative mRNA splicing, via spliceosome
3. B	GO:0051015	actin filament binding
3. B	GO:0120197	mucociliary clearance
3. B	GO:0008270	zinc ion binding
3. B	GO:0000775	chromosome, centromeric region
3. B	GO:0006907	pinocytosis
3. B	GO:1900091	regulation of raffinose biosynthetic process
3. B	GO:0030042	actin filament depolymerization
3. B	GO:0005814	centriole
3. B	GO:0045943	positive regulation of transcription by RNA polymerase I
3. B	GO:0007079	mitotic chromosome movement towards spindle pole
3. B	GO:0106004	tRNA (guanine-N7)-methylation
3. B	GO:0090049	regulation of cell migration involved in sprouting angiogenesis
3. B	GO:0071532	ankyrin repeat binding
3. B	GO:0010826	negative regulation of centrosome duplication
3. B	GO:1903378	positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
3. B	GO:1903955	positive regulation of protein targeting to mitochondrion
3. B	GO:0032008	positive regulation of TOR signaling
3. B	GO:0097598	sperm cytoplasmic droplet
3. B	GO:0042073	intraciliary transport
3. B	GO:0007368	determination of left/right symmetry
3. B	GO:0006364	rRNA processing
3. B	GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0097344	Rix1 complex
3. B	GO:0045827	negative regulation of isoprenoid metabolic process
3. B	GO:0001845	phagolysosome assembly
3. B	GO:0036180	filamentous growth of a population of unicellular organisms in response to biotic stimulus
3. B	GO:0090110	COPII-coated vesicle cargo loading
3. B	GO:0030174	regulation of DNA-dependent DNA replication initiation
3. B	GO:0030220	platelet formation
3. B	GO:1902463	protein localization to cell leading edge
3. B	GO:0048705	skeletal system morphogenesis
3. B	GO:0035014	phosphatidylinositol 3-kinase regulator activity
3. B	GO:0007399	nervous system development
3. B	GO:0033290	eukaryotic 48S preinitiation complex
3. B	GO:1903861	positive regulation of dendrite extension
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:0021522	spinal cord motor neuron differentiation
3. B	GO:1900052	regulation of retinoic acid biosynthetic process
3. B	GO:0042247	establishment of planar polarity of follicular epithelium
3. B	GO:0031915	positive regulation of synaptic plasticity
3. B	GO:0006974	cellular response to DNA damage stimulus
3. B	GO:0031117	positive regulation of microtubule depolymerization
3. B	GO:0016559	peroxisome fission
3. B	GO:0032781	positive regulation of ATP-dependent activity
3. B	GO:0008023	transcription elongation factor complex
3. B	GO:0045214	sarcomere organization
3. B	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
3. B	GO:0048596	embryonic camera-type eye morphogenesis
3. B	GO:0016226	iron-sulfur cluster assembly
3. B	GO:0005669	transcription factor TFIID complex
3. B	GO:0001895	retina homeostasis
3. B	GO:0034145	positive regulation of toll-like receptor 4 signaling pathway
3. B	GO:0043320	natural killer cell degranulation
3. B	GO:1903423	positive regulation of synaptic vesicle recycling
3. B	GO:0030030	cell projection organization
3. B	GO:1901998	toxin transport
3. B	GO:1905515	non-motile cilium assembly
3. B	GO:0002183	cytoplasmic translational initiation
3. B	GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
3. B	GO:0071006	U2-type catalytic step 1 spliceosome
3. B	GO:0045199	maintenance of epithelial cell apical/basal polarity
3. B	GO:0030126	COPI vesicle coat
3. B	GO:0045022	early endosome to late endosome transport
3. B	GO:0071541	eukaryotic translation initiation factor 3 complex, eIF3m
3. B	GO:0000437	carbon catabolite repression of transcription from RNA polymerase II promoter
3. B	GO:0051721	protein phosphatase 2A binding
3. B	GO:0050773	regulation of dendrite development
3. B	GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0017070	U6 snRNA binding
3. B	GO:0030686	90S preribosome
3. B	GO:0061966	establishment of left/right asymmetry
3. B	GO:0035767	endothelial cell chemotaxis
3. B	GO:0019899	enzyme binding
3. B	GO:1990939
3. B	GO:0005852	eukaryotic translation initiation factor 3 complex
3. B	GO:0071001	U4/U6 snRNP
3. B	GO:0080001	mucilage extrusion from seed coat
3. B	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0005871	kinesin complex
3. B	GO:0016480	negative regulation of transcription by RNA polymerase III
3. B	GO:0060271	cilium assembly
3. B	GO:1990452	Parkin-FBXW7-Cul1 ubiquitin ligase complex
3. B	GO:0043293	apoptosome
3. B	GO:0050816	phosphothreonine residue binding
3. B	GO:0071933	Arp2/3 complex binding
3. B	GO:0000139	Golgi membrane
3. B	GO:0033588	elongator holoenzyme complex
3. B	GO:0090443	FAR/SIN/STRIPAK complex
3. B	GO:0048366	leaf development
3. B	GO:1901796	regulation of signal transduction by p53 class mediator
3. B	GO:1900088	regulation of inositol biosynthetic process
3. B	GO:0051279	regulation of release of sequestered calcium ion into cytosol
3. B	GO:0070016	armadillo repeat domain binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q9D994	WD repeat-containing protein 38	6.33e-15	7.95e-06	1.86e-13
1. PB	Q5BE22	Pre-mRNA-splicing factor prp46	2.18e-12	1.57e-07	3.32e-12
1. PB	Q756D0	Ribosome biogenesis protein YTM1	4.23e-12	4.34e-04	0.033
1. PB	Q58E77	WD repeat-containing protein 82-B	0.00e+00	4.13e-05	0.004
1. PB	G4MQX3	MST50-interacting protein 11	0.00e+00	2.47e-03	3.87e-12
1. PB	B4JWA1	Lissencephaly-1 homolog	0.00e+00	4.20e-04	2.33e-12
1. PB	D5GBI7	Nuclear distribution protein PAC1	0.00e+00	3.99e-05	1.91e-11
1. PB	Q05048	Cleavage stimulation factor subunit 1	2.02e-14	5.62e-05	3.74e-05
1. PB	A1L271	Guanine nucleotide-binding protein subunit beta-5a	0.00e+00	1.19e-08	1.22e-07
1. PB	Q9BQA1	Methylosome protein 50	2.33e-15	4.12e-07	4.50e-09
1. PB	P0CS49	Pre-mRNA-splicing factor PRP46	4.44e-16	1.70e-02	6.49e-11
1. PB	Q75AV4	Polyadenylation factor subunit 2	1.50e-13	2.16e-08	6.90e-06
1. PB	Q8BFQ4	WD repeat-containing protein 82	0.00e+00	3.48e-05	5.31e-04
1. PB	P93563	Guanine nucleotide-binding protein subunit beta	3.94e-13	1.26e-09	8.75e-04
1. PB	O94244	Histone acetyltransferase type B subunit 2	3.33e-16	1.39e-03	1.98e-05
1. PB	B3NPW0	Lissencephaly-1 homolog	0.00e+00	1.99e-03	1.41e-12
1. PB	B4Q9T6	Ribosome biogenesis protein WDR12 homolog	6.00e-13	3.49e-04	9.17e-08
1. PB	B4LS78	Ribosome biogenesis protein WDR12 homolog	3.66e-13	3.29e-03	3.03e-07
1. PB	Q9NYS7	WD repeat and SOCS box-containing protein 2	1.77e-12	2.41e-04	6.57e-10
1. PB	Q75BY3	Pre-mRNA-splicing factor PRP46	0.00e+00	8.37e-17	8.66e-09
1. PB	P62881	Guanine nucleotide-binding protein subunit beta-5	2.22e-16	9.83e-09	1.20e-07
1. PB	Q6FJ73	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	3.43e-02	4.31e-04
1. PB	A4R3M4	Nuclear distribution protein PAC1	0.00e+00	1.70e-04	3.40e-11
1. PB	Q6P2Y2	Dynein assembly factor with WDR repeat domains 1	1.89e-15	3.46e-04	1.70e-13
1. PB	C0NRC6	Nuclear distribution protein PAC1	0.00e+00	1.23e-06	2.03e-09
1. PB	B8PD53	Nuclear distribution protein PAC1-2	NA	2.39e-04	9.51e-13
1. PB	A0CH87	Lissencephaly-1 homolog 2	0.00e+00	2.12e-05	2.24e-10
1. PB	Q5M7K4	Histone-binding protein RBBP4	5.55e-16	1.29e-02	1.88e-05
1. PB	Q8MYE8	Probable proteasomal ATPase-associated factor 1	9.87e-12	1.59e-18	0.002
1. PB	Q6ZMY6	WD repeat-containing protein 88	1.81e-13	8.33e-06	2.41e-05
1. PB	Q40507	Guanine nucleotide-binding protein subunit beta	1.11e-16	4.73e-10	5.50e-04
1. PB	A8X8C6	WD repeat-containing protein tag-125	0.00e+00	1.14e-09	7.72e-11
1. PB	Q6NZH4	Lissencephaly-1 homolog	0.00e+00	1.90e-04	2.63e-13
1. PB	C7Z6H2	Nuclear distribution protein PAC1	0.00e+00	5.74e-09	3.48e-12
1. PB	B0LSW3	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	2.34e-04	8.73e-13
1. PB	Q6UXN9	WD repeat-containing protein 82	0.00e+00	3.48e-05	5.31e-04
1. PB	Q9BUR4	Telomerase Cajal body protein 1	8.03e-10	2.32e-06	0.008
1. PB	P18851	Guanine nucleotide-binding protein subunit beta	1.21e-10	1.80e-09	0.022
1. PB	A2QP30	Nuclear distribution protein nudF	0.00e+00	2.49e-04	5.67e-08
1. PB	P0CS48	Pre-mRNA-splicing factor PRP46	8.89e-14	3.50e-02	1.48e-10
1. PB	Q8HXX0	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	2.78e-04	7.96e-13
1. PB	Q9P7C0	Uncharacterized WD repeat-containing protein C2E1P5.05	6.20e-09	1.98e-07	0.035
1. PB	Q498M4	WD repeat-containing protein 5	0.00e+00	2.44e-10	1.42e-15
1. PB	Q24572	Chromatin assembly factor 1 p55 subunit	4.44e-16	2.26e-04	4.91e-06
1. PB	Q5M9G8	DDB1- and CUL4-associated factor 11	6.66e-16	4.11e-02	2.09e-05
1. PB	Q0VC24	Ribosome biogenesis protein WDR12	6.08e-13	2.25e-03	1.20e-06
1. PB	Q05583	Cytosolic iron-sulfur protein assembly protein 1	0.00e+00	4.60e-02	2.94e-06
1. PB	Q86TI4	WD repeat-containing protein 86	0.00e+00	4.28e-05	3.32e-04
1. PB	P63244	Receptor of activated protein C kinase 1	0.00e+00	3.00e-05	6.70e-15
1. PB	Q7T2F6	WD repeat and SOCS box-containing protein 1	0.00e+00	9.83e-06	2.06e-08
1. PB	B4QHG6	Lissencephaly-1 homolog	0.00e+00	3.71e-03	1.38e-12
1. PB	Q0U1B1	Nuclear distribution protein PAC1	0.00e+00	3.61e-04	4.76e-11
1. PB	Q5QP82	DDB1- and CUL4-associated factor 10	9.53e-08	3.95e-03	0.002
1. PB	Q17963	WD repeat-containing protein wdr-5.1	4.44e-16	1.79e-06	3.04e-16
1. PB	B2VWG7	Nuclear distribution protein PAC1	0.00e+00	2.28e-05	8.39e-12
1. PB	Q90ZL4	Lissencephaly-1 homolog	0.00e+00	3.38e-04	2.86e-13
1. PB	P63245	Receptor of activated protein C kinase 1	0.00e+00	3.00e-05	6.70e-15
1. PB	C4R6H3	Nuclear distribution protein PAC1	2.22e-16	9.43e-05	5.75e-07
1. PB	P79959	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	1.18e-12	1.16e-07
1. PB	Q4WLM7	Nuclear distribution protein nudF	0.00e+00	9.16e-06	2.19e-12
1. PB	P62882	Guanine nucleotide-binding protein subunit beta-5	1.82e-14	7.83e-10	1.58e-07
1. PB	P61480	Ribosome biogenesis protein WDR12	6.30e-13	2.47e-03	3.65e-07
1. PB	Q3SWS8	mRNA export factor	2.24e-12	7.98e-04	0.001
1. PB	Q54LT8	Serine-threonine kinase receptor-associated protein	0.00e+00	4.32e-03	1.41e-05
1. PB	Q9HAV0	Guanine nucleotide-binding protein subunit beta-4	1.11e-16	9.98e-14	3.95e-06
1. PB	Q8TEB1	DDB1- and CUL4-associated factor 11	7.73e-10	1.20e-02	5.56e-06
1. PB	Q6DH44	WD repeat domain-containing protein 83	0.00e+00	3.24e-11	9.05e-07
1. PB	B4KT48	Lissencephaly-1 homolog	0.00e+00	9.75e-04	4.82e-12
1. PB	Q21215	Guanine nucleotide-binding protein subunit beta-2-like 1	1.22e-15	9.05e-06	3.41e-12
1. PB	P54313	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	1.52e-12	1.80e-08
1. PB	Q8AVH1	Histone-binding protein RBBP7	4.44e-16	4.28e-05	2.96e-04
1. PB	Q6FJZ9	Pre-mRNA-splicing factor PRP46	7.29e-14	1.27e-12	4.26e-11
1. PB	Q9PTR5	Lissencephaly-1 homolog	0.00e+00	3.49e-04	1.27e-12
1. PB	B6HP56	Nuclear distribution protein nudF 1	0.00e+00	9.01e-05	2.42e-13
1. PB	O24456	Receptor for activated C kinase 1A	0.00e+00	1.50e-04	1.11e-15
1. PB	Q8VE80	THO complex subunit 3	0.00e+00	1.25e-12	0.014
1. PB	P0CS37	Histone acetyltransferase type B subunit 2	7.77e-16	2.70e-02	3.80e-08
1. PB	Q29RH4	THO complex subunit 3	1.72e-14	7.52e-12	0.014
1. PB	P62883	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.50e-03	1.25e-08
1. PB	Q6CKE8	Pre-mRNA-splicing factor PRP46	0.00e+00	2.61e-18	2.12e-10
1. PB	Q12417	Pre-mRNA-splicing factor PRP46	2.73e-13	1.88e-12	4.82e-11
1. PB	Q4R304	Histone-binding protein RBBP7	2.22e-16	1.35e-04	4.84e-05
1. PB	Q8VC51	Telomerase Cajal body protein 1	5.03e-09	2.74e-06	0.010
1. PB	Q29KQ0	Ribosome biogenesis protein WDR12 homolog	7.95e-13	1.17e-03	9.12e-10
1. PB	Q8CBE3	WD repeat-containing protein 37	4.07e-11	5.08e-03	4.32e-05
1. PB	Q42384	Protein pleiotropic regulatory locus 1	1.82e-11	3.61e-04	1.99e-10
1. PB	A0DB19	Lissencephaly-1 homolog 1	2.22e-16	6.65e-06	4.65e-10
1. PB	Q9SY00	COMPASS-like H3K4 histone methylase component WDR5B	0.00e+00	2.01e-07	2.41e-10
1. PB	O54929	WD repeat and SOCS box-containing protein 2	1.64e-12	8.15e-04	2.41e-10
1. PB	Q9GZL7	Ribosome biogenesis protein WDR12	4.08e-13	7.98e-04	1.31e-06
1. PB	D4DG66	Nuclear distribution protein PAC1	0.00e+00	5.12e-06	7.51e-10
1. PB	Q6NUD0	Methylosome protein 50	0.00e+00	6.58e-06	4.41e-06
1. PB	Q8VZY6	Polycomb group protein FIE2	5.74e-13	2.09e-03	0.031
1. PB	Q55AR8	U5 small nuclear ribonucleoprotein 40 kDa protein	1.64e-13	6.77e-16	6.17e-12
1. PB	Q13685	Angio-associated migratory cell protein	1.14e-11	2.01e-03	0.005
1. PB	Q6PE01	U5 small nuclear ribonucleoprotein 40 kDa protein	4.22e-15	7.51e-10	1.62e-14
1. PB	Q8W1K8	Protein Mut11	0.00e+00	2.49e-04	6.23e-14
1. PB	P38011	Guanine nucleotide-binding protein subunit beta-like protein	2.00e-15	3.11e-05	3.23e-15
1. PB	O54927	WD repeat and SOCS box-containing protein 1	1.11e-16	6.43e-05	2.39e-07
1. PB	Q75C99	Histone acetyltransferase type B subunit 2	2.15e-14	2.96e-08	1.19e-05
1. PB	P69104	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	3.05e-07	1.44e-12
1. PB	A4IIX9	WD repeat-containing protein 37	2.20e-11	8.98e-03	4.88e-05
1. PB	P63247	Receptor of activated protein C kinase 1	0.00e+00	3.00e-05	6.70e-15
1. PB	Q9D7H2	WD repeat-containing protein 5B	5.22e-15	2.44e-12	3.46e-14
1. PB	Q5R7H5	DDB1- and CUL4-associated factor 11	1.57e-11	4.91e-02	6.18e-06
1. PB	P93398	Guanine nucleotide-binding protein subunit beta-2	0.00e+00	1.32e-08	4.27e-04
1. PB	C5FWH1	Nuclear distribution protein PAC1	0.00e+00	1.04e-05	2.32e-10
1. PB	Q5BJQ6	Cleavage stimulation factor subunit 1	4.93e-14	6.81e-05	5.38e-05
1. PB	B5DG67	Ribosome biogenesis protein wdr12	5.12e-13	5.92e-04	1.01e-08
1. PB	Q60525	Telomerase Cajal body protein 1	5.08e-09	1.37e-06	0.011
1. PB	P54311	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	6.98e-13	2.43e-07
1. PB	Q5R5W8	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	6.98e-13	2.52e-07
1. PB	Q4WEI5	Histone acetyltransferase type B subunit 2	3.33e-16	1.91e-05	2.23e-10
1. PB	B8P4B0	Nuclear distribution protein PAC1-1	0.00e+00	6.20e-06	1.04e-12
1. PB	Q5IS43	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	1.47e-04	4.67e-12
1. PB	Q5XI13	Glutamate-rich WD repeat-containing protein 1	1.14e-12	2.48e-02	1.54e-05
1. PB	Q5FVA9	mRNA export factor	2.12e-12	2.71e-05	0.003
1. PB	P90917	Probable histone-binding protein rba-1	0.00e+00	7.76e-08	0.011
1. PB	Q7KNS3	Lissencephaly-1 homolog	0.00e+00	3.71e-03	1.38e-12
1. PB	C3XVT5	Lissencephaly-1 homolog	0.00e+00	4.02e-04	1.04e-16
1. PB	Q6P1V3	WD repeat and SOCS box-containing protein 1	0.00e+00	3.75e-03	1.24e-11
1. PB	Q9V3J8	Protein will die slowly	0.00e+00	7.01e-10	2.18e-16
1. PB	Q13216	DNA excision repair protein ERCC-8	1.11e-16	6.06e-11	1.01e-06
1. PB	Q96DI7	U5 small nuclear ribonucleoprotein 40 kDa protein	4.44e-16	7.12e-09	1.50e-14
1. PB	Q2UA71	Histone acetyltransferase type B subunit 2	3.33e-16	1.46e-05	2.04e-09
1. PB	O22467	Histone-binding protein MSI1	3.33e-16	3.10e-04	7.09e-04
1. PB	Q6CSI1	Histone acetyltransferase type B subunit 2	1.11e-16	2.66e-08	6.62e-06
1. PB	P90916	Probable histone-binding protein lin-53	1.11e-16	3.21e-05	1.02e-06
1. PB	C5GVJ9	Nuclear distribution protein PAC1	6.79e-14	1.26e-05	8.91e-14
1. PB	Q6CGP9	Polyadenylation factor subunit 2	5.40e-11	1.10e-13	3.57e-07
1. PB	O18640	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	3.41e-06	9.97e-14
1. PB	Q6CG48	Nuclear distribution protein PAC1	0.00e+00	1.96e-04	1.55e-08
1. PB	Q5E9A4	mRNA export factor	2.36e-12	3.95e-03	0.001
1. PB	Q9VKQ3	Ribosome biogenesis protein WDR12 homolog	9.79e-13	1.27e-03	4.65e-08
1. PB	Q5R8K2	Cleavage stimulation factor subunit 1	2.07e-14	1.85e-04	4.24e-05
1. PB	C4JPW9	Nuclear distribution protein PAC1-2	0.00e+00	4.20e-09	1.46e-10
1. PB	Q0P593	Dynein assembly factor with WDR repeat domains 1	4.88e-15	1.87e-03	1.86e-15
1. PB	Q71UF4	Histone-binding protein RBBP7	2.22e-16	1.35e-04	4.84e-05
1. PB	P62884	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.50e-03	1.25e-08
1. PB	Q7ZTY4	Histone-binding protein RBBP7	4.44e-16	6.52e-04	6.15e-05
1. PB	A8NEG8	Nuclear distribution protein PAC1	0.00e+00	2.87e-05	1.31e-13
1. PB	Q1JQD2	Glutamate-rich WD repeat-containing protein 1	6.81e-13	1.41e-03	7.16e-05
1. PB	O93377	Histone-binding protein RBBP4-A	5.55e-16	2.79e-03	4.84e-05
1. PB	Q5BJ90	Ribosome biogenesis protein wdr12	4.99e-13	1.62e-02	0.034
1. PB	Q5XII5	Telomerase Cajal body protein 1	1.48e-10	5.37e-06	0.017
1. PB	Q4R6D2	mRNA export factor	3.21e-12	1.53e-02	8.45e-04
1. PB	Q9W5Z5	WD repeat and SOCS box-containing protein 1	1.09e-12	1.86e-02	6.93e-08
1. PB	A1CF18	Nuclear distribution protein nudF 2	0.00e+00	4.94e-10	1.98e-11
1. PB	Q08706	Guanine nucleotide-binding protein subunit beta	0.00e+00	6.48e-12	8.20e-08
1. PB	Q6BU94	Pre-mRNA-splicing factor PRP46	1.32e-13	1.01e-11	3.23e-12
1. PB	Q09028	Histone-binding protein RBBP4	5.55e-16	6.34e-03	2.12e-05
1. PB	Q5M786	WD repeat-containing protein 5	0.00e+00	8.82e-11	2.30e-15
1. PB	B6QC06	Nuclear distribution protein nudF 2	0.00e+00	1.20e-03	1.01e-08
1. PB	Q54KL5	WD repeat-containing protein 5 homolog	0.00e+00	1.08e-10	1.82e-16
1. PB	B4MU54	Ribosome biogenesis protein WDR12 homolog	7.99e-13	1.31e-03	5.07e-07
1. PB	P41838	Poly(A)+ RNA export protein	3.36e-14	3.63e-07	0.003
1. PB	Q61Y48	Probable histone-binding protein lin-53	1.11e-16	9.06e-04	4.62e-07
1. PB	O24467	LEC14B homolog	9.42e-10	1.28e-03	7.69e-05
1. PB	P62872	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	6.98e-13	2.43e-07
1. PB	Q5R654	Histone-binding protein RBBP7	2.22e-16	3.56e-05	1.06e-04
1. PB	Q6P3H7	Histone-binding protein RBBP4	4.44e-16	9.16e-03	7.39e-05
1. PB	Q2HBX6	Nuclear distribution protein PAC1-1	0.00e+00	7.37e-08	2.52e-14
1. PB	Q922V4	Pleiotropic regulator 1	2.36e-11	6.73e-04	1.28e-12
1. PB	Q10282	Guanine nucleotide-binding protein subunit beta	2.33e-15	4.50e-09	3.39e-08
1. PB	Q5ZL33	Serine-threonine kinase receptor-associated protein	0.00e+00	2.07e-04	1.43e-06
1. PB	Q10281	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	9.94e-06	8.48e-15
1. PB	P40066	mRNA export factor GLE2	1.33e-14	1.79e-03	0.001
1. PB	P49177	Guanine nucleotide-binding protein subunit beta	4.34e-14	9.48e-11	9.61e-08
1. PB	Q54W52	Ribosome biogenesis protein WDR12 homolog	1.40e-12	7.62e-05	9.42e-06
1. PB	Q75LV5	U3 snoRNP-associated protein-like YAOH	1.57e-09	9.79e-08	2.53e-06
1. PB	Q8R537	Peroxisomal targeting signal 2 receptor	0.00e+00	1.59e-06	2.48e-10
1. PB	Q4QR85	Methylosome protein 50	1.44e-15	9.84e-07	7.69e-07
1. PB	O94394	Uncharacterized WD repeat-containing protein C126.01c	0.00e+00	1.70e-14	2.72e-04
1. PB	P93339	Guanine nucleotide-binding protein subunit beta	NA	1.18e-10	0.004
1. PB	Q93847	WD repeat-containing protein wdr-5.2	0.00e+00	4.47e-11	9.75e-14
1. PB	Q7T394	Lissencephaly-1 homolog A	0.00e+00	6.73e-05	1.71e-13
1. PB	Q40153	LEC14B protein	9.47e-11	8.24e-04	6.03e-06
1. PB	P83774	Guanine nucleotide-binding protein subunit beta-like protein	1.89e-15	1.35e-04	2.12e-13
1. PB	P26308	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	5.21e-13	4.20e-06
1. PB	O94620	Pre-mRNA-splicing factor cwf17	0.00e+00	2.10e-12	8.51e-11
1. PB	Q9NDC9	Lissencephaly-1 homolog	0.00e+00	1.36e-04	9.91e-12
1. PB	Q1LV15	Dynein assembly factor with WDR repeat domains 1	1.78e-15	1.66e-07	1.19e-15
1. PB	Q4V7A0	WD repeat-containing protein 61	0.00e+00	1.82e-02	0.002
1. PB	Q59WJ4	Polyadenylation factor subunit 2	7.67e-13	1.36e-05	1.47e-06
1. PB	Q6FXI8	Histone acetyltransferase type B subunit 2	0.00e+00	1.88e-06	1.18e-09
1. PB	Q61011	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	1.11e-16	3.98e-11	5.11e-09
1. PB	Q5RDY7	Guanine nucleotide-binding protein subunit beta-5	0.00e+00	5.01e-10	9.82e-08
1. PB	Q6DDF0	WD repeat-containing protein 37	5.55e-16	1.53e-03	3.99e-05
1. PB	B5X3Z6	Lissencephaly-1 homolog A	0.00e+00	7.62e-05	2.02e-13
1. PB	Q39836	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.05e-03	2.87e-14
1. PB	Q7RY30	Nuclear distribution protein nudF-2	0.00e+00	2.81e-06	4.95e-13
1. PB	Q86VZ2	WD repeat-containing protein 5B	9.88e-15	1.07e-14	1.14e-13
1. PB	B4MY65	Lissencephaly-1 homolog	0.00e+00	1.94e-04	1.71e-11
1. PB	Q5REG7	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	3.42e-04	1.98e-12
1. PB	P90794	DDB1- and CUL4-associated factor 11 homolog	1.76e-09	1.98e-04	2.79e-04
1. PB	Q6PBY0	Guanine nucleotide-binding protein subunit beta-5b	2.22e-16	6.07e-08	1.78e-05
1. PB	A9V790	Lissencephaly-1 homolog	0.00e+00	4.15e-03	4.63e-12
1. PB	Q5FWQ6	Dynein assembly factor with WDR repeat domains 1	1.55e-15	9.60e-06	1.71e-12
1. PB	P62874	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	6.98e-13	2.43e-07
1. PB	C5JD40	Nuclear distribution protein PAC1	6.45e-14	1.26e-05	8.91e-14
1. PB	Q91WM3	U3 small nucleolar RNA-interacting protein 2	3.00e-09	4.20e-04	1.07e-09
1. PB	P49027	Guanine nucleotide-binding protein subunit beta-like protein A	4.44e-15	8.83e-09	6.12e-11
1. PB	Q9LTJ6	WD repeat-containing protein RUP1	2.37e-11	1.34e-08	0.004
1. PB	P52287	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	1.11e-16	2.42e-11	2.05e-08
1. PB	Q4P553	Histone acetyltransferase type B subunit 2	2.22e-16	9.63e-03	5.09e-04
1. PB	Q9C1X0	Uncharacterized WD repeat-containing protein C713.05	0.00e+00	2.00e-04	4.38e-10
1. PB	Q5RCG7	Angio-associated migratory cell protein	7.49e-11	2.65e-03	0.005
1. PB	A1DP19	Nuclear distribution protein nudF	0.00e+00	6.78e-07	3.45e-13
1. PB	C4JZS6	Nuclear distribution protein PAC1-1	0.00e+00	8.59e-04	2.62e-07
1. PB	B4GAJ1	Lissencephaly-1 homolog	0.00e+00	1.37e-03	3.41e-12
1. PB	Q5REE6	Ribosome biogenesis protein WDR12	5.73e-13	1.06e-03	1.31e-06
1. PB	Q4WT34	Pre-mRNA-splicing factor prp46	2.06e-11	2.10e-08	2.29e-13
1. PB	Q39336	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	4.88e-06	2.95e-14
1. PB	P0CS36	Histone acetyltransferase type B subunit 2	6.66e-16	2.70e-02	3.80e-08
1. PB	A7S338	Lissencephaly-1 homolog	0.00e+00	1.20e-04	7.31e-13
1. PB	Q20636	Guanine nucleotide-binding protein subunit beta-2	9.77e-15	1.00e-10	4.76e-07
1. PB	Q2HJH6	U5 small nuclear ribonucleoprotein 40 kDa protein	1.22e-15	2.91e-09	2.15e-14
1. PB	Q9GL51	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	3.94e-04	1.98e-12
1. PB	Q40687	Guanine nucleotide-binding protein subunit beta	8.12e-13	5.24e-11	6.04e-05
1. PB	Q6P315	Histone-binding protein RBBP7	3.33e-16	4.13e-05	1.78e-05
1. PB	D1ZEM6	Nuclear distribution protein PAC1-2	1.18e-13	3.92e-09	4.91e-12
1. PB	Q9UTN4	Polyadenylation factor subunit 2	1.62e-11	1.44e-07	2.93e-10
1. PB	Q5BK30	Dynein assembly factor with WDR repeat domains 1	3.89e-15	2.46e-06	1.06e-15
1. PB	O94423	Meiotic fizzy-related protein 1	8.00e-12	3.98e-04	0.005
1. PB	O22469	WD-40 repeat-containing protein MSI3	1.11e-16	2.38e-05	2.52e-04
1. PB	P23232	Guanine nucleotide-binding protein subunit beta	1.13e-14	2.32e-11	3.03e-07
1. PB	C6HTE8	Nuclear distribution protein PAC1	0.00e+00	1.23e-06	2.03e-09
1. PB	Q810D6	Glutamate-rich WD repeat-containing protein 1	1.27e-10	2.04e-02	8.40e-05
1. PB	Q7S7L4	Nuclear distribution protein nudF-1	1.38e-13	1.19e-07	1.15e-11
1. PB	P61964	WD repeat-containing protein 5	0.00e+00	2.44e-10	1.42e-15
1. PB	P36408	Guanine nucleotide-binding protein subunit beta	1.31e-14	3.71e-13	2.05e-08
1. PB	Q5A7Q3	Pre-mRNA-splicing factor PRP46	1.11e-16	1.44e-16	4.88e-06
1. PB	Q9SU78	WD-40 repeat-containing protein MSI5	1.56e-13	2.34e-06	1.65e-04
1. PB	P0CS42	Nuclear distribution protein PAC1	0.00e+00	8.13e-03	4.04e-13
1. PB	Q9JHB4	WD repeat-containing protein 31	0.00e+00	9.58e-58	0.0
1. PB	Q6TMK6	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	NA	1.99e-13	1.24e-07
1. PB	Q9DAJ4	WD repeat domain-containing protein 83	0.00e+00	4.60e-11	4.65e-09
1. PB	Q4R7Y4	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	3.00e-05	6.70e-15
1. PB	Q803D2	Lissencephaly-1 homolog B	0.00e+00	1.50e-04	3.87e-13
1. PB	Q54WA3	Peroxisomal targeting signal 2 receptor	0.00e+00	2.71e-06	4.41e-06
1. PB	P40968	Pre-mRNA-processing factor 17	1.63e-13	4.38e-05	2.36e-06
1. PB	Q9VLN1	WD repeat-containing protein 82	0.00e+00	2.62e-07	8.39e-06
1. PB	O24076	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	1.72e-04	1.15e-15
1. PB	P17343	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	4.07e-12	1.52e-07
1. PB	Q39190	Protein pleiotropic regulator PRL2	1.12e-10	1.32e-06	3.31e-09
1. PB	Q93134	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	4.33e-05	3.42e-16
1. PB	P61965	WD repeat-containing protein 5	0.00e+00	2.44e-10	1.42e-15
1. PB	Q4R8E7	Dynein assembly factor with WDR repeat domains 1	6.66e-15	2.63e-04	1.98e-14
1. PB	Q3SWX8	Histone-binding protein RBBP7	3.33e-16	2.75e-04	5.24e-05
1. PB	Q6GL39	WD repeat-containing protein 82	0.00e+00	8.43e-06	0.001
1. PB	Q8I0F4	Lissencephaly-1 homolog	0.00e+00	1.72e-04	4.44e-09
1. PB	B0XM00	Nuclear distribution protein nudF	0.00e+00	9.16e-06	2.19e-12
1. PB	Q96J01	THO complex subunit 3	3.90e-14	4.39e-12	0.006
1. PB	Q8C570	mRNA export factor	2.29e-12	3.46e-02	0.001
1. PB	P73594	WD repeat-containing protein slr1409	0.00e+00	1.24e-02	1.26e-05
1. PB	P29829	Guanine nucleotide-binding protein subunit beta-2	0.00e+00	8.11e-15	3.76e-10
1. PB	Q9XF57	Peroxisome biogenesis protein 7	0.00e+00	7.20e-05	7.67e-06
1. PB	P49178	Guanine nucleotide-binding protein subunit beta	5.07e-13	6.48e-12	9.76e-07
1. PB	Q9BRP4	Proteasomal ATPase-associated factor 1	6.44e-15	4.46e-16	0.016
1. PB	P43033	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	5.49e-04	8.97e-13
1. PB	Q6FJS0	Polyadenylation factor subunit 2	1.09e-11	7.94e-10	1.02e-06
1. PB	Q0V8J1	WD repeat and SOCS box-containing protein 2	1.28e-14	5.15e-04	1.29e-09
1. PB	Q5RF99	mRNA export factor	9.67e-13	3.91e-03	8.01e-04
1. PB	P63246	Receptor of activated protein C kinase 1	0.00e+00	3.00e-05	6.70e-15
1. PB	A8IR43	Ribosome biogenesis protein WDR12 homolog	4.34e-12	6.03e-03	6.10e-04
1. PB	B7FNU7	Lissencephaly-1 homolog	0.00e+00	1.29e-02	6.50e-10
1. PB	C0S902	Nuclear distribution protein PAC1	6.82e-14	8.53e-06	1.26e-14
1. PB	Q8N136	Dynein assembly factor with WDR repeat domains 1	5.00e-15	1.05e-03	2.69e-15
1. PB	P78406	mRNA export factor	1.15e-12	3.91e-03	8.01e-04
1. PB	Q6BVZ3	Polyadenylation factor subunit 2	1.46e-13	1.32e-07	4.64e-08
1. PB	A5GFN6	mRNA export factor	2.95e-12	1.17e-02	0.001
1. PB	B6QC56	Nuclear distribution protein nudF 1	0.00e+00	3.55e-08	3.44e-08
1. PB	Q9W7I5	Histone-binding protein RBBP4	5.55e-16	1.48e-02	2.16e-05
1. PB	P0CS43	Nuclear distribution protein PAC1	0.00e+00	8.13e-03	4.04e-13
1. PB	A8XZJ9	Lissencephaly-1 homolog	0.00e+00	9.35e-03	8.75e-12
1. PB	B6GZD3	Nuclear distribution protein nudF 2	0.00e+00	7.97e-07	8.92e-12
1. PB	Q5GIS3	Guanine nucleotide-binding protein subunit beta	5.00e-15	1.76e-13	6.05e-09
1. PB	D3BUN1	Lissencephaly-1 homolog	0.00e+00	1.18e-03	2.08e-09
1. PB	Q61ZF6	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	4.07e-12	1.52e-07
1. PB	Q6GMD2	WD repeat-containing protein 61	0.00e+00	3.06e-02	4.13e-06
1. PB	Q4ICM0	Nuclear distribution protein PAC1	0.00e+00	1.57e-05	2.44e-10
1. PB	Q9M0V4	U3 snoRNP-associated protein-like YAO	5.60e-13	5.55e-04	1.28e-07
1. PB	Q0D0X6	Nuclear distribution protein nudF	0.00e+00	1.83e-04	3.19e-08
1. PB	A2AKB9	DDB1- and CUL4-associated factor 10	2.64e-08	1.31e-02	0.002
1. PB	B2AEZ5	Nuclear distribution protein PAC1-1	0.00e+00	5.70e-06	4.91e-11
1. PB	Q7ZWF0	mRNA export factor	4.73e-13	1.36e-02	0.002
1. PB	P62873	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	6.98e-13	2.43e-07
1. PB	A7EKM8	Nuclear distribution protein PAC1	0.00e+00	5.84e-06	3.35e-11
1. PB	Q99LC2	Cleavage stimulation factor subunit 1	2.54e-14	6.81e-05	5.38e-05
1. PB	B4HWV6	Ribosome biogenesis protein WDR12 homolog	6.14e-13	4.02e-04	9.17e-08
1. PB	Q8CFD5	DNA excision repair protein ERCC-8	1.11e-16	3.72e-10	4.46e-06
1. PB	P46800	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	7.37e-05	5.01e-15
1. PB	O35353	Guanine nucleotide-binding protein subunit beta-4	5.11e-15	9.82e-14	0.011
1. PB	O22607	WD-40 repeat-containing protein MSI4	2.46e-10	1.08e-02	2.45e-04
1. PB	Q4I7L0	Histone acetyltransferase type B subunit 2	2.22e-16	1.07e-02	4.85e-05
1. PB	P58742	Aladin	3.58e-12	2.89e-02	2.84e-04
1. PB	B3N534	Ribosome biogenesis protein WDR12 homolog	5.58e-13	3.57e-04	4.41e-08
1. PB	Q291L9	Lissencephaly-1 homolog	0.00e+00	1.37e-03	3.41e-12
1. PB	Q6INH0	Histone-binding protein RBBP4-B	4.44e-16	2.02e-02	4.93e-05
1. PB	O14775	Guanine nucleotide-binding protein subunit beta-5	2.22e-16	2.68e-07	7.64e-08
1. PB	Q60973	Histone-binding protein RBBP7	2.22e-16	1.55e-04	4.67e-05
1. PB	Q5BLX8	WD repeat domain-containing protein 83	0.00e+00	5.09e-11	8.12e-09
1. PB	Q5RF51	U5 small nuclear ribonucleoprotein 40 kDa protein	6.66e-16	2.18e-09	1.20e-13
1. PB	P49026	Guanine nucleotide-binding protein subunit beta-like protein	2.44e-15	5.19e-05	4.30e-14
1. PB	P62871	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	6.98e-13	2.43e-07
1. PB	Q3Y8L7	Dynein assembly factor with WDR repeat domains 1	1.59e-14	7.95e-06	8.62e-19
1. PB	Q7ZYQ6	DDB1- and CUL4-associated factor 13	1.08e-12	2.64e-05	0.004
1. PB	Q3MKM6	U3 snoRNP-associated protein-like EMB2271	1.64e-13	1.11e-06	3.12e-07
1. PB	Q8SRB0	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	2.43e-07	6.46e-07
1. PB	P63004	Platelet-activating factor acetylhydrolase IB subunit alpha	0.00e+00	2.34e-04	8.73e-13
1. PB	B8AP31	Guanine nucleotide-binding protein subunit beta	1.11e-16	5.02e-11	6.04e-05
1. PB	Q6PNB6	Guanine nucleotide-binding protein subunit beta-5	1.11e-16	4.05e-10	1.01e-07
1. PB	O42248	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	1.76e-05	2.88e-15
1. PB	Q3MHL3	Histone-binding protein RBBP4	4.44e-16	6.34e-03	2.12e-05
1. PB	Q38942	Protein RAE1	0.00e+00	5.01e-09	0.005
1. PB	Q2GT28	Nuclear distribution protein PAC1-2	0.00e+00	7.37e-05	1.02e-08
1. PB	Q5XGI5	WD repeat domain-containing protein 83	0.00e+00	1.58e-11	4.26e-09
1. PB	Q2KIG2	WD repeat-containing protein 5	0.00e+00	1.12e-08	1.34e-15
1. PB	Q06506	Ribosomal RNA-processing protein 9	2.41e-08	3.77e-02	0.008
1. PB	Q99J09	Methylosome protein 50	1.44e-15	6.56e-08	7.35e-07
1. PB	A7TMF9	Ribosome biogenesis protein YTM1	1.37e-12	9.25e-04	0.005
1. PB	P62880	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	1.52e-12	1.80e-08
1. PB	Q9LV28	Receptor for activated C kinase 1C	0.00e+00	1.08e-04	4.43e-15
1. PB	O43017	Set1 complex component swd3	3.44e-15	2.95e-06	1.55e-11
1. PB	Q9BRX9	WD repeat domain-containing protein 83	2.66e-15	1.80e-11	2.70e-11
1. PB	Q8L4M1	THO complex subunit 6	0.00e+00	4.71e-06	2.33e-05
1. PB	B5X3C4	Lissencephaly-1 homolog B	0.00e+00	4.43e-05	1.41e-13
1. PB	O43818	U3 small nucleolar RNA-interacting protein 2	1.54e-10	6.58e-05	1.12e-08
1. PB	B4GT01	Ribosome biogenesis protein WDR12 homolog	1.04e-12	1.81e-03	8.88e-10
1. PB	B8M0Q1	Nuclear distribution protein nudF	0.00e+00	1.95e-06	4.86e-10
1. PB	Q25189	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	7.85e-06	2.02e-12
1. PB	Q9C4Z6	Receptor for activated C kinase 1B	0.00e+00	7.32e-06	1.83e-15
1. PB	Q60972	Histone-binding protein RBBP4	4.44e-16	6.34e-03	2.12e-05
1. PB	Q6L4F8	Guanine nucleotide-binding protein subunit beta-like protein B	5.00e-15	3.11e-09	1.16e-11
1. PB	Q9I8G9	Histone-binding protein RBBP7	3.33e-16	1.26e-04	2.77e-05
1. PB	O13982	Uncharacterized WD repeat-containing protein C25H1.08c	4.11e-14	3.85e-04	5.43e-04
1. PB	C1GB49	Nuclear distribution protein PAC1	8.48e-14	1.24e-05	3.87e-15
1. PB	O74340	Protein sof1	1.99e-13	3.11e-05	4.50e-06
1. PB	C5PFX0	Nuclear distribution protein PAC1	4.09e-13	2.99e-06	4.68e-11
1. PB	Q2KID6	Pleiotropic regulator 1	3.24e-12	1.50e-02	1.39e-12
1. PB	O14435	Guanine nucleotide-binding protein subunit beta	1.03e-14	5.64e-11	3.76e-05
1. PB	P38123	COMPASS component SWD3	0.00e+00	1.02e-03	5.74e-04
1. PB	Q7KWL3	DDB1- and CUL4-associated factor 13	0.00e+00	1.15e-05	5.89e-05
1. PB	P53196	26S proteasome regulatory subunit RPN14	5.65e-12	3.71e-15	3.86e-08
1. PB	Q6NX08	Ribosome biogenesis protein wdr12	4.97e-13	1.30e-03	1.39e-07
1. PB	Q80ZD0	Guanine nucleotide-binding protein subunit beta-5	1.11e-16	1.12e-09	9.39e-08
1. PB	O43660	Pleiotropic regulator 1	1.76e-12	1.89e-03	1.38e-12
1. PB	B4P6P9	Lissencephaly-1 homolog	0.00e+00	1.99e-03	1.41e-12
1. PB	B3S4I5	Lissencephaly-1 homolog	0.00e+00	5.91e-03	2.73e-14
1. PB	Q4P9P9	Nuclear distribution protein PAC1	1.11e-16	3.94e-04	8.23e-14
1. PB	P25387	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	4.97e-07	1.36e-13
1. PB	P79147	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	1.11e-16	4.60e-11	3.34e-08
1. PB	B4LQ21	Lissencephaly-1 homolog	0.00e+00	5.80e-04	2.37e-12
1. PB	Q8NA23	WD repeat-containing protein 31	0	2.75e-148	0.0
1. PB	B3MJV8	Ribosome biogenesis protein WDR12 homolog	6.63e-13	2.01e-03	1.39e-07
1. PB	Q5XJS5	THO complex subunit 6 homolog	0.00e+00	3.67e-03	0.019
1. PB	B4KKN1	Ribosome biogenesis protein WDR12 homolog	5.57e-13	1.99e-03	8.58e-06
1. PB	B4JPT9	Ribosome biogenesis protein WDR12 homolog	5.07e-13	1.53e-02	4.48e-08
1. PB	Q2UGU1	Nuclear distribution protein nudF	0.00e+00	2.68e-06	6.04e-10
1. PB	Q25306	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	2.25e-03	7.29e-09
1. PB	Q6P5M2	WD repeat-containing protein 61	0.00e+00	1.35e-03	4.50e-07
1. PB	Q7S7N3	Histone acetyltransferase type B subunit 2	5.55e-16	2.17e-05	2.93e-05
1. PB	Q9Y2I8	WD repeat-containing protein 37	1.05e-11	8.50e-04	2.05e-05
1. PB	Q9M2Z2	COMPASS-like H3K4 histone methylase component WDR5A	3.33e-16	1.61e-06	6.20e-16
1. PB	B4HSL3	Lissencephaly-1 homolog	0.00e+00	3.71e-03	1.38e-12
1. PB	Q803X4	DDB1- and CUL4-associated factor 13	1.12e-12	7.02e-04	0.004
1. PB	P63243	Receptor of activated protein C kinase 1	0.00e+00	3.00e-05	6.70e-15
1. PB	P63005	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	2.34e-04	8.73e-13
1. PB	O13615	Pre-mRNA-splicing factor prp5	8.55e-15	3.00e-05	7.50e-11
1. PB	P93340	Guanine nucleotide-binding protein subunit beta-like protein	2.00e-15	7.62e-05	1.35e-14
1. PB	Q5RF92	Histone-binding protein RBBP4	5.55e-16	4.28e-03	2.40e-05
1. PB	Q16576	Histone-binding protein RBBP7	2.22e-16	1.35e-04	4.84e-05
1. PB	P42841	Polyadenylation factor subunit 2	1.47e-11	1.01e-09	2.85e-05
1. PB	Q5E9I7	Methylosome protein 50	8.88e-16	1.91e-07	9.95e-08
1. PB	D4AZ50	Nuclear distribution protein PAC1	0.00e+00	5.12e-06	7.51e-10
1. PB	Q3KQ62	WD repeat domain-containing protein 83	0.00e+00	2.49e-11	6.38e-05
1. PB	Q5R650	WD repeat-containing protein 37	0.00e+00	1.39e-03	1.77e-05
1. PB	D1ZEB4	Nuclear distribution protein PAC1-1	0.00e+00	5.15e-04	2.48e-13
1. PB	B4P116	Ribosome biogenesis protein WDR12 homolog	5.52e-13	5.49e-04	2.12e-08
1. PB	B8N9H4	Nuclear distribution protein nudF	0.00e+00	2.68e-06	6.04e-10
1. PB	Q5JTN6	WD repeat-containing protein 38	1.22e-15	1.93e-07	2.45e-17
1. PB	Q9Z1Z2	Serine-threonine kinase receptor-associated protein	0.00e+00	2.83e-02	6.68e-05
1. PB	P62879	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	1.52e-12	1.80e-08
1. PB	Q6NV31	WD repeat-containing protein 82	0.00e+00	2.66e-04	2.86e-05
1. PB	O14021	RbAp48-related WD40 repeat-containing protein prw1	1.11e-16	6.51e-05	0.023
1. PB	Q6CP71	Polyadenylation factor subunit 2	1.62e-11	5.64e-11	6.81e-06
1. PB	Q9BQ67	Glutamate-rich WD repeat-containing protein 1	1.19e-10	4.23e-02	2.55e-04
1. PB	Q5E9I8	DDB1- and CUL4-associated factor 11	8.08e-10	3.60e-02	7.05e-06
1. PB	O22468	WD-40 repeat-containing protein MSI2	0.00e+00	4.99e-04	8.15e-06
1. PB	O42249	Guanine nucleotide-binding protein subunit beta-2-like 1	0.00e+00	4.83e-06	6.45e-15
1. PB	P68040	Receptor of activated protein C kinase 1	0.00e+00	3.00e-05	6.70e-15
1. PB	D3TLL6	Lissencephaly-1 homolog	0.00e+00	2.61e-04	7.59e-14
1. PB	A1CUD6	Nuclear distribution protein nudF 1	0.00e+00	1.13e-04	2.28e-14
1. PB	Q9Y6I7	WD repeat and SOCS box-containing protein 1	3.56e-13	1.29e-02	2.75e-08
1. PB	Q9WUC8	Pleiotropic regulator 1	2.03e-11	1.53e-03	1.37e-12
1. PB	P74598	Uncharacterized WD repeat-containing protein sll1491	9.99e-16	4.51e-02	5.27e-08
1. PB	P93397	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	1.21e-10	0.003
1. PB	Q6PH57	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	1.33e-12	9.59e-10
1. PB	Q17BB0	Ribosome biogenesis protein WDR12 homolog	1.01e-14	3.46e-02	2.89e-07
1. PB	B0W517	Ribosome biogenesis protein WDR12 homolog	7.07e-13	3.81e-02	1.28e-07
1. PB	Q5RE95	WD repeat-containing protein 5B	8.66e-15	1.90e-13	1.41e-13
1. PB	Q9Y3F4	Serine-threonine kinase receptor-associated protein	0.00e+00	3.84e-02	4.95e-04
1. PB	O00628	Peroxisomal targeting signal 2 receptor	0.00e+00	3.08e-07	1.82e-11
1. PB	Q4V8C4	WD repeat-containing protein 5B	3.66e-15	3.52e-10	1.29e-13
1. PB	Q5RBZ2	Methylosome protein 50	2.22e-15	3.00e-08	3.65e-09
1. PB	P97865	Peroxisomal targeting signal 2 receptor	0.00e+00	4.02e-07	2.14e-10
1. PB	P33750	Protein SOF1	5.28e-12	9.96e-04	8.53e-05
1. PB	Q17N69	Lissencephaly-1 homolog	0.00e+00	4.43e-04	9.82e-15
1. PB	P29387	Guanine nucleotide-binding protein subunit beta-4	5.22e-15	2.94e-14	0.012
1. PB	Q54SD4	Probable histone-binding protein rbbD	1.11e-16	4.00e-08	1.33e-04
1. PB	P69103	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	3.05e-07	1.44e-12
1. PB	B7PS00	Lissencephaly-1 homolog	0.00e+00	3.49e-04	9.97e-12
1. PB	Q6C709	Pre-mRNA-splicing factor PRP46	5.38e-14	3.25e-05	1.91e-13
1. PB	Q5BIM8	DNA excision repair protein ERCC-8	0.00e+00	1.86e-08	2.25e-06
1. PB	P16520	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	1.11e-16	7.75e-12	1.09e-09
1. PB	P43034	Platelet-activating factor acetylhydrolase IB subunit beta	0.00e+00	4.20e-04	1.09e-12
1. PB	P11017	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	1.07e-14	1.52e-12	1.80e-08
1. PB	Q640J6	WD repeat-containing protein 82-A	0.00e+00	1.91e-05	0.011
1. PB	Q6NVS5	DDB1- and CUL4-associated factor 13	9.33e-13	1.20e-05	0.013
1. PB	B3MEY6	Lissencephaly-1 homolog	0.00e+00	1.34e-03	6.66e-13
1. PB	Q9JJA4	Ribosome biogenesis protein WDR12	6.39e-13	1.83e-03	5.75e-08
1. PB	Q00664	Nuclear distribution protein nudF	0.00e+00	7.88e-05	6.61e-08
1. PB	Q4RJN5	Lissencephaly-1 homolog	0.00e+00	7.04e-05	2.19e-13
1. PB	Q7YR70	Angio-associated migratory cell protein	6.75e-12	2.88e-03	0.015
1. PB	O45040	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	7.54e-13	7.13e-08
1. PB	B2B766	Nuclear distribution protein PAC1-2	0.00e+00	4.13e-06	3.92e-11
2. P	Q0IF90	WD repeat-containing protein 55 homolog	1.94e-11	3.29e-08	NA
2. P	Q32LB0	WD repeat-containing protein 70	2.03e-08	5.18e-03	NA
2. P	Q5ZJL7	DNA damage-binding protein 2	3.90e-09	6.96e-05	NA
2. P	P0DOB8	Protein cortex	1.19e-11	2.18e-03	NA
2. P	Q5R4T8	DDB1- and CUL4-associated factor 13	8.27e-13	2.84e-04	NA
2. P	Q9WVA3	Mitotic checkpoint protein BUB3	0.00e+00	2.44e-04	NA
2. P	Q9H6Y2	WD repeat-containing protein 55	5.90e-14	1.49e-04	NA
2. P	Q5RB58	Mitotic checkpoint protein BUB3	0.00e+00	5.26e-04	NA
2. P	Q63ZP7	DDB1- and CUL4-associated factor 12-A	2.74e-09	5.92e-07	NA
2. P	Q8X9X2	Uncharacterized protein YncE	7.11e-15	2.41e-02	NA
2. P	A9VDW7	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	4.25e-10	1.38e-03	NA
2. P	Q9XWH0	Mitotic checkpoint protein bub-3	0.00e+00	7.53e-05	NA
2. P	Q9Y825	Uncharacterized WD repeat-containing protein C25H1.06	3.33e-16	2.40e-08	NA
2. P	P18754	Regulator of chromosome condensation	1.05e-04	3.18e-02	NA
2. P	Q6GPP0	WD repeat-containing protein 70	4.30e-09	2.17e-02	NA
2. P	A4QNE6	Dynein axonemal assembly factor 10	1.11e-16	2.55e-02	NA
2. P	Q5EB92	WD repeat-containing protein 70	2.48e-08	1.07e-02	NA
2. P	P39984	Histone acetyltransferase type B subunit 2	0.00e+00	2.99e-09	NA
2. P	O16519	Gastrulation defective protein 1	6.17e-09	8.78e-04	NA
2. P	P36104	COMPASS component SWD2	0.00e+00	2.21e-04	NA
2. P	P0C7V8	DDB1- and CUL4-associated factor 8-like protein 2	1.45e-09	1.65e-02	NA
2. P	Q9W1J3	Gastrulation defective protein 1 homolog	2.37e-08	2.49e-04	NA
2. P	Q2GXT0	Ribosome biogenesis protein YTM1	7.81e-11	1.90e-04	NA
2. P	Q9H977	WD repeat-containing protein 54	1.11e-16	1.75e-03	NA
2. P	Q6PAC3	DDB1- and CUL4-associated factor 13	9.31e-13	1.01e-05	NA
2. P	Q5VU92	DDB1- and CUL4-associated factor 12-like protein 1	8.94e-11	5.32e-11	NA
2. P	Q6CRJ7	Protein SWT21	2.75e-10	1.10e-04	NA
2. P	Q6C7Q4	Histone acetyltransferase type B subunit 2	2.31e-13	5.29e-03	NA
2. P	O16023	Polycomb protein esc	3.41e-11	1.65e-03	NA
2. P	Q6TNS2	p21-activated protein kinase-interacting protein 1-like	0.00e+00	3.12e-03	NA
2. P	P0CS56	DNA damage-binding protein CMR1	4.77e-08	1.84e-02	NA
2. P	B4N984	WD repeat-containing protein 55 homolog	5.33e-11	3.35e-04	NA
2. P	Q9UT73	Uncharacterized WD repeat-containing protein C343.17c	3.55e-08	2.74e-06	NA
2. P	Q6CU55	Nuclear distribution protein PAC1	0.00e+00	4.41e-03	NA
2. P	Q96MX6	Dynein axonemal assembly factor 10	5.55e-16	8.98e-03	NA
2. P	Q39221	SEC12-like protein 2	1.11e-16	2.01e-02	NA
2. P	Q6AX81	DDB1- and CUL4-associated factor 12-B	1.88e-09	3.20e-07	NA
2. P	Q9LJN8	Mitotic checkpoint protein BUB3.1	0.00e+00	3.00e-05	NA
2. P	B3M1G0	WD repeat-containing protein 55 homolog	1.23e-11	4.28e-05	NA
2. P	Q5ZK69	Proteasomal ATPase-associated factor 1	3.03e-13	3.21e-17	NA
2. P	A8XJ40	Protein SEC13 homolog	0.00e+00	2.22e-05	NA
2. P	Q9CWR1	WD repeat-containing protein 73	1.44e-15	4.58e-05	NA
2. P	Q09786	Uncharacterized WD repeat-containing protein C13G6.08	1.59e-09	4.35e-02	NA
2. P	O94319	Protein transport protein sec13	0.00e+00	8.46e-03	NA
2. P	Q5VW00	DDB1- and CUL4-associated factor 12-like protein 2	5.08e-09	8.61e-08	NA
2. P	Q86W42	THO complex subunit 6 homolog	0.00e+00	3.92e-09	NA
2. P	Q5ZLK1	DDB1- and CUL4-associated factor 13	1.08e-12	1.07e-03	NA
2. P	Q9Y4P3	Transducin beta-like protein 2	4.70e-10	5.70e-06	NA
2. P	Q8CBW4	DDB1- and CUL4-associated factor 12-like protein 1	4.51e-09	2.21e-08	NA
2. P	Q9VGE3	DDB1- and CUL4-associated factor 12 homolog	NA	4.60e-06	NA
2. P	B4KE10	WD repeat-containing protein 55 homolog	7.94e-11	3.03e-04	NA
2. P	Q08BB3	DDB1- and CUL4-associated factor 12	3.97e-11	2.00e-04	NA
2. P	F4K5R6	Cell division cycle 20.6, cofactor of APC complex	2.89e-10	1.02e-05	NA
2. P	A8PWQ8	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	7.88e-05	NA
2. P	O74763	Uncharacterized WD repeat-containing protein C17D11.08	1.93e-11	7.15e-06	NA
2. P	Q5FVP5	WD repeat-containing protein 89	1.11e-16	5.80e-04	NA
2. P	B4JSW8	WD repeat-containing protein 55 homolog	4.01e-11	1.20e-03	NA
2. P	Q84KJ3	DNA damage-binding protein 2	5.81e-08	8.06e-05	NA
2. P	Q5RF24	WD repeat-containing protein 13	5.31e-13	2.68e-03	NA
2. P	A1L3L9	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	2.26e-10	1.64e-02	NA
2. P	Q9LYK6	Protein ANTHESIS POMOTING FACTOR 1	0.00e+00	8.27e-07	NA
2. P	Q12021	Radiation-sensitive protein 28	1.53e-05	7.51e-09	NA
2. P	Q9C2I5	Ribosome biogenesis protein ytm1	1.21e-12	1.77e-03	NA
2. P	Q12024	Ribosome biogenesis protein YTM1	4.20e-12	2.60e-03	NA
2. P	Q5TAQ9	DDB1- and CUL4-associated factor 8	6.41e-09	3.53e-03	NA
2. P	C5DY07	Nuclear distribution protein PAC1	2.39e-13	4.41e-03	NA
2. P	Q5ZKH3	Polycomb protein EED	2.16e-11	1.76e-04	NA
2. P	Q9Y1C1	77 kDa echinoderm microtubule-associated protein (Fragment)	5.22e-08	2.55e-02	NA
2. P	Q22071	F-box/WD repeat-containing protein mec-15	0.00e+00	3.92e-02	NA
2. P	Q59RH5	Histone acetyltransferase type B subunit 2	5.20e-14	3.50e-07	NA
2. P	Q9UKT8	F-box/WD repeat-containing protein 2	2.60e-14	1.84e-02	NA
2. P	Q9R099	Transducin beta-like protein 2	6.49e-10	1.20e-05	NA
2. P	A2QI22	Ribosome biogenesis protein ytm1	1.09e-12	2.68e-02	NA
2. P	Q294Y7	WD repeat-containing protein 55 homolog	2.50e-11	1.27e-03	NA
2. P	O74865	Diphthine methyltransferase	0.00e+00	8.15e-04	NA
2. P	Q6AZS2	Polycomb protein eed-B	2.88e-11	2.14e-04	NA
2. P	Q552R1	DDB1- and CUL4-associated factor 7 homolog	0.00e+00	3.11e-05	NA
2. P	C5DTN0	Protein SWT21	1.76e-10	3.06e-03	NA
2. P	Q8NFH3	Nucleoporin Nup43	4.44e-16	7.02e-04	NA
2. P	Q8N7N5	DDB1- and CUL4-associated factor 8	9.16e-09	8.32e-04	NA
2. P	P36872	Protein phosphatase PP2A 55 kDa regulatory subunit	5.49e-09	1.31e-02	NA
2. P	Q6DKP5	WD repeat-containing protein 13	2.06e-11	4.11e-03	NA
2. P	O43684	Mitotic checkpoint protein BUB3	0.00e+00	3.27e-04	NA
2. P	Q567G2	WD repeat-containing protein 73	3.89e-15	6.25e-04	NA
2. P	A6NGE4	DDB1- and CUL4-associated factor 8-like protein 1	6.39e-11	1.91e-05	NA
2. P	Q944S2	WD repeat-containing protein GTS1	7.25e-13	2.23e-06	NA
2. P	Q6NL34	Telomerase Cajal body protein 1 homolog	2.95e-09	5.25e-05	NA
2. P	Q24338	Polycomb protein esc	5.42e-11	3.88e-02	NA
2. P	Q12363	Transcriptional modulator WTM1	1.23e-09	5.29e-03	NA
2. P	Q9D0R9	WD repeat-containing protein 89	1.11e-16	1.63e-03	NA
2. P	Q92466	DNA damage-binding protein 2	9.60e-13	7.06e-06	NA
2. P	Q3TWF6	WD repeat-containing protein 70	2.86e-08	1.23e-02	NA
2. P	Q09873	WD repeat-containing protein 21	2.30e-10	8.05e-03	NA
2. P	B3RNR8	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	1.87e-03	NA
2. P	Q6NWH1	DDB1- and CUL4-associated factor 10	4.74e-10	9.82e-03	NA
2. P	Q5UQX6	Uncharacterized protein R882	NA	1.63e-05	NA
2. P	Q9ZUN8	Protein HEAT STRESS TOLERANT DWD 1	5.36e-11	2.67e-05	NA
2. P	Q28I90	DDB1- and CUL4-associated factor 8	1.33e-09	5.56e-03	NA
2. P	P40055	U3 small nucleolar RNA-associated protein 7	2.11e-14	2.46e-02	NA
2. P	Q6BK34	Histone acetyltransferase type B subunit 2	2.69e-13	1.44e-07	NA
2. P	Q6NPN9	WD repeat-containing protein DWA2	0.00e+00	7.98e-04	NA
2. P	B4QTL6	WD repeat-containing protein 55 homolog	3.65e-10	2.12e-05	NA
2. P	Q5B4R1	Ribosome biogenesis protein ytm1	9.28e-11	3.22e-03	NA
2. P	Q8BGF3	Dynein axonemal assembly factor 10	2.22e-16	2.68e-03	NA
2. P	B1ANS9	WD repeat-containing protein 64	5.70e-05	1.50e-02	NA
2. P	Q9VIP8	Protein valois	1.61e-12	1.01e-05	NA
2. P	Q8NFH4	Nucleoporin Nup37	0.00e+00	1.29e-06	NA
2. P	Q759L2	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	3.63e-02	NA
2. P	Q566T0	Polycomb protein eed	3.38e-11	2.17e-02	NA
2. P	B5DHW4	WD repeat-containing protein on Y chromosome	1.93e-07	3.67e-02	NA
2. P	Q6FNI6	Protein SWT21	1.77e-08	1.72e-03	NA
2. P	Q6CU59	Ribosome biogenesis protein YTM1	1.95e-12	2.65e-03	NA
2. P	Q9URY0	Ribosome biogenesis protein ytm1	1.69e-12	4.69e-03	NA
2. P	A1CTE6	Probable catabolite repression protein creC	6.89e-06	1.48e-02	NA
2. P	Q04225	Ribosome assembly protein RRB1	2.36e-10	4.47e-02	NA
2. P	Q148I1	Proteasomal ATPase-associated factor 1	4.27e-14	4.85e-16	NA
2. P	Q0VBY8	DNA damage-binding protein 2	2.11e-12	1.06e-06	NA
2. P	B2B5V0	Ribosome biogenesis protein YTM1	7.91e-11	3.06e-02	NA
2. P	Q5ZMV7	WD repeat-containing protein 82	0.00e+00	4.43e-05	NA
2. P	Q8BGW4	DDB1- and CUL4-associated factor 12-like protein 2	2.63e-09	1.09e-08	NA
2. P	P20484	Protein MAK11	3.33e-10	3.21e-02	NA
2. P	A1Z8D0	Periodic tryptophan protein 1 homolog	5.02e-08	7.73e-04	NA
2. P	Q28DT7	Polycomb protein eed	3.14e-11	1.08e-04	NA
2. P	Q03010	Transcriptional regulatory protein UME1	4.43e-13	2.36e-02	NA
2. P	Q8T088	WD repeat-containing protein 55 homolog	5.59e-11	1.17e-04	NA
2. P	Q94AD8	F-box/WD-40 repeat-containing protein At5g21040	1.84e-09	6.80e-03	NA
2. P	Q2YDS1	DNA damage-binding protein 2	2.55e-11	5.49e-05	NA
2. P	Q6NQ88	Protein DAMAGED DNA-BINDING 2	3.65e-07	1.11e-08	NA
2. P	B4PU14	WD repeat-containing protein 55 homolog	6.03e-11	1.02e-03	NA
2. P	O59762	Guanine nucleotide-binding protein negative regulator 1	8.18e-12	2.53e-08	NA
2. P	Q58DT8	WD repeat-containing protein 55	4.21e-12	1.13e-03	NA
2. P	Q6ZJX0	Polycomb group protein FIE1	1.11e-16	7.85e-06	NA
2. P	B3P4F8	WD repeat-containing protein 55 homolog	6.54e-11	1.44e-04	NA
2. P	A6ZPA9	Ribosome biogenesis protein YTM1	2.94e-12	2.60e-03	NA
2. P	Q9S7H3	Cell division cycle 20.3, cofactor of APC complex	1.67e-11	1.41e-02	NA
2. P	Q9W351	Aladin	1.57e-12	3.84e-02	NA
2. P	P0CS57	DNA damage-binding protein CMR1	9.56e-08	1.84e-02	NA
2. P	B2RZ17	F-box/WD repeat-containing protein 2	2.11e-14	5.91e-03	NA
2. P	A6R3K5	Ribosome biogenesis protein YTM1	6.49e-13	2.52e-03	NA
2. P	Q5M7F6	Dynein axonemal assembly factor 10	2.22e-16	1.62e-02	NA
2. P	Q1JQB2	Mitotic checkpoint protein BUB3	0.00e+00	2.44e-04	NA
2. P	P59235	Nucleoporin Nup43	7.77e-16	5.21e-04	NA
2. P	Q6P809	DDB1- and CUL4-associated factor 12	2.04e-09	9.13e-07	NA
2. P	Q54QU5	WD repeat-containing protein 89 homolog	5.02e-14	4.24e-03	NA
2. P	Q9C701	Mitotic checkpoint protein BUB3.2	0.00e+00	9.16e-04	NA
2. P	Q5U2M6	DDB1- and CUL4-associated factor 8	1.12e-09	5.86e-04	NA
2. P	Q8GWR1	Aladin	4.25e-08	3.35e-03	NA
2. P	Q54E33	Dynein axonemal assembly factor 10	2.01e-13	4.07e-03	NA
2. P	Q6P4I2	WD repeat-containing protein 73	2.00e-15	3.81e-04	NA
2. P	Q9FFA7	WD repeat-containing protein RUP2	1.85e-10	1.72e-05	NA
2. P	Q6NRH1	DDB1- and CUL4-associated factor 8	5.06e-09	3.00e-03	NA
2. P	Q54DM1	Mitotic checkpoint protein bub3	0.00e+00	1.65e-06	NA
2. P	P50082	Meiosis-specific APC/C activator protein AMA1	2.33e-07	1.77e-02	NA
2. P	Q4R3J7	DDB1- and CUL4-associated factor 12	1.68e-09	4.68e-09	NA
2. P	Q38960	WD repeat-containing protein LWD2	5.14e-12	8.84e-06	NA
2. P	Q1Q0T4	Hydrazine synthase subunit beta	2.03e-12	1.48e-02	NA
2. P	Q8BGZ3	DDB1- and CUL4-associated factor 12	4.50e-09	2.68e-09	NA
2. P	Q5RBZ3	WD repeat-containing protein 89	1.11e-16	6.21e-03	NA
2. P	Q9CWU9	Nucleoporin Nup37	0.00e+00	7.31e-07	NA
2. P	Q4PGT8	DNA damage-binding protein CMR1	5.36e-11	1.24e-03	NA
2. P	Q3MHH0	DDB1- and CUL4-associated factor 12	1.60e-09	6.84e-09	NA
2. P	Q9NV06	DDB1- and CUL4-associated factor 13	6.73e-13	1.03e-04	NA
2. P	Q8ZPD6	Uncharacterized protein YncE	3.16e-14	3.00e-02	NA
2. P	Q5R448	DDB1- and CUL4-associated factor 8	1.56e-10	6.60e-03	NA
2. P	P0DOC0	Protein cortex	2.85e-10	4.94e-04	NA
2. P	Q99J79	DNA damage-binding protein 2	3.95e-10	8.45e-11	NA
2. P	Q960N3	Protein cortex	3.11e-10	1.99e-02	NA
2. P	Q6FKK3	Ribosome biogenesis protein YTM1	1.17e-11	1.94e-04	NA
2. P	Q5X521	Outer membrane protein assembly factor BamB	1.14e-09	1.96e-03	NA
2. P	P87229	Uncharacterized protein C4G3.03	1.40e-11	8.40e-10	NA
2. P	Q5U4D9	THO complex subunit 6 homolog	0.00e+00	9.26e-10	NA
2. P	Q9LPV9	WD repeat-containing protein LWD1	9.41e-14	9.12e-05	NA
2. P	A5DKC4	Ribosome biogenesis protein NSA1	3.94e-10	3.95e-02	NA
2. P	Q55C80	Diphthine methyltransferase homolog	0.00e+00	9.25e-04	NA
2. P	Q2UGK1	Ribosome biogenesis protein ytm1	8.49e-13	1.65e-02	NA
2. P	Q29RZ9	Dynein axonemal assembly factor 10	2.22e-16	7.22e-03	NA
2. P	Q96FK6	WD repeat-containing protein 89	2.22e-16	1.92e-03	NA
2. P	Q9YGY3	Mitotic checkpoint protein BUB3	0.00e+00	1.01e-03	NA
2. P	G0SFB5	Ribosome biogenesis protein YTM1	1.42e-10	2.34e-04	NA
2. P	O60136	Uncharacterized WD repeat-containing protein C18H10.05	1.36e-09	2.21e-06	NA
2. P	Q8UUP2	Polycomb protein eed-A	2.68e-11	5.92e-04	NA
2. P	Q5T6F0	DDB1- and CUL4-associated factor 12	3.59e-09	1.94e-08	NA
2. P	Q9LT47	Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM	2.95e-14	3.98e-06	NA
2. P	A8J3F6	Dynein axonemal assembly factor 10	0.00e+00	1.45e-02	NA
2. P	Q9R0D8	WD repeat-containing protein 54	1.11e-16	3.29e-03	NA
2. P	Q93ZG3	WD repeat-containing protein ATCSA-1	2.22e-16	1.11e-03	NA
2. P	Q66JG1	DNA damage-binding protein 2	9.50e-11	8.06e-05	NA
2. P	Q5F3R7	DDB1- and CUL4-associated factor 12	1.96e-08	3.01e-12	NA
2. P	A7ECP3	Ribosome biogenesis protein ytm1	6.96e-11	7.82e-03	NA
2. P	Q9XGN1	Protein TRANSPARENT TESTA GLABRA 1	5.64e-12	1.50e-05	NA
2. P	B4GMG4	WD repeat-containing protein 55 homolog	1.53e-11	1.19e-03	NA
2. P	Q8Z740	Uncharacterized protein YncE	3.44e-15	2.55e-02	NA
2. P	Q3SWZ7	Telomerase Cajal body protein 1	3.24e-09	4.33e-05	NA
2. P	Q4PSE4	Cell division cycle 20.4, cofactor of APC complex	3.24e-10	3.84e-02	NA
2. P	A0A1W2PR48	Transducin-like enhancer protein 7	6.95e-11	1.18e-04	NA
2. P	Q10990	Cell division cycle protein cdt2	5.10e-10	1.18e-06	NA
2. P	Q6CNC8	Protein DSE1	4.52e-08	1.02e-03	NA
2. P	Q9VBU8	Nucleoporin Nup37	0.00e+00	1.28e-02	NA
2. P	Q5R9T6	WD repeat-containing protein 55	5.67e-14	2.63e-04	NA
2. P	G0SEA3	mRNA export factor GLE2	1.07e-13	8.52e-05	NA
2. P	P42000	U3 small nucleolar RNA-associated protein 18 homolog	6.99e-15	2.29e-06	NA
2. P	A7TL79	Protein SWT21	3.48e-10	1.04e-02	NA
2. P	A9UP22	Ribosome biogenesis protein WDR12 homolog	2.26e-11	3.86e-05	NA
2. P	P35184	Ribosome assembly protein SQT1	3.27e-11	1.61e-03	NA
2. P	Q9USR0	DNA excision repair protein ckn1	0.00e+00	3.50e-07	NA
2. P	Q9H1Z4	WD repeat-containing protein 13	2.69e-11	4.64e-03	NA
2. P	P76116	Uncharacterized protein YncE	8.99e-15	2.39e-02	NA
2. P	Q58D00	F-box/WD repeat-containing protein 2	1.52e-14	8.46e-03	NA
2. P	P73595	Uncharacterized WD repeat-containing protein slr1410	3.00e-15	9.06e-04	NA
2. P	B4M4W4	WD repeat-containing protein 55 homolog	1.62e-11	2.84e-04	NA
2. P	Q91V09	WD repeat-containing protein 13	8.18e-11	7.66e-03	NA
2. P	P53851	Protein TEX1	1.11e-16	8.24e-05	NA
2. P	Q9CX97	WD repeat-containing protein 55	6.24e-14	2.22e-03	NA
2. P	Q3ZBK1	WD repeat-containing protein 89	1.11e-16	3.91e-03	NA
2. P	Q561Y0	Dynein axonemal assembly factor 10	3.33e-16	1.04e-04	NA
2. P	Q8VCH5	Rab9 effector protein with kelch motifs	3.80e-05	4.91e-02	NA
2. P	A1L112	WD repeat-containing protein 55	4.03e-14	6.11e-04	NA
2. P	Q6AY87	THO complex subunit 6 homolog	0.00e+00	4.94e-09	NA
2. P	Q0VA16	WD repeat-containing protein 70	6.91e-09	1.08e-02	NA
2. P	A6S0T8	Ribosome biogenesis protein ytm1	8.78e-11	3.15e-02	NA
2. P	P13712	Chromatin assembly factor 1 subunit p50	8.49e-13	1.19e-03	NA
2. P	B2ZZS9	WD repeat-containing protein 55	5.22e-12	9.01e-05	NA
3. B	G8SD34	NAD(+) hydrolase ApTIR	1.52e-13	NA	2.01e-09
3. B	Q09406	Autophagic-related protein 16.2	1.03e-12	NA	1.09e-05
3. B	Q7ZW33	U3 small nucleolar RNA-associated protein 15 homolog	1.59e-14	NA	3.86e-05
3. B	Q8YRI1	Uncharacterized WD repeat-containing protein alr3466	1.52e-06	NA	2.47e-20
3. B	Q5R664	Coatomer subunit beta'	8.29e-14	NA	3.09e-10
3. B	O42469	Transducin-like enhancer protein 1	1.05e-08	NA	0.021
3. B	Q5RFQ4	WD repeat-containing protein 72	2.00e-05	NA	0.001
3. B	Q9W7F2	WD repeat-containing protein 1-A	6.01e-09	NA	2.76e-04
3. B	A4RDD7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.63e-05
3. B	B0BNA7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.003
3. B	Q29HG9	Protein LST8 homolog	0.00e+00	NA	0.008
3. B	A2R3Z3	Mitochondrial division protein 1	1.44e-08	NA	7.81e-04
3. B	Q8SRK1	Histone acetyltransferase type B subunit 2	0.00e+00	NA	3.30e-05
3. B	O43172	U4/U6 small nuclear ribonucleoprotein Prp4	0.00e+00	NA	4.37e-07
3. B	Q13033	Striatin-3	3.99e-08	NA	0.016
3. B	P87177	Uncharacterized WD repeat-containing protein C3D6.12	3.21e-07	NA	2.08e-05
3. B	Q4WP10	Ribosome biogenesis protein ytm1	9.63e-11	NA	0.013
3. B	O89053	Coronin-1A	3.48e-10	NA	0.008
3. B	A8XL02	Ribosome biogenesis protein WDR12 homolog	6.30e-12	NA	5.08e-06
3. B	O74855	Ribosome assembly protein 4	6.85e-11	NA	9.59e-13
3. B	O43815	Striatin	2.70e-09	NA	1.60e-04
3. B	P74442	Uncharacterized WD repeat-containing protein slr0143	5.00e-07	NA	8.03e-12
3. B	Q2GTM8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.09e-07
3. B	Q9C827	Coatomer subunit beta'-2	1.25e-13	NA	6.44e-13
3. B	Q6P0D9	Probable cytosolic iron-sulfur protein assembly protein ciao1	0.00e+00	NA	0.002
3. B	Q1DIW7	Mitochondrial division protein 1	3.95e-08	NA	0.002
3. B	Q6FWT9	Nuclear distribution protein PAC1	1.43e-13	NA	0.005
3. B	Q7RXH4	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.75e-05
3. B	P0CS32	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.004
3. B	P35606	Coatomer subunit beta'	8.29e-14	NA	3.32e-10
3. B	Q4IBR4	Protein HIR1	4.06e-11	NA	7.85e-05
3. B	B4MY77	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	1.57e-05
3. B	Q3MHE2	U4/U6 small nuclear ribonucleoprotein Prp4	0.00e+00	NA	3.06e-07
3. B	Q92636	Protein FAN	3.27e-08	NA	0.042
3. B	Q2GVT8	Protein transport protein SEC31	5.62e-08	NA	0.013
3. B	Q12788	Transducin beta-like protein 3	5.01e-11	NA	4.29e-07
3. B	Q7T0P4	POC1 centriolar protein homolog A	0.00e+00	NA	3.10e-18
3. B	C5FP68	Probable E3 ubiquitin ligase complex SCF subunit sconB	6.90e-12	NA	5.73e-07
3. B	Q5RHH4	Intraflagellar transport protein 172 homolog	7.42e-06	NA	0.032
3. B	Q5XGE2	U3 small nucleolar RNA-associated protein 15 homolog	1.77e-12	NA	4.45e-04
3. B	Q86HX1	Protein HIRA	3.43e-11	NA	3.00e-07
3. B	Q9BVC4	Target of rapamycin complex subunit LST8	0.00e+00	NA	0.035
3. B	Q7SYD5	Protein transport protein Sec31A	3.58e-05	NA	0.026
3. B	P91343	Ribosome biogenesis protein WDR12 homolog	6.26e-12	NA	6.74e-06
3. B	Q32LN7	WD repeat-containing protein 61	0.00e+00	NA	0.001
3. B	P41318	Target of rapamycin complex subunit LST8	0.00e+00	NA	8.70e-05
3. B	P47025	Mitochondrial division protein 1	5.93e-09	NA	2.31e-06
3. B	P40217	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.016
3. B	Q9UTC7	Uncharacterized WD repeat-containing protein C227.12	0.00e+00	NA	5.02e-14
3. B	Q9NWT1	p21-activated protein kinase-interacting protein 1	2.76e-12	NA	2.36e-04
3. B	Q8SQS4	Transcription initiation factor TFIID subunit 5	3.20e-13	NA	2.03e-09
3. B	Q61FW2	F-box/WD repeat-containing protein sel-10	6.11e-11	NA	3.76e-09
3. B	P49846	Transcription initiation factor TFIID subunit 5	4.43e-09	NA	3.59e-11
3. B	P39014	F-box protein MET30	1.07e-12	NA	4.11e-06
3. B	Q5FW06	DDB1- and CUL4-associated factor 10	1.69e-10	NA	0.042
3. B	Q9P7I3	Mitochondrial division protein 1	3.41e-10	NA	7.05e-09
3. B	Q9R1K5	Fizzy-related protein homolog	1.97e-11	NA	2.04e-07
3. B	Q8NHY2	E3 ubiquitin-protein ligase COP1	2.05e-14	NA	0.004
3. B	Q8YV57	Uncharacterized WD repeat-containing protein all2124	2.96e-08	NA	8.90e-20
3. B	Q4I7X1	Polyadenylation factor subunit 2	3.83e-10	NA	1.03e-04
3. B	Q6CB13	Mitochondrial division protein 1	2.06e-11	NA	4.02e-04
3. B	Q9P775	Uncharacterized WD repeat-containing protein C17D11.16	6.24e-09	NA	4.41e-04
3. B	Q6CI08	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	6.21e-04
3. B	Q17GR9	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	4.76e-06
3. B	Q9UM11	Fizzy-related protein homolog	2.04e-11	NA	2.38e-07
3. B	Q4X0M4	Protein transport protein sec31	1.82e-05	NA	2.02e-04
3. B	Q499N3	WD repeat-containing protein 18	1.18e-14	NA	0.020
3. B	Q80ZK9	WD and tetratricopeptide repeats protein 1	5.01e-08	NA	0.048
3. B	A3LNI7	Nuclear distribution protein PAC1	1.13e-12	NA	0.008
3. B	O43071	Pre-mRNA-processing factor 17	1.06e-10	NA	0.022
3. B	Q4P6E2	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.001
3. B	Q8TC44	POC1 centriolar protein homolog B	0.00e+00	NA	8.13e-13
3. B	Q6ZS30	Neurobeachin-like protein 1	7.26e-03	NA	0.022
3. B	E7FEV0	WD repeat-containing protein 81	6.13e-04	NA	0.040
3. B	P16371	Protein groucho	1.45e-09	NA	5.03e-05
3. B	Q9D0I6	WD repeat, SAM and U-box domain-containing protein 1	0.00e+00	NA	5.15e-04
3. B	P0CS38	Protein HIR1	3.49e-12	NA	7.19e-10
3. B	P25635	Periodic tryptophan protein 2	4.70e-08	NA	1.25e-07
3. B	Q9FKT5	THO complex subunit 3	0.00e+00	NA	2.56e-05
3. B	B7PY76	Ribosome biogenesis protein WDR12 homolog	2.87e-13	NA	3.15e-04
3. B	Q9D2V7	Coronin-7	3.66e-05	NA	0.016
3. B	Q54MZ3	Anaphase-promoting complex subunit cdc20	1.29e-09	NA	1.24e-05
3. B	Q9DC48	Pre-mRNA-processing factor 17	4.83e-13	NA	9.61e-06
3. B	Q23256	WD repeat-containing protein wdr-5.3	8.77e-15	NA	5.25e-11
3. B	B4GSH1	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.043
3. B	Q4R2Z6	WD repeat-containing protein 48	6.77e-10	NA	0.001
3. B	A6ZPA6	Nuclear distribution protein PAC1	3.16e-13	NA	0.025
3. B	C4YFX2	Transcriptional repressor TUP1	2.95e-13	NA	5.12e-20
3. B	Q6FVD3	Protein HIR1	6.83e-13	NA	4.09e-06
3. B	A8QB65	Ribosome biogenesis protein WDR12 homolog	2.86e-13	NA	5.90e-05
3. B	Q8YTC2	Uncharacterized WD repeat-containing protein alr2800	3.33e-15	NA	1.37e-21
3. B	Q9C270	Periodic tryptophan protein 2 homolog	8.91e-07	NA	9.85e-07
3. B	Q9DAW6	U4/U6 small nuclear ribonucleoprotein Prp4	0.00e+00	NA	4.32e-07
3. B	Q5R1S9	Chromatin assembly factor 1 subunit B	1.11e-15	NA	8.04e-06
3. B	Q54N86	F-box/WD repeat-containing protein A-like protein	8.03e-06	NA	0.001
3. B	O17468	Protein HIRA homolog	5.96e-11	NA	0.002
3. B	P07834	Cell division control protein 4	2.17e-12	NA	8.86e-04
3. B	Q6P1W0	Denticleless protein homolog	6.87e-08	NA	0.004
3. B	Q55E54	Coronin-B	2.59e-06	NA	0.002
3. B	Q8TED0	U3 small nucleolar RNA-associated protein 15 homolog	2.86e-12	NA	7.16e-05
3. B	Q9CAA0	Coatomer subunit beta'-1	9.80e-14	NA	2.61e-12
3. B	P0CS46	Polyadenylation factor subunit 2	8.79e-09	NA	3.76e-07
3. B	Q99973	Telomerase protein component 1	2.20e-04	NA	5.53e-06
3. B	P78706	Transcriptional repressor rco-1	4.41e-11	NA	1.73e-12
3. B	O75037	Kinesin-like protein KIF21B	2.55e-05	NA	0.002
3. B	Q94A40	Coatomer subunit alpha-1	1.92e-10	NA	4.44e-08
3. B	B3MC74	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	1.29e-05
3. B	Q6C553	Protein HIR1	4.97e-11	NA	1.34e-05
3. B	O13286	WD repeat-containing protein srw1	2.70e-09	NA	1.67e-04
3. B	Q6IA86	Elongator complex protein 2	4.06e-09	NA	6.23e-04
3. B	Q0J3D9	Coatomer subunit alpha-3	1.72e-10	NA	7.05e-06
3. B	Q4R4I8	Coatomer subunit beta'	6.76e-14	NA	2.90e-10
3. B	Q8TAF3	WD repeat-containing protein 48	1.58e-09	NA	6.45e-04
3. B	A5DL92	Ribosome biogenesis protein YTM1	3.22e-14	NA	0.003
3. B	Q4R4J2	Coronin-1A	3.71e-10	NA	0.018
3. B	O93277	WD repeat-containing protein 1	2.45e-09	NA	1.14e-05
3. B	Q9EPV5	Apoptotic protease-activating factor 1	4.43e-10	NA	2.74e-10
3. B	Q96P53	WD repeat and FYVE domain-containing protein 2	0.00e+00	NA	2.07e-05
3. B	Q7Z4S6	Kinesin-like protein KIF21A	2.50e-05	NA	3.42e-06
3. B	O13985	Uncharacterized WD repeat-containing protein C26H5.03	7.88e-15	NA	0.008
3. B	Q5ZKU8	p21-activated protein kinase-interacting protein 1-like	0.00e+00	NA	0.030
3. B	Q6NLV4	Flowering time control protein FY	2.92e-09	NA	5.71e-08
3. B	Q2TBS9	WD40 repeat-containing protein SMU1	5.06e-13	NA	1.47e-05
3. B	A7ETB3	Mitochondrial division protein 1	4.42e-10	NA	0.002
3. B	Q55FJ2	WD repeat-containing protein 91 homolog	1.94e-08	NA	0.010
3. B	A0A2R8RWN9	F-box and WD repeat domain-containing 11-B	1.08e-09	NA	1.01e-04
3. B	O13637	Protein transport protein sec31	5.84e-06	NA	0.002
3. B	Q01277	Probable E3 ubiquitin ligase complex SCF subunit scon-2	5.36e-09	NA	7.97e-07
3. B	Q6H8D5	Coatomer subunit beta'-2	8.80e-12	NA	5.45e-14
3. B	Q9VU68	Actin-interacting protein 1	1.70e-09	NA	0.002
3. B	Q86A97	EARP-interacting protein homolog	4.22e-15	NA	2.47e-05
3. B	Q6CJ50	Mitochondrial division protein 1	2.18e-11	NA	1.06e-05
3. B	O88879	Apoptotic protease-activating factor 1	2.22e-05	NA	3.57e-10
3. B	Q28I85	POC1 centriolar protein homolog A	0.00e+00	NA	3.48e-17
3. B	Q9AUR7	Coatomer subunit alpha-2	7.07e-11	NA	6.75e-06
3. B	P25382	Ribosome assembly protein 4	8.20e-11	NA	1.16e-09
3. B	Q5I0B9	Autophagy-related protein 16	8.83e-12	NA	1.16e-04
3. B	Q8BG40	Katanin p80 WD40 repeat-containing subunit B1	9.99e-16	NA	6.34e-10
3. B	F1MNN4	F-box/WD repeat-containing protein 7	7.60e-10	NA	1.04e-08
3. B	Q7RY68	Polyadenylation factor subunit 2	2.15e-09	NA	3.82e-07
3. B	Q54Y96	WD40 repeat-containing protein smu1	2.23e-13	NA	1.92e-04
3. B	O42478	Transducin-like enhancer protein 4	4.14e-09	NA	0.001
3. B	Q9UMS4	Pre-mRNA-processing factor 19	5.55e-16	NA	2.04e-13
3. B	P16649	General transcriptional corepressor TUP1	1.27e-11	NA	2.41e-13
3. B	Q6NNP0	Autophagy-related protein 16	2.79e-14	NA	8.22e-07
3. B	Q91WG4	Elongator complex protein 2	1.17e-08	NA	3.13e-04
3. B	Q9QZD9	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.003
3. B	Q55FR9	Coatomer subunit alpha	1.83e-11	NA	2.03e-09
3. B	Q96S15	GATOR complex protein WDR24	1.97e-10	NA	0.003
3. B	Q8RXA7	DENN domain and WD repeat-containing protein SCD1	4.89e-06	NA	5.72e-05
3. B	Q873A1	Protein transport protein sec31	1.15e-08	NA	3.05e-05
3. B	Q55DA2	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	0.001
3. B	O80990	Protein CIA1	8.66e-15	NA	0.002
3. B	O88466	Zinc finger protein 106	1.33e-04	NA	0.002
3. B	Q0CJD8	Mitochondrial division protein 1	5.33e-11	NA	0.003
3. B	Q09150	Meiotic recombination protein rec14	0.00e+00	NA	8.21e-05
3. B	Q04726	Transducin-like enhancer protein 3	2.27e-09	NA	0.004
3. B	Q9R1A8	E3 ubiquitin-protein ligase COP1	1.97e-08	NA	0.004
3. B	O60336	Mitogen-activated protein kinase-binding protein 1	1.78e-05	NA	0.032
3. B	P56094	General transcriptional corepressor TUP1	2.16e-10	NA	8.74e-17
3. B	Q91ZN1	Coronin-1A	4.68e-10	NA	0.008
3. B	Q9BQ87	F-box-like/WD repeat-containing protein TBL1Y	2.03e-10	NA	3.16e-09
3. B	A2CEH0	POC1 centriolar protein homolog B	0.00e+00	NA	1.00e-14
3. B	Q5ZJW8	Denticleless protein homolog	4.77e-12	NA	0.035
3. B	Q969X6	U3 small nucleolar RNA-associated protein 4 homolog	7.93e-09	NA	7.57e-04
3. B	Q9JIT3	Transducin-like enhancer protein 3	2.38e-08	NA	0.004
3. B	Q2GSJ9	Protein HIR1	7.67e-11	NA	0.004
3. B	Q5A7Q6	Nuclear distribution protein PAC1	9.65e-14	NA	0.028
3. B	Q8VBV4	F-box/WD repeat-containing protein 7	9.17e-10	NA	1.35e-08
3. B	P53622	Coatomer subunit alpha	1.06e-10	NA	1.42e-08
3. B	Q4X1Y0	Polyadenylation factor subunit 2	3.16e-11	NA	0.011
3. B	Q9FNZ2	Zinc finger CCCH domain-containing protein 48	5.29e-13	NA	2.15e-04
3. B	O14301	Uncharacterized WD repeat-containing protein C9G1.05	3.79e-12	NA	1.46e-06
3. B	Q08E38	Pre-mRNA-processing factor 19	3.10e-13	NA	2.36e-13
3. B	P0CS45	Mitochondrial division protein 1	3.81e-07	NA	0.004
3. B	Q9SZQ5	WD repeat-containing protein VIP3	0.00e+00	NA	2.39e-06
3. B	Q54YD8	Coatomer subunit beta'	1.07e-12	NA	6.45e-11
3. B	O60508	Pre-mRNA-processing factor 17	7.57e-13	NA	1.16e-05
3. B	Q4P2B6	Protein transport protein SEC31	3.16e-04	NA	7.01e-04
3. B	Q54RP0	UDP-galactose:fucoside alpha-3-galactosyltransferase	6.52e-10	NA	9.33e-07
3. B	Q9M0E5	Serine/threonine-protein kinase VPS15	2.59e-03	NA	0.003
3. B	Q4X0A9	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.50e-09	NA	6.24e-09
3. B	Q8VEJ4	Notchless protein homolog 1	1.67e-10	NA	3.20e-10
3. B	B4N0L0	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.008
3. B	Q99KP6	Pre-mRNA-processing factor 19	8.36e-14	NA	7.19e-14
3. B	Q54KM3	Anaphase-promoting complex subunit cdh1	1.83e-07	NA	1.52e-05
3. B	O75529	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	9.52e-11	NA	8.78e-14
3. B	Q27954	Coatomer subunit alpha	1.39e-10	NA	6.86e-07
3. B	A8QBF3	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.014
3. B	Q5RAW8	WD repeat-containing protein 48	1.62e-09	NA	0.001
3. B	Q8WWQ0	PH-interacting protein	7.71e-04	NA	0.021
3. B	Q4PHV3	Pre-rRNA-processing protein IPI3	3.18e-07	NA	7.39e-04
3. B	Q75C26	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	0.004
3. B	Q5XIG8	Serine-threonine kinase receptor-associated protein	0.00e+00	NA	2.63e-04
3. B	B6K1G6	Probable cytosolic Fe-S cluster assembly factor SJAG_02895	2.01e-11	NA	5.98e-04
3. B	Q6GM65	Phospholipase A-2-activating protein	8.55e-09	NA	6.36e-06
3. B	Q8H594	Ribosome biogenesis protein WDR12 homolog	2.89e-14	NA	8.90e-08
3. B	A6ZMK5	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.016
3. B	Q9JKU3	Intraflagellar transport protein 172 homolog	9.65e-06	NA	0.004
3. B	Q22830	Intraflagellar transport protein osm-1	4.87e-06	NA	7.62e-04
3. B	Q9FNN2	WD repeat-containing protein 26 homolog	2.21e-10	NA	4.91e-04
3. B	A7RHG8	Ribosome biogenesis protein WDR12 homolog (Fragment)	2.72e-13	NA	6.49e-10
3. B	Q9NVX2	Notchless protein homolog 1	7.89e-11	NA	4.51e-11
3. B	Q6GPC6	F-box-like/WD repeat-containing protein TBL1XR1-B	1.12e-12	NA	3.12e-07
3. B	Q9FN19	WD40 repeat-containing protein HOS15	1.79e-09	NA	5.61e-05
3. B	Q10NY2	Protein TPR3	8.21e-06	NA	2.29e-04
3. B	Q8L611	Protein transport protein SEC31 homolog B	4.12e-06	NA	0.002
3. B	F4KB17	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3	5.62e-14	NA	3.07e-09
3. B	B8M7Q5	Probable E3 ubiquitin ligase complex SCF subunit sconB	4.69e-10	NA	8.39e-08
3. B	B4HRQ6	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	1.12e-04
3. B	A7MB12	U3 small nucleolar RNA-associated protein 15 homolog	1.72e-12	NA	4.62e-04
3. B	Q6KAU8	Protein Atg16l2	7.60e-11	NA	3.34e-12
3. B	Q9DCE5	p21-activated protein kinase-interacting protein 1	0.00e+00	NA	0.002
3. B	Q8BHD1	POC1 centriolar protein homolog B	0.00e+00	NA	3.48e-13
3. B	Q7PS24	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	0.005
3. B	Q6FLI3	CCR4-associated factor 4 homolog	8.98e-12	NA	3.93e-07
3. B	Q28YY2	WD repeat-containing protein 48 homolog	2.28e-12	NA	4.85e-06
3. B	A5DVY3	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.015
3. B	A1CBP8	Mitochondrial division protein 1	3.48e-09	NA	0.005
3. B	Q2TZG4	Polyadenylation factor subunit 2	1.35e-09	NA	1.23e-04
3. B	O48847	Transcriptional corepressor LEUNIG_HOMOLOG	4.53e-09	NA	3.91e-10
3. B	F4IIK6	Non-functional target of rapamycin complex subunit LST8-2	0.00e+00	NA	0.001
3. B	Q8VZS9	Protein FIZZY-RELATED 1	1.40e-09	NA	3.01e-04
3. B	P39946	Nuclear distribution protein PAC1	2.88e-13	NA	0.025
3. B	A4RJV3	Mitochondrial division protein 1	5.91e-09	NA	5.28e-04
3. B	B0Y5V6	Ribosome biogenesis protein ytm1	6.71e-11	NA	0.013
3. B	P97452	Ribosome biogenesis protein BOP1	1.13e-07	NA	0.036
3. B	A7TH19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.008
3. B	Q29L19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.043
3. B	P79083	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	3.72e-04
3. B	Q5AZM3	Protein transport protein sec31	2.03e-05	NA	0.001
3. B	Q8VYZ5	Periodic tryptophan protein 2	8.40e-08	NA	3.78e-08
3. B	Q9SZA4	Cell division cycle 20.1, cofactor of APC complex	1.49e-10	NA	0.009
3. B	P54686	Actin-interacting protein 1	2.28e-08	NA	0.024
3. B	Q6S7B0	Transcription initiation factor TFIID subunit 5	8.57e-11	NA	1.17e-12
3. B	Q5ZMA2	Pre-mRNA-processing factor 19	2.02e-13	NA	8.42e-12
3. B	P58404	Striatin-4	9.76e-09	NA	1.67e-05
3. B	A8Q2R5	WD repeat-containing protein 48 homolog	7.76e-08	NA	0.029
3. B	C4Q0P6	Lissencephaly-1 homolog	0.00e+00	NA	1.50e-13
3. B	A8WSU9	Pre-rRNA-processing protein pro-1	1.83e-09	NA	0.010
3. B	Q04727	Transducin-like enhancer protein 4	3.62e-09	NA	0.002
3. B	P58405	Striatin-3	1.53e-10	NA	0.005
3. B	Q8TEQ6	Gem-associated protein 5	9.83e-05	NA	0.010
3. B	O22212	U4/U6 small nuclear ribonucleoprotein PRP4-like protein	0.00e+00	NA	3.72e-10
3. B	Q6PJI9	GATOR complex protein WDR59	3.13e-06	NA	0.004
3. B	Q68EI0	WD repeat-containing protein 18	1.54e-14	NA	2.18e-05
3. B	O82266	Protein SLOW WALKER 1	2.91e-12	NA	0.004
3. B	Q6BSL7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.006
3. B	Q6Q0C0	E3 ubiquitin-protein ligase TRAF7	2.20e-12	NA	1.04e-05
3. B	Q562E7	WD repeat-containing protein 81	2.46e-04	NA	0.002
3. B	A1D7I5	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.57e-05
3. B	U4PCM1	pre-mRNA 3' end processing protein pfs-2	5.55e-09	NA	6.39e-05
3. B	B0X2V9	WD repeat-containing protein 48 homolog	8.88e-16	NA	3.98e-07
3. B	Q8K4P0	pre-mRNA 3' end processing protein WDR33	1.10e-05	NA	2.03e-07
3. B	O89046	Coronin-1B	4.42e-10	NA	0.006
3. B	P57081	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	1.33e-15	NA	0.022
3. B	Q6BYU4	Protein HIR1	1.48e-11	NA	8.57e-06
3. B	Q2UFN8	Probable E3 ubiquitin ligase complex SCF subunit sconB	7.18e-09	NA	5.51e-08
3. B	Q8LPL5	Protein FIZZY-RELATED 3	9.59e-12	NA	2.89e-07
3. B	Q9Y263	Phospholipase A-2-activating protein	5.35e-12	NA	4.81e-05
3. B	A4RD35	Protein transport protein SEC31	6.73e-08	NA	0.004
3. B	Q58D20	Notchless protein homolog 1	1.15e-10	NA	2.08e-10
3. B	Q9ERG2	Striatin-3	3.48e-08	NA	0.004
3. B	O88342	WD repeat-containing protein 1	2.34e-09	NA	2.79e-08
3. B	Q09731	UBP9-binding protein bun107	6.83e-07	NA	4.87e-06
3. B	Q62440	Transducin-like enhancer protein 1	1.34e-11	NA	0.002
3. B	Q5ND34	WD repeat-containing protein 81	1.05e-03	NA	0.009
3. B	Q5U5D4	GATOR complex protein MIOS-A	3.44e-08	NA	0.010
3. B	Q0CY32	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.18e-09	NA	7.18e-08
3. B	Q4PCB8	Protein transport protein SEC13	3.33e-16	NA	0.023
3. B	Q28DW0	Probable cytosolic iron-sulfur protein assembly protein ciao1	0.00e+00	NA	0.020
3. B	Q07141	Transducin-like enhancer protein 4	5.71e-09	NA	0.001
3. B	Q8C092	Transcription initiation factor TFIID subunit 5	1.69e-08	NA	1.04e-11
3. B	Q9GZS3	WD repeat-containing protein 61	0.00e+00	NA	0.001
3. B	Q0USG2	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	0.002
3. B	Q12834	Cell division cycle protein 20 homolog	2.39e-12	NA	8.03e-05
3. B	Q5E959	Serine-threonine kinase receptor-associated protein	0.00e+00	NA	4.00e-04
3. B	Q9DCJ1	Target of rapamycin complex subunit LST8	0.00e+00	NA	0.006
3. B	A2RRU3	U3 small nucleolar RNA-associated protein 15 homolog	1.65e-12	NA	0.018
3. B	Q9Z2K5	Target of rapamycin complex subunit LST8	0.00e+00	NA	0.002
3. B	Q6GPU3	Denticleless protein homolog B	1.12e-08	NA	0.022
3. B	O22785	Pre-mRNA-processing factor 19 homolog 2	8.88e-15	NA	2.88e-09
3. B	Q9FLX9	Notchless protein homolog	1.27e-11	NA	3.30e-12
3. B	P53699	Cell division control protein 4	4.38e-13	NA	0.035
3. B	Q19124	Autophagic-related protein 16.1	8.48e-13	NA	0.006
3. B	Q5ZIU8	Katanin p80 WD40 repeat-containing subunit B1	3.33e-16	NA	6.36e-07
3. B	Q5EA99	p21-activated protein kinase-interacting protein 1	0.00e+00	NA	0.010
3. B	F4HTH8	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2	4.44e-11	NA	1.57e-07
3. B	Q13112	Chromatin assembly factor 1 subunit B	1.89e-15	NA	1.54e-04
3. B	P79987	Protein HIRA	4.54e-11	NA	0.032
3. B	Q7ZV55	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.002
3. B	Q9JMJ4	Pre-mRNA-processing factor 19	1.11e-16	NA	7.19e-14
3. B	P93107	Flagellar WD repeat-containing protein Pf20	1.28e-13	NA	1.51e-05
3. B	Q6ZQA0	Neurobeachin-like protein 2	NA	NA	0.018
3. B	Q04724	Transducin-like enhancer protein 1	2.73e-09	NA	0.002
3. B	Q5ZLG9	GATOR complex protein WDR59	3.97e-06	NA	0.005
3. B	O76734	General transcriptional corepressor tupA	2.66e-11	NA	3.88e-15
3. B	Q7ZXK9	Notchless protein homolog 1	1.64e-10	NA	4.21e-12
3. B	Q2TAY7	WD40 repeat-containing protein SMU1	3.65e-11	NA	1.47e-05
3. B	P0CS44	Mitochondrial division protein 1	2.47e-07	NA	0.004
3. B	Q5RAC9	Autophagy-related protein 16-1	1.20e-11	NA	0.005
3. B	D3Z902	F-box/WD repeat-containing protein 7	1.03e-09	NA	1.37e-08
3. B	O08653	Telomerase protein component 1	1.84e-04	NA	1.14e-08
3. B	Q9NRG9	Aladin	6.01e-12	NA	6.20e-04
3. B	Q6BRR2	Protein transport protein SEC31	1.14e-04	NA	6.85e-04
3. B	Q1LZ08	WD repeat-containing protein 48 homolog	2.52e-12	NA	1.83e-06
3. B	Q562C2	Ribosome biogenesis protein BOP1	2.30e-09	NA	0.040
3. B	P97412	Lysosomal-trafficking regulator	NA	NA	0.042
3. B	A7TNS8	CCR4-associated factor 4 homolog	3.07e-10	NA	0.002
3. B	Q09715	Transcriptional repressor tup11	5.70e-12	NA	1.88e-12
3. B	Q1HPW4	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	6.14e-04
3. B	B4GIU9	Ribosome biogenesis protein BOP1 homolog	4.85e-07	NA	0.049
3. B	Q7K1Y4	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	9.58e-05
3. B	Q5H7C0	Cell division cycle protein 20 homolog	5.43e-11	NA	1.90e-04
3. B	Q9LV35	Actin-interacting protein 1-2	2.51e-09	NA	4.83e-04
3. B	Q4R8H1	F-box-like/WD repeat-containing protein TBL1X	2.22e-12	NA	4.90e-08
3. B	Q7S8R5	Mitochondrial division protein 1	2.37e-08	NA	0.008
3. B	Q9LV27	Target of rapamycin complex subunit LST8-1	0.00e+00	NA	5.72e-06
3. B	Q9FND4	WD repeat-containing protein WDS homolog	2.13e-11	NA	7.67e-06
3. B	D4AM37	Probable E3 ubiquitin ligase complex SCF subunit sconB	3.82e-12	NA	5.92e-08
3. B	Q0V320	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	3.29e-04
3. B	Q64LD2	WD repeat-containing protein 25	4.22e-15	NA	0.044
3. B	Q7SZM9	F-box-like/WD repeat-containing protein TBL1XR1-A	2.51e-10	NA	3.55e-07
3. B	O55106	Striatin	6.40e-09	NA	0.001
3. B	Q08122	Transducin-like enhancer protein 3	2.57e-11	NA	0.004
3. B	Q62441	Transducin-like enhancer protein 4	7.60e-09	NA	0.002
3. B	Q06078	U3 small nucleolar RNA-associated protein 21	1.99e-08	NA	2.65e-04
3. B	P26309	APC/C activator protein CDC20	5.55e-09	NA	0.002
3. B	Q759U7	Nuclear distribution protein PAC1	6.17e-14	NA	0.002
3. B	Q9UT57	Probable cytosolic Fe-S cluster assembly factor SPAC806.02c	0.00e+00	NA	0.003
3. B	Q5NVK4	Coronin-1B	5.57e-10	NA	0.009
3. B	Q7RZI0	Protein hir-1	3.64e-11	NA	3.90e-06
3. B	Q62623	Cell division cycle protein 20 homolog	9.45e-10	NA	6.61e-05
3. B	Q8VDD9	PH-interacting protein	1.38e-04	NA	0.024
3. B	Q9AV81	Pre-mRNA-processing factor 19	2.88e-13	NA	7.63e-09
3. B	Q5AZX0	Polyadenylation factor subunit 2	1.56e-10	NA	0.007
3. B	Q5REE0	U3 small nucleolar RNA-associated protein 15 homolog	3.54e-12	NA	0.003
3. B	Q92176	Coronin-1A	4.15e-10	NA	0.008
3. B	Q8C0M0	GATOR complex protein WDR59	1.26e-06	NA	0.002
3. B	P0CS39	Protein HIR1	3.19e-12	NA	7.19e-10
3. B	P87053	F-box/WD repeat-containing protein pof1	3.12e-09	NA	5.82e-07
3. B	P42527	Myosin heavy chain kinase A	1.35e-07	NA	8.48e-09
3. B	Q8BHB4	WD repeat-containing protein 3	5.65e-07	NA	1.48e-06
3. B	Q8C4J7	Transducin beta-like protein 3	4.90e-11	NA	5.64e-05
3. B	Q54JS5	GATOR complex protein WDR24	5.92e-12	NA	0.009
3. B	Q6ZMW3	Echinoderm microtubule-associated protein-like 6	2.67e-04	NA	0.004
3. B	Q9JJ66	Cell division cycle protein 20 homolog	6.61e-11	NA	1.90e-04
3. B	Q969H0	F-box/WD repeat-containing protein 7	8.59e-10	NA	9.46e-09
3. B	Q9W328	Protein LST8 homolog	0.00e+00	NA	3.89e-04
3. B	Q676U5	Autophagy-related protein 16-1	2.29e-10	NA	0.006
3. B	P78972	WD repeat-containing protein slp1	7.61e-11	NA	0.033
3. B	O13166	Transducin-like enhancer protein 3-A	1.43e-09	NA	0.006
3. B	A0A2R8QFQ6	F-box and WD repeat domain-containing 11-A	1.26e-09	NA	1.76e-05
3. B	Q652L2	Protein HIRA	2.74e-12	NA	1.24e-05
3. B	B8NGT5	Probable E3 ubiquitin ligase complex SCF subunit sconB	2.65e-09	NA	6.02e-08
3. B	Q9EP82	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	2.22e-16	NA	0.030
3. B	P36130	CCR4-associated factor 4	9.72e-11	NA	8.94e-06
3. B	Q9QXL2	Kinesin-like protein KIF21A	3.07e-06	NA	2.13e-04
3. B	Q6PFM9	WD repeat-containing protein 48	1.74e-09	NA	0.001
3. B	Q6DFF9	Mitogen-activated protein kinase-binding protein 1	3.81e-05	NA	0.031
3. B	Q9XW12	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	0.014
3. B	Q0DYP5	Zinc finger CCCH domain-containing protein 17	1.21e-10	NA	5.53e-08
3. B	Q9WUM3	Coronin-1B	9.39e-10	NA	0.008
3. B	Q1DX43	Protein transport protein SEC31	2.22e-05	NA	0.005
3. B	C7GWC1	Nuclear distribution protein PAC1	1.34e-13	NA	0.025
3. B	O13168	Transducin-like enhancer protein 3-B	2.16e-11	NA	0.006
3. B	Q7ZX22	GATOR complex protein WDR24	7.88e-15	NA	0.003
3. B	Q9I9H8	Apoptotic protease-activating factor 1	2.50e-06	NA	0.029
3. B	B4LJT7	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	0.002
3. B	Q9ZU34	Actin-interacting protein 1-1	1.02e-09	NA	7.28e-06
3. B	P38129	Transcription initiation factor TFIID subunit 5	7.27e-09	NA	3.14e-11
3. B	Q11176	Actin-interacting protein 1	1.36e-09	NA	0.010
3. B	Q8W117	Suppressor of mec-8 and unc-52 protein homolog 1	1.43e-11	NA	4.16e-05
3. B	Q8N1V2	Cilia- and flagella-associated protein 52	1.95e-12	NA	1.40e-04
3. B	P27133	Coronin-A	1.74e-10	NA	0.001
3. B	Q9SXY1	Chromatin assembly factor 1 subunit FAS2	0.00e+00	NA	1.65e-04
3. B	P0CY34	Transcriptional repressor TUP1	1.08e-13	NA	5.14e-20
3. B	B0XTS1	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.69e-08	NA	6.24e-09
3. B	O14170	WD repeat-containing protein pop2	2.12e-09	NA	5.11e-09
3. B	Q54R82	Mitogen-activated protein kinase kinase kinase A	8.33e-08	NA	2.75e-04
3. B	Q8CGF6	WD repeat-containing protein 47	2.31e-08	NA	0.001
3. B	Q7K4B3	Probable elongator complex protein 2	1.51e-08	NA	0.012
3. B	A6RUL1	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.86e-04
3. B	O14053	U3 small nucleolar RNA-associated protein 21 homolog	1.68e-09	NA	0.024
3. B	Q95JL5	Cilia- and flagella-associated protein 52	6.49e-09	NA	1.38e-04
3. B	O35142	Coatomer subunit beta'	6.38e-12	NA	2.43e-10
3. B	B7QKS1	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	2.21e-04
3. B	B4KTK4	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	0.003
3. B	E3LB80	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	3.76e-05
3. B	Q9QXE7	F-box-like/WD repeat-containing protein TBL1X	3.48e-10	NA	1.73e-09
3. B	P0CS47	Polyadenylation factor subunit 2	9.21e-09	NA	4.04e-07
3. B	Q920M5	Coronin-6	5.78e-10	NA	2.38e-07
3. B	Q9BZK7	F-box-like/WD repeat-containing protein TBL1XR1	1.87e-10	NA	3.09e-07
3. B	Q7ZXZ2	U3 small nucleolar RNA-associated protein 15 homolog	2.04e-12	NA	0.007
3. B	P90648	Myosin heavy chain kinase B	3.97e-11	NA	1.11e-06
3. B	Q5F201	Cilia- and flagella-associated protein 52	7.12e-11	NA	2.88e-04
3. B	G0SC29	Ribosome assembly protein 4	5.89e-13	NA	2.78e-10
3. B	Q54S59	WD repeat-containing protein 61 homolog	0.00e+00	NA	9.34e-07
3. B	Q54ZP5	WD repeat-containing protein 48 homolog	1.80e-03	NA	3.41e-05
3. B	Q5NVD0	U4/U6 small nuclear ribonucleoprotein Prp4	0.00e+00	NA	4.14e-07
3. B	Q05946	U3 small nucleolar RNA-associated protein 13	8.76e-11	NA	0.001
3. B	A0A1P8AW69	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1	2.35e-12	NA	9.60e-11
3. B	Q66J51	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.032
3. B	Q6CBI8	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	8.77e-05
3. B	Q91WQ5	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	8.28e-11	NA	3.22e-15
3. B	Q0CYG9	Protein transport protein sec31	3.49e-05	NA	4.58e-04
3. B	E9Q4P1	WD repeat and FYVE domain-containing protein 1	3.33e-16	NA	0.001
3. B	Q9UNX4	WD repeat-containing protein 3	8.64e-07	NA	7.90e-08
3. B	Q0UN56	Ribosome biogenesis protein ERB1	5.26e-07	NA	0.017
3. B	A5D7H2	Striatin-3	1.18e-08	NA	5.42e-04
3. B	B4J8H6	WD repeat-containing protein 48 homolog	1.69e-12	NA	3.44e-06
3. B	A7THX0	Mitochondrial division protein 1	2.67e-11	NA	7.06e-08
3. B	B3RQN1	Ribosome biogenesis protein WDR12 homolog	3.73e-13	NA	1.02e-04
3. B	Q26544	WD repeat-containing protein SL1-17	NA	NA	9.75e-06
3. B	O14186	Uncharacterized WD repeat-containing protein C4F8.11	4.15e-07	NA	0.001
3. B	Q9AUR8	Coatomer subunit alpha-1	7.83e-12	NA	8.18e-06
3. B	D4A929	WD repeat-containing protein 81	4.61e-04	NA	0.001
3. B	Q9C1X1	Periodic tryptophan protein 2 homolog	9.80e-09	NA	3.41e-06
3. B	Q8IV35	WD repeat-containing protein 49	8.01e-09	NA	0.019
3. B	Q8JZX3	POC1 centriolar protein homolog A	0.00e+00	NA	3.00e-17
3. B	Q9QXL1	Kinesin-like protein KIF21B	5.52e-05	NA	1.94e-04
3. B	Q4P8R5	Mitochondrial division protein 1	9.71e-07	NA	0.005
3. B	Q2KIY3	WD repeat and FYVE domain-containing protein 1	1.41e-11	NA	0.001
3. B	B0R0D7	Coronin-1C-A	7.04e-10	NA	7.26e-04
3. B	A6ZQL5	Mitochondrial division protein 1	1.71e-08	NA	2.06e-06
3. B	Q8NBT0	POC1 centriolar protein homolog A	0.00e+00	NA	1.33e-15
3. B	Q9BV38	WD repeat-containing protein 18	5.11e-15	NA	0.001
3. B	Q17QU5	Target of rapamycin complex subunit LST8	0.00e+00	NA	0.021
3. B	P49695	Probable serine/threonine-protein kinase PkwA	9.90e-12	NA	6.18e-17
3. B	Q95RJ9	F-box-like/WD repeat-containing protein ebi	6.35e-09	NA	5.42e-07
3. B	O74319	Transcription initiation factor TFIID subunit taf73	3.37e-11	NA	8.59e-12
3. B	P41811	Coatomer subunit beta'	7.98e-12	NA	3.47e-13
3. B	B4LUA5	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.032
3. B	Q3ULA2	F-box/WD repeat-containing protein 1A	5.39e-09	NA	1.15e-06
3. B	Q54MT0	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.001
3. B	Q8BUB4	WD repeat and FYVE domain-containing protein 2	5.55e-16	NA	4.14e-05
3. B	Q6BUA6	Nuclear distribution protein PAC1	1.50e-13	NA	0.029
3. B	Q05B17	WD repeat-containing protein 48	1.71e-09	NA	8.39e-05
3. B	Q3U3T8	WD repeat-containing protein 62	4.81e-05	NA	0.039
3. B	B4KRQ4	WD repeat-containing protein 48 homolog	2.90e-12	NA	8.81e-06
3. B	A7RM20	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.005
3. B	Q5DM57	Intraflagellar transport protein 172	5.65e-06	NA	0.016
3. B	F1M5N7	Kinesin-like protein KIF21B	1.61e-04	NA	3.88e-04
3. B	F6ZT52	POC1 centriolar protein homolog B	0.00e+00	NA	1.78e-14
3. B	Q9S7I8	Cell division cycle 20.2, cofactor of APC complex	3.47e-10	NA	0.008
3. B	Q76B40	WD40 repeat-containing protein SMU1	2.27e-11	NA	1.47e-05
3. B	Q9LJR3	Protein SPA1-RELATED 3	1.51e-09	NA	0.004
3. B	F4IH25	Ribosome biogenesis protein BOP1 homolog	3.39e-07	NA	0.026
3. B	Q5U2W5	Transducin beta-like protein 3	3.21e-10	NA	1.26e-07
3. B	F4IG73	BEACH domain-containing protein C2	NA	NA	0.013
3. B	Q32PG3	WD repeat-containing protein 48	1.49e-09	NA	3.32e-04
3. B	Q8C0J2	Autophagy-related protein 16-1	1.58e-11	NA	0.008
3. B	P35605	Coatomer subunit beta'	3.00e-12	NA	3.12e-10
3. B	Q00808	Vegetative incompatibility protein HET-E-1	8.44e-12	NA	3.95e-19
3. B	Q9VZF4	F-box/WD repeat-containing protein 7	9.51e-09	NA	8.66e-07
3. B	Q5ZJH5	WD repeat-containing protein 61	0.00e+00	NA	7.82e-04
3. B	A0AUS0	WD repeat, SAM and U-box domain-containing protein 1	0.00e+00	NA	1.72e-05
3. B	Q54K14	TSET complex member tstF	5.97e-04	NA	0.005
3. B	Q3UDP0	WD repeat-containing protein 41	7.76e-12	NA	4.95e-05
3. B	B4JW81	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	0.016
3. B	B3NSK1	WD repeat-containing protein 48 homolog	2.84e-12	NA	1.04e-05
3. B	Q496Z0	Elongator complex protein 2	8.14e-09	NA	2.79e-04
3. B	Q6NS57	Mitogen-activated protein kinase-binding protein 1	1.57e-05	NA	0.028
3. B	Q7ZVF0	POC1 centriolar protein homolog A	0.00e+00	NA	9.22e-16
3. B	Q8H0T9	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4	5.84e-14	NA	2.60e-08
3. B	Q0UXP3	Ribosome biogenesis protein YTM1	2.44e-11	NA	0.037
3. B	Q8IWB7	WD repeat and FYVE domain-containing protein 1	2.22e-16	NA	0.002
3. B	O75083	WD repeat-containing protein 1	5.28e-09	NA	6.37e-07
3. B	Q0U2T3	Mitochondrial division protein 1	8.23e-08	NA	2.51e-04
3. B	Q2UQ34	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.48e-05
3. B	C4YPI7	Nuclear distribution protein PAC1	9.63e-14	NA	0.028
3. B	Q4V7Y7	Katanin p80 WD40 repeat-containing subunit B1	1.44e-15	NA	7.37e-10
3. B	P87060	WD repeat-containing protein pop1	6.56e-12	NA	5.32e-07
3. B	A8XEN7	DDB1- and CUL4-associated factor 11 homolog	8.25e-11	NA	6.33e-06
3. B	Q7TNG5	Echinoderm microtubule-associated protein-like 2	7.36e-08	NA	0.026
3. B	B4HND9	WD repeat-containing protein 48 homolog	2.60e-12	NA	3.26e-06
3. B	Q8N0X2	Sperm-associated antigen 16 protein	2.03e-14	NA	8.27e-06
3. B	Q4P4R3	Protein HIR1	1.70e-11	NA	0.024
3. B	Q8BHJ5	F-box-like/WD repeat-containing protein TBL1XR1	1.62e-12	NA	2.91e-08
3. B	P54319	Phospholipase A-2-activating protein	5.50e-12	NA	1.47e-04
3. B	Q922B6	E3 ubiquitin-protein ligase TRAF7	1.28e-13	NA	1.60e-05
3. B	Q5EBD9	Elongator complex protein 2	4.57e-09	NA	1.80e-04
3. B	A8IZG4	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	8.54e-06
3. B	B3NQR5	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	3.96e-05
3. B	Q7ZVA0	WD40 repeat-containing protein SMU1	2.11e-11	NA	0.002
3. B	O60137	Set1 complex component swd2	6.66e-16	NA	0.002
3. B	Q8K450	Sperm-associated antigen 16 protein	6.05e-12	NA	3.33e-07
3. B	Q9USZ0	Uncharacterized WD repeat-containing protein C1306.02	1.52e-04	NA	0.017
3. B	Q0WV90	Topless-related protein 1	1.20e-06	NA	5.99e-06
3. B	Q54H44	WD repeat domain-containing protein 83 homolog	0.00e+00	NA	1.03e-07
3. B	A3GFK8	Protein transport protein SEC31	1.19e-04	NA	2.92e-06
3. B	P70483	Striatin	2.87e-09	NA	1.53e-04
3. B	Q5B8Y3	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	4.87e-05
3. B	Q9FNZ1	Zinc finger CCCH domain-containing protein 63	1.07e-10	NA	4.88e-06
3. B	Q6DIF4	WD repeat-containing protein 1	2.16e-09	NA	0.002
3. B	Q5F3K4	WD repeat-containing protein 48	2.00e-09	NA	0.002
3. B	Q9NZJ0	Denticleless protein homolog	9.52e-08	NA	0.012
3. B	Q4V7Z1	POC1 centriolar protein homolog B	0.00e+00	NA	3.67e-13
3. B	Q5SQM0	Echinoderm microtubule-associated protein-like 6	1.72e-03	NA	0.010
3. B	A0A1L8HX76	WD repeat-containing protein 18	4.11e-15	NA	1.43e-04
3. B	Q9BR76	Coronin-1B	5.20e-10	NA	0.010
3. B	Q15542	Transcription initiation factor TFIID subunit 5	1.67e-08	NA	9.12e-12
3. B	Q5S580	Protein transport protein SEC31	2.31e-05	NA	0.019
3. B	Q01369	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	6.10e-13
3. B	Q8N9V3	WD repeat, SAM and U-box domain-containing protein 1	0.00e+00	NA	0.004
3. B	Q6ZD63	Chromatin assembly factor 1 subunit FAS2 homolog	2.22e-16	NA	0.002
3. B	Q5RFF8	Notchless protein homolog 1	1.42e-10	NA	2.60e-11
3. B	B4GIJ0	WD repeat-containing protein 48 homolog	2.56e-12	NA	4.85e-06
3. B	Q5FVN8	WD repeat, SAM and U-box domain-containing protein 1	0.00e+00	NA	1.60e-05
3. B	Q5IH81	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.003
3. B	Q6QEF8	Coronin-6	5.23e-10	NA	6.28e-07
3. B	Q5ZMC3	WD repeat, SAM and U-box domain-containing protein 1	0.00e+00	NA	1.69e-04
3. B	Q54SF9	Myosin heavy chain kinase D	6.41e-09	NA	0.004
3. B	Q18964	WD repeat and FYVE domain-containing protein 2	7.08e-12	NA	2.05e-05
3. B	G5EES6	Ubiquitin fusion degradation protein 3 homolog	4.69e-07	NA	0.002
3. B	Q2UG43	Protein transport protein sec13	0.00e+00	NA	0.039
3. B	Q6H8D6	Putative coatomer subunit beta'-3	8.13e-14	NA	1.25e-14
3. B	Q96WV5	Putative coatomer subunit alpha	1.37e-10	NA	3.32e-12
3. B	Q9UKB1	F-box/WD repeat-containing protein 11	1.12e-09	NA	9.48e-06
3. B	Q54J37	Striatin homolog	1.05e-08	NA	0.018
3. B	P87314	Protein hir1	4.03e-12	NA	8.67e-04
3. B	Q9UG01	Intraflagellar transport protein 172 homolog	9.71e-06	NA	0.003
3. B	Q5F3D7	U3 small nucleolar RNA-associated protein 15 homolog	1.67e-12	NA	5.14e-04
3. B	Q68FJ6	p21-activated protein kinase-interacting protein 1-like	0.00e+00	NA	0.003
3. B	Q8BH57	WD repeat-containing protein 48	1.79e-09	NA	5.70e-04
3. B	B0XYC8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.43e-05
3. B	B9WD30	Nuclear distribution protein PAC1	2.31e-13	NA	0.024
3. B	Q27GK7	Topless-related protein 4	3.18e-05	NA	9.33e-05
3. B	Q12220	U3 small nucleolar RNA-associated protein 12	2.65e-14	NA	7.53e-07
3. B	Q8L3Z8	Protein FIZZY-RELATED 2	5.19e-08	NA	5.49e-06
3. B	Q5AXW3	Mitochondrial division protein 1	6.81e-09	NA	0.006
3. B	G5EEG7	Smu-1 suppressor of mec-8 and unc-52 protein	8.34e-14	NA	0.018
3. B	P90587	66 kDa stress protein	1.42e-09	NA	1.68e-05
3. B	A5DJX5	Nuclear distribution protein PAC1	8.34e-14	NA	0.006
3. B	Q0CXH9	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	8.20e-06
3. B	Q8MY12	Myosin heavy chain kinase C	9.32e-11	NA	0.002
3. B	O74184	Target of rapamycin complex subunit wat1	0.00e+00	NA	2.23e-11
3. B	A7EF03	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.32e-04
3. B	F4I9T0	BEACH domain-containing protein B	4.87e-02	NA	0.004
3. B	O55029	Coatomer subunit beta'	1.01e-13	NA	2.98e-10
3. B	A1C7E4	Probable E3 ubiquitin ligase complex SCF subunit sconB	4.32e-09	NA	4.44e-08
3. B	Q0V8F1	Coronin-7	3.76e-05	NA	0.049
3. B	P97499	Telomerase protein component 1	8.21e-04	NA	5.12e-07
3. B	Q8NI36	WD repeat-containing protein 36	6.93e-10	NA	6.26e-06
3. B	Q94BR4	Pre-mRNA-processing factor 19 homolog 1	7.47e-11	NA	6.63e-07
3. B	Q09990	F-box/WD repeat-containing protein lin-23	2.87e-09	NA	6.48e-06
3. B	Q5APF0	Ribosome biogenesis protein YTM1	5.11e-12	NA	0.022
3. B	B4QB64	WD repeat-containing protein 48 homolog	1.66e-12	NA	2.97e-06
3. B	Q3UKJ7	WD40 repeat-containing protein SMU1	3.02e-11	NA	1.47e-05
3. B	A3LX18	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.002
3. B	Q20168	Probable coatomer subunit beta'	5.21e-13	NA	3.91e-11
3. B	B6Q4Z5	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.62e-09	NA	1.03e-09
3. B	D4D8P3	Probable E3 ubiquitin ligase complex SCF subunit sconB	4.51e-12	NA	5.92e-08
3. B	Q6NRT3	WD40 repeat-containing protein SMU1	2.05e-11	NA	1.45e-05
3. B	Q9Y297	F-box/WD repeat-containing protein 1A	5.74e-09	NA	3.55e-06
3. B	Q3SZD4	WD repeat-containing protein 18	7.44e-15	NA	0.014
3. B	Q9NRL3	Striatin-4	2.23e-11	NA	5.67e-06
3. B	E9Q349	WD repeat-containing protein 25	2.02e-10	NA	0.032
3. B	Q38884	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	8.43e-05
3. B	Q1DHE1	Protein HIR1	6.48e-11	NA	0.046
3. B	O76071	Probable cytosolic iron-sulfur protein assembly protein CIAO1	0.00e+00	NA	0.001
3. B	Q10051	Pre-mRNA-processing factor 19	0.00e+00	NA	7.80e-17
3. B	A2QCU8	Probable E3 ubiquitin ligase complex SCF subunit sconB	2.53e-09	NA	6.03e-07
3. B	A7RWD2	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	1.57e-05
3. B	Q96KV7	WD repeat-containing protein 90	1.08e-05	NA	0.007
3. B	Q2KJJ5	Transducin beta-like protein 3	3.42e-11	NA	3.11e-07
3. B	Q10272	Pre-rRNA-processing protein crb3/ipi3	5.33e-15	NA	0.003
3. B	B4GDM7	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	8.53e-05
3. B	Q1DPU4	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.004
3. B	Q54D08	Protein LST8 homolog	0.00e+00	NA	5.05e-05
3. B	Q14137	Ribosome biogenesis protein BOP1	2.09e-09	NA	0.049
3. B	Q229Z6	POC1 centriolar protein homolog	4.02e-12	NA	4.06e-10
3. B	A1CXL0	Ribosome biogenesis protein ytm1	5.43e-11	NA	0.023
3. B	P0DPA1	WD repeat-containing protein DDB_G0349043	9.65e-11	NA	3.51e-06
3. B	Q9SJT9	Coatomer subunit alpha-2	1.90e-10	NA	1.23e-08
3. B	Q8BU03	Periodic tryptophan protein 2 homolog	1.37e-07	NA	1.46e-04
3. B	A1CJY4	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	7.40e-06
3. B	A1DHK2	Protein transport protein sec31	1.78e-05	NA	1.00e-04
3. B	Q99M63	WD40 repeat-containing protein SMU1	2.37e-11	NA	1.49e-05
3. B	Q9BVA0	Katanin p80 WD40 repeat-containing subunit B1	4.44e-16	NA	5.54e-10
3. B	O13282	Transcription initiation factor TFIID subunit 5	9.72e-11	NA	3.43e-08
3. B	Q13347	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.003
3. B	Q4WX90	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	1.43e-05
3. B	Q9XZ25	GATOR complex protein WDR24	9.53e-11	NA	7.13e-06
3. B	O94289	Ubiquitin homeostasis protein lub1	3.03e-12	NA	9.83e-05
3. B	O94365	U3 small nucleolar RNA-associated protein 15	1.18e-11	NA	0.006
3. B	Q3SZK1	Angio-associated migratory cell protein	1.57e-10	NA	0.003
3. B	B6GZA1	Probable E3 ubiquitin ligase complex SCF subunit sconB	1.06e-09	NA	4.80e-09
3. B	Q5RFQ3	Periodic tryptophan protein 2 homolog	2.46e-07	NA	1.17e-06
3. B	Q9D0N7	Chromatin assembly factor 1 subunit B	1.33e-15	NA	2.31e-06
3. B	Q9HAD4	WD repeat-containing protein 41	1.41e-11	NA	2.99e-05
3. B	Q9UUG8	Transcriptional repressor tup12	3.68e-10	NA	1.53e-11
3. B	Q20059	WD repeat-containing protein 48 homolog	1.50e-11	NA	0.006
3. B	A5DTX3	Protein transport protein SEC31	1.06e-05	NA	0.003
3. B	P53621	Coatomer subunit alpha	3.55e-11	NA	7.23e-07
3. B	B4MFM2	WD repeat-containing protein 48 homolog	2.12e-12	NA	5.74e-06
3. B	A4R2Q6	Ribosome biogenesis protein YTM1	8.75e-11	NA	0.020
3. B	Q9VU65	POC1 centriolar protein homolog	0.00e+00	NA	9.44e-13
3. B	Q9USN3	Probable U3 small nucleolar RNA-associated protein 13	1.97e-11	NA	5.66e-08
3. B	Q32SG6	Protein HIRA	9.41e-12	NA	2.70e-06
3. B	Q91854	Beta-TrCP	3.41e-11	NA	9.35e-06
3. B	Q7ZVL2	GATOR complex protein WDR24	1.20e-14	NA	7.25e-04
3. B	B5X212	Probable cytosolic iron-sulfur protein assembly protein ciao1-B	0.00e+00	NA	6.73e-06
3. B	B3MET8	WD repeat-containing protein 48 homolog	2.40e-12	NA	1.03e-05
3. B	Q9Y485	DmX-like protein 1	NA	NA	0.042
3. B	Q9LXN4	Protein HIRA	2.89e-11	NA	4.18e-06
3. B	Q6P4J8	WD40 repeat-containing protein SMU1	1.34e-11	NA	8.89e-05
3. B	P0CS33	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.004
3. B	Q6PAX7	WD repeat-containing protein 1-B	2.42e-09	NA	0.010
3. B	Q8CFJ9	GATOR complex protein WDR24	1.24e-14	NA	0.005
3. B	Q74ZN0	Protein HIR1	4.83e-13	NA	9.61e-06
3. B	Q5VQ78	Coatomer subunit beta'-1	3.75e-14	NA	5.89e-13
3. B	A6NE52	WD repeat-containing protein 97	3.00e-04	NA	0.006
3. B	B3LJT5	Nuclear distribution protein PAC1	1.14e-10	NA	0.024
3. B	O42937	Probable coatomer subunit beta'	2.92e-13	NA	1.21e-07
3. B	A3LQ86	Ribosome biogenesis protein YTM1	9.59e-12	NA	6.06e-05
3. B	Q3MJ13	WD repeat-containing protein 72	1.53e-05	NA	0.002
3. B	Q15269	Periodic tryptophan protein 2 homolog	2.59e-07	NA	4.69e-07
3. B	Q54S79	WD repeat-containing protein 3 homolog	1.45e-07	NA	1.50e-10
3. B	Q54PE0	Periodic tryptophan protein 2 homolog	5.36e-08	NA	3.84e-09
3. B	Q8IZU2	WD repeat-containing protein 17	2.69e-06	NA	1.09e-04
3. B	Q5ACW8	Protein HIR1	2.45e-12	NA	2.05e-04
3. B	Q99KN2	Probable cytosolic iron-sulfur protein assembly protein CIAO1	0.00e+00	NA	0.001
3. B	Q5NBT9	Protein TPR1	3.92e-06	NA	0.006
3. B	Q16MY0	WD repeat-containing protein 48 homolog	1.35e-12	NA	2.10e-05
3. B	Q9AYE4	Target of rapamycin complex subunit LST8	0.00e+00	NA	2.23e-08
3. B	P32479	Protein HIR1	5.65e-13	NA	9.53e-08
3. B	A1C6X5	Protein transport protein sec31	1.88e-05	NA	5.37e-04
3. B	Q292E8	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	9.08e-05
3. B	Q5R7R2	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.003
3. B	Q2UF60	Protein transport protein sec31	2.16e-05	NA	2.82e-04
3. B	Q09855	F-box/WD repeat-containing protein pof11	0.00e+00	NA	4.90e-10
3. B	A5DB75	Protein transport protein SEC31	1.10e-04	NA	0.002
3. B	Q9FUY2	Transcriptional corepressor LEUNIG	1.52e-08	NA	2.23e-04
3. B	A6ZYM0	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	3.16e-06
3. B	O60907	F-box-like/WD repeat-containing protein TBL1X	1.14e-09	NA	4.90e-08
3. B	Q5E966	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.002
3. B	Q8CIE6	Coatomer subunit alpha	1.35e-10	NA	6.12e-07
3. B	Q00659	Probable E3 ubiquitin ligase complex SCF subunit sconB	6.37e-09	NA	6.97e-10
3. B	Q9ERF3	WD repeat-containing protein 61	0.00e+00	NA	0.002
3. B	Q6NVM2	Katanin p80 WD40 repeat-containing subunit B1	3.33e-16	NA	2.88e-09
3. B	Q5M7T1	Probable cytosolic iron-sulfur protein assembly protein CIAO1	0.00e+00	NA	0.002
3. B	Q5RD06	POC1 centriolar protein homolog B	0.00e+00	NA	1.71e-12
3. B	E7FAW3	Neurobeachin-like protein 2	NA	NA	0.014
3. B	Q32PJ6	Probable cytosolic iron-sulfur protein assembly protein CIAO1	0.00e+00	NA	1.03e-05
3. B	Q55563	Uncharacterized WD repeat-containing protein sll0163	2.06e-05	NA	6.29e-12
3. B	Q7QJ33	Ribosome biogenesis protein WDR12 homolog	9.38e-13	NA	1.46e-10
3. B	Q6C705	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	0.00e+00	NA	0.022
3. B	B0XAF3	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	2.33e-05
3. B	Q2H139	Mitochondrial division protein 1	1.51e-10	NA	0.004
3. B	D3ZW91	POC1 centriolar protein homolog B	0.00e+00	NA	1.41e-13
3. B	O62621	Coatomer subunit beta'	1.06e-13	NA	2.64e-10
3. B	Q0UNC6	Protein HIR1	7.42e-10	NA	0.026
3. B	Q9H2Y7	Zinc finger protein 106	1.74e-04	NA	0.002
3. B	Q9C0J8	pre-mRNA 3' end processing protein WDR33	1.57e-05	NA	1.72e-07
3. B	A2QEV8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	2.43e-05
3. B	O62471	Protein qui-1	4.33e-07	NA	3.39e-07
3. B	Q6CMA2	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	NA	0.001
3. B	A6ZZZ8	CCR4-associated factor 4	2.88e-11	NA	2.62e-05
3. B	Q6VH22	Intraflagellar transport protein 172 homolog	9.16e-06	NA	0.004
3. B	A8ILK1	Cilia- and flagella-associated protein 52	1.86e-12	NA	5.93e-04
3. B	O94967	WD repeat-containing protein 47	1.51e-07	NA	8.95e-04
3. B	Q5RKI0	WD repeat-containing protein 1	2.50e-09	NA	2.87e-08
3. B	O61585	Katanin p80 WD40 repeat-containing subunit B1	1.22e-15	NA	1.50e-10
3. B	Q5AAU3	Protein transport protein SEC31	1.46e-04	NA	0.002
3. B	Q5EBE8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.005
3. B	Q5ZME8	WD40 repeat-containing protein SMU1	2.01e-11	NA	2.11e-05
3. B	Q2TBP4	POC1 centriolar protein homolog A	0.00e+00	NA	2.17e-16
3. B	Q5AI86	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.008
3. B	P42935	Elongator complex protein 2	1.35e-08	NA	0.040
3. B	P20053	U4/U6 small nuclear ribonucleoprotein PRP4	0.00e+00	NA	1.25e-06
3. B	A2QBZ0	Protein transport protein sec31	1.85e-05	NA	0.010
3. B	B5FZ19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.004
3. B	Q55DM1	BEACH domain-containing protein lvsA	NA	NA	2.48e-06
3. B	Q06440	Coronin-like protein	1.48e-08	NA	0.003
3. B	Q5SRY7	F-box/WD repeat-containing protein 11	9.07e-11	NA	6.10e-06
3. B	Q9VPR4	Protein Notchless	6.99e-12	NA	3.70e-09
3. B	Q6PBD6	WD repeat-containing protein 61	0.00e+00	NA	6.26e-06
3. B	Q8N5D0	WD and tetratricopeptide repeats protein 1	5.02e-08	NA	0.032
3. B	A8XXC7	WD repeat and FYVE domain-containing protein 2	7.47e-12	NA	1.42e-05
3. B	B4P7H8	WD repeat-containing protein 48 homolog	2.52e-12	NA	1.45e-05
3. B	Q7ZUV2	Katanin p80 WD40 repeat-containing subunit B1	3.00e-15	NA	6.45e-10
3. B	Q8C7V3	U3 small nucleolar RNA-associated protein 15 homolog	1.83e-12	NA	0.023
3. B	Q6CXX3	Protein HIR1	1.66e-12	NA	3.76e-07
3. B	B4QFZ8	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	9.16e-05
3. B	Q8R2N2	U3 small nucleolar RNA-associated protein 4 homolog	7.54e-09	NA	2.41e-04
3. B	Q758R7	Mitochondrial division protein 1	2.34e-08	NA	6.12e-07
3. B	B4JB43	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	NA	0.008
3. B	Q93794	F-box/WD repeat-containing protein sel-10	2.62e-09	NA	5.17e-10
3. B	Q8NAA4	Protein Atg16l2	3.00e-10	NA	4.82e-12
3. B	P27612	Phospholipase A-2-activating protein	4.85e-12	NA	5.10e-06
3. B	B4P7Q3	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	NA	8.23e-05
3. B	Q91VU6	DDB1- and CUL4-associated factor 11	6.66e-16	NA	2.11e-05
3. B	Q6FT96	Mitochondrial division protein 1	4.27e-09	NA	2.12e-04
3. B	Q9UT85	Uncharacterized WD repeat-containing protein C343.04c	2.96e-11	NA	2.53e-05
3. B	A8PTE4	Mitochondrial division protein 1	1.47e-12	NA	0.002
3. B	Q8L828	Coatomer subunit beta'-3	9.89e-14	NA	3.05e-13
3. B	Q920J3	Coronin-6	4.69e-10	NA	1.23e-07
3. B	B5X9P2	Probable cytosolic iron-sulfur protein assembly protein ciao1-A	0.00e+00	NA	1.18e-05
3. B	O15736	Protein tipD	1.26e-13	NA	7.75e-06
3. B	A1DHW6	Probable E3 ubiquitin ligase complex SCF subunit sconB	6.32e-08	NA	1.11e-08
3. B	O14727	Apoptotic protease-activating factor 1	2.15e-09	NA	8.79e-08
3. B	A7UWE6	ASTRA-associated protein 1	6.89e-09	NA	0.011
3. B	Q2KJH4	WD repeat-containing protein 1	3.96e-09	NA	1.65e-06