Summary

Q8NAV2

Homolog: Q5XHY8.
Function: Protein FAM217A.

Statistics

Total GO Annotation: 43
Unique PROST Go: 43
Unique BLAST Go: 0

Total Homologs: 26
Unique PROST Homologs: 24
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q5XHY8 (Protein FAM217A) with a FATCAT P-Value: 0.0237 and RMSD of 6.91 angstrom. The sequence alignment identity is 24.1%.
Structural alignment shown in left. Query protein Q8NAV2 colored as red in alignment, homolog Q5XHY8 colored as blue. Query protein Q8NAV2 is also shown in right top, homolog Q5XHY8 showed in right bottom. They are colored based on secondary structures. 

  Q8NAV2 MMGRRRAFAVDGRDGAGEGLARGCIV-PGVTSTYRRIPDAAHGCSSW--ERGDKFRGVGREALFLKLASRDSGVEMAVG-------DSPLAALPGLSQDS 90
  Q5XHY8 -MGRK----------SNE----SCSANPHSSS----I--SQENLSQWNLDAEDLFD--ENES-F--LSEKD-GV--AGGKTNKNHLESPAEQL--VLQLT 69

  Q8NAV2 LDFESSGSSEPPAQVG--RLLAS--QKLGEVLE-RSRRLP---TAPTSLSGQHR---SLRLAS--------KPE--REVPLG---AGQQESMEADTDLEA 166
  Q5XHY8 VS-EHAHSRSQNNNQGVFQLWSSPVNK-GSIIDKRNSSVEENVTDESDLSESEKMNDSL-LSYFKKMDLNLKPETIEHVERAFTEEANQVSVYADF-LPA 165

  Q8NAV2 -----GLEEEAVGGLGPGAW-ACL-PGQGLRYLEHLCL-VLEQMARLQQLYLQLRIQRPP------------GD-PGEEES-T---RAP-LP-SP-LHTP 238
  Q5XHY8 PFNTMDLHRFAFSKC--ESWKTTVDPPE--SSIERLIMRLLE-LERLQHMTIQ-R-ERPKLQSTFCSSMFSMAERPSSSKAITLKARPPKIPETPTLQTS 258

  Q8NAV2 G---NR-------GQG-P------WELLSQTEHTG---------AKAASPPKV------EVPSANPPR--L-P--ETPVEPTYHLPSSQGHKRDISHWDK 301
  Q5XHY8 SVDKNRDKRKNNSGSGKPEQNVPKWSL--ST--AGKSKSNSRSLLKCSSTSKQCAMAHDDV--KNPKNSILNPCQDPPPKPT---TTTQA----IQ--PM 343

  Q8NAV2 VKVLLNRIC--RRSHHHPEP--PAP---PDGSDPRIESRDLPE-RPQCRPHRKTFM---PSLVVKKQ-RAKNL-SVG-------- 365
  Q5XHY8 IKVVSTR-CLPPRS---PMPVSPIPLSFPE--NPR-EEVKVPRTKKKC--HRKSILQNRPFHVQKRNCLSPSLIARGKCSPTDQK 419

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:0010569 regulation of double-strand break repair via homologous recombination
2. P GO:0010387 COP9 signalosome assembly
2. P GO:0009630 gravitropism
2. P GO:0045786 negative regulation of cell cycle
2. P GO:0050862 positive regulation of T cell receptor signaling pathway
2. P GO:0060997 dendritic spine morphogenesis
2. P GO:2001022 positive regulation of response to DNA damage stimulus
2. P GO:0030331 estrogen receptor binding
2. P GO:1903251 multi-ciliated epithelial cell differentiation
2. P GO:0007346 regulation of mitotic cell cycle
2. P GO:0003713 transcription coactivator activity
2. P GO:0008156 negative regulation of DNA replication
2. P GO:0033089 positive regulation of T cell differentiation in thymus
2. P GO:0033148 positive regulation of intracellular estrogen receptor signaling pathway
2. P GO:0051568 histone H3-K4 methylation
2. P GO:0060271 cilium assembly
2. P GO:0009958 positive gravitropism
2. P GO:0008180 COP9 signalosome
2. P GO:0044666 MLL3/4 complex
2. P GO:0060717 chorion development
2. P GO:0140059 dendrite arborization
2. P GO:0005634 nucleus
2. P GO:0044458 motile cilium assembly
2. P GO:0110026 regulation of DNA strand resection involved in replication fork processing
2. P GO:0005816 spindle pole body
2. P GO:0021687 cerebellar molecular layer morphogenesis
2. P GO:0016604 nuclear body
2. P GO:0048304 positive regulation of isotype switching to IgG isotypes
2. P GO:1902808 positive regulation of cell cycle G1/S phase transition
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:1902017 regulation of cilium assembly
2. P GO:0034399 nuclear periphery
2. P GO:0072487 MSL complex
2. P GO:0098534 centriole assembly
2. P GO:0000723 telomere maintenance
2. P GO:0042802 identical protein binding
2. P GO:0048714 positive regulation of oligodendrocyte differentiation
2. P GO:1902749 regulation of cell cycle G2/M phase transition
2. P GO:0006310 DNA recombination
2. P GO:0035097 histone methyltransferase complex
2. P GO:0071557 histone H3-K27 demethylation
2. P GO:0043984 histone H4-K16 acetylation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8NAV2 Uncharacterized protein C8orf58 0 1.35e-159 0.0
1. PB Q66JV7 Uncharacterized protein C8orf58 homolog 2.84e-03 1.16e-31 2.61e-117
2. P D3ZDX9 Multicilin 4.59e-02 1.83e-05 NA
2. P Q07555 Uncharacterized protein YDL129W 2.59e-01 1.78e-03 NA
2. P A2RU30 Protein TESPA1 1.77e-01 1.94e-03 NA
2. P Q8IXS0 Protein FAM217A 3.18e-01 3.67e-02 NA
2. P Q9D9W6 Protein FAM217A 5.36e-02 3.47e-02 NA
2. P A0A494C0N9 Protein FAM246B 2.78e-02 1.06e-03 NA
2. P Q06616 Nuclear envelope protein YPR174C 1.18e-01 7.31e-03 NA
2. P Q58G53 Protein LAZY 2 2.13e-01 2.42e-02 NA
2. P Q5T1N1 Protein AKNAD1 8.32e-01 3.71e-03 NA
2. P Q5R9L2 Protein ZNF365 2.55e-01 2.35e-02 NA
2. P Q6AXX2 Uncharacterized protein C16orf46 homolog 1.92e-01 3.11e-03 NA
2. P Q99L02 PAXIP1-associated glutamate-rich protein 1A 3.08e-01 1.94e-03 NA
2. P A0A494C0Y3 Protein FAM246A 4.27e-02 2.97e-02 NA
2. P Q5M865 PAXIP1-associated glutamate-rich protein 1 1.83e-01 4.71e-03 NA
2. P Q99MY0 Spermatogenic leucine zipper protein 1 5.58e-02 3.78e-02 NA
2. P D6RGH6 Multicilin 1.56e-01 1.86e-03 NA
2. P P58505 Uncharacterized protein C21orf58 9.25e-03 4.45e-02 NA
2. P Q3UZ45 Multicilin 9.91e-02 6.16e-06 NA
2. P Q5XHY8 Protein FAM217A 2.37e-02 2.83e-04 NA
2. P Q8BHB7 Uncharacterized protein C16orf46 homolog 1.63e-01 1.33e-03 NA
2. P Q32LI3 Uncharacterized protein C12orf71 homolog 8.33e-02 5.06e-05 NA
2. P Q1LZ80 PAXIP1-associated glutamate-rich protein 1 1.82e-01 1.78e-02 NA
2. P Q9BQE6 LBH domain-containing protein 1 1.17e-01 1.54e-02 NA
2. P Q6PDM1 Male-specific lethal 1 homolog 1.44e-01 3.67e-02 NA