Summary

Q8NBP0

Homolog: Q58741.
Function: TPR repeat-containing protein MJ1345.

Statistics

Total GO Annotation: 209
Unique PROST Go: 7
Unique BLAST Go: 199

Total Homologs: 128
Unique PROST Homologs: 2
Unique BLAST Homologs: 124

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q58741 (TPR repeat-containing protein MJ1345) with a FATCAT P-Value: 1.22e-15 and RMSD of 3.05 angstrom. The sequence alignment identity is 12.2%.
Structural alignment shown in left. Query protein Q8NBP0 colored as red in alignment, homolog Q58741 colored as blue. Query protein Q8NBP0 is also shown in right top, homolog Q58741 showed in right bottom. They are colored based on secondary structures. 

  Q8NBP0 MAPAGCCCCCCFWGGAVAAAGAARRVLLLLLLGVLSAGLRPGALATEHYSPLSLLKQELQHRQQQEAPAGGGGCSPQSGDWGDQYSAECGESSFLNFHDS 100
  Q58741 ---------------------------------------------------------------------------------------------------- 0

  Q8NBP0 DCEPKGSSPCDSLLSLNTEKILSQAKSIAEQKRFPFATDNDSTNEELAIAYVLIGSG----LYDEAIRHFSTMLQEEPDLVSAIYGRGIAYGKKGLHDIK 196
  Q58741 -----------------------------------------------------MGEGVNMEIYNESI------LWDE--YFDALEKRN--Y-EKAL---- 32

  Q8NBP0 NAELALFELSRVITLE-PDRPEVFEQRAEILSPLGRINE-AVN--DLTKAIQLQPSARLYRH-RGTLYFIS----EDYATAHEDFQQSLELNKNQ-PIAM 286
  Q58741 ---L-L--IDKI--LEVRESPDVYVRKARILRTLGE-NDKALEYFD--KALKLKPKYILANFLKGAL-LVSLGKLEE---AKEVFLKLCRLEKSDLPV-- 115

  Q8NBP0 LYKGLTFFHRGLLKEAIESFKEALKQKVD-FIDAY-KSL------GQ-AYRELGNFEAATESFQKALLLNQNHVQTLQLRGMMLYHHGSLQEALKNFKRC 377
  Q58741 --KYVTAF---ILKK-LGEYDYALKI-IDKILKKYPKSAIAWAEKGEILYRE-GKLKKSLECFDNALKINPKDCQSLLYKGEILFKLGRYGEALK----C 203

  Q8NBP0 LQ--LEPYN-EV--CQY-MKGLSHVAMGQFYEGIKAQTK--VMLN--DPLPGQKASPEYLKVKYLREYSRYLHAHLDTPLTEYN-----ID--VDL-PGS 459
  Q58741 LKKVFERNNKDIRALMYIIQILIYL--GRLNQAL-EYTKKALKLNPDDPL---------L---YL--YKGII---LN-KLGKYNEAIKYFDKVLEINP-N 281

  Q8NBP0 FKDHW-AKNLPFLIEDYEEQPGLQPHIKDVLHQNFESYKPEVQELI-CVADRLGSLMQYETPGFLPNKRIHRAMGLAALEVMQAVQRTWTNSKVRMNGKT 557
  Q58741 IPDAWNGKAI-AL-----EKLG-----K-------------INEAIECY-NR--ALDIYE---------------------------------------- 314

  Q8NBP0 RLMQWRDMFDIAVKWRRIADPDQPVLWLDQMPARSLSRGFNNHINLIRGQVINMRYLEYFEKILHFIKDRILVYHGANNPKGLLEVREALEKVHKVEDLL 657
  Q58741 ---------------------------------------------------------------------------------------------------- 314

  Q8NBP0 PIMKQFNTKTKDGFTVNTKVPSLKDQGKEYDGFTITITGDKVGNILFSVETQTTEERTQLYHAEIDALYKDLTAKGKVLILSSEFGEADAVCNLILSLVY 757
  Q58741 ---------------------------------------------------------------------------------------------------- 314

  Q8NBP0 YFYNLMPLSRGSSVIAYSVIVGALMASGKEVAGKIPKGKLVDFEAMTAPGSEAFSKVAKSWMNLKSISPSYKTLPSVSETFPTLRSMIEVLNTDSSPRCL 857
  Q58741 ---------------------------------------------------------------------------------------------------- 314

  Q8NBP0 KKL 860
  Q58741 --- 314

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005783 endoplasmic reticulum
1. PB GO:0060090 molecular adaptor activity
1. PB GO:0031348 negative regulation of defense response
2. P GO:0018117 protein adenylylation
2. P GO:0031965 nuclear membrane
2. P GO:0070733 protein adenylyltransferase activity
2. P GO:0016779 nucleotidyltransferase activity
2. P GO:0005635 nuclear envelope
2. P GO:0050829 defense response to Gram-negative bacterium
2. P GO:0020002 host cell plasma membrane
3. B GO:0048029 monosaccharide binding
3. B GO:0016176 superoxide-generating NADPH oxidase activator activity
3. B GO:0060411 cardiac septum morphogenesis
3. B GO:0097237 cellular response to toxic substance
3. B GO:0001832 blastocyst growth
3. B GO:0032922 circadian regulation of gene expression
3. B GO:0000122 negative regulation of transcription by RNA polymerase II
3. B GO:0009736 cytokinin-activated signaling pathway
3. B GO:0045862 positive regulation of proteolysis
3. B GO:0000030 mannosyltransferase activity
3. B GO:0007091 metaphase/anaphase transition of mitotic cell cycle
3. B GO:0035327
3. B GO:0050688 regulation of defense response to virus
3. B GO:0006368 transcription elongation from RNA polymerase II promoter
3. B GO:0051787 misfolded protein binding
3. B GO:0035020 regulation of Rac protein signal transduction
3. B GO:0030992 intraciliary transport particle B
3. B GO:0061077 chaperone-mediated protein folding
3. B GO:0031490 chromatin DNA binding
3. B GO:0016567 protein ubiquitination
3. B GO:0051131 chaperone-mediated protein complex assembly
3. B GO:0019894 kinesin binding
3. B GO:0016584 nucleosome positioning
3. B GO:0009100 glycoprotein metabolic process
3. B GO:0010187 negative regulation of seed germination
3. B GO:0000791 euchromatin
3. B GO:0019903 protein phosphatase binding
3. B GO:0055087 Ski complex
3. B GO:0048564 photosystem I assembly
3. B GO:0007517 muscle organ development
3. B GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0097363 protein O-GlcNAc transferase activity
3. B GO:0004860 protein kinase inhibitor activity
3. B GO:0033523 histone H2B ubiquitination
3. B GO:0007338 single fertilization
3. B GO:0051603 proteolysis involved in cellular protein catabolic process
3. B GO:0060263 regulation of respiratory burst
3. B GO:2001168 positive regulation of histone H2B ubiquitination
3. B GO:0001826 inner cell mass cell differentiation
3. B GO:0005528 FK506 binding
3. B GO:0005788 endoplasmic reticulum lumen
3. B GO:1900150 regulation of defense response to fungus
3. B GO:0006041 glucosamine metabolic process
3. B GO:0071357 cellular response to type I interferon
3. B GO:0009740 gibberellic acid mediated signaling pathway
3. B GO:0042030 ATPase inhibitor activity
3. B GO:1990429 peroxisomal importomer complex
3. B GO:0051301 cell division
3. B GO:0043981 histone H4-K5 acetylation
3. B GO:0043568 positive regulation of insulin-like growth factor receptor signaling pathway
3. B GO:0042588 zymogen granule
3. B GO:0070613 regulation of protein processing
3. B GO:0072380 TRC complex
3. B GO:0042995 cell projection
3. B GO:0019901 protein kinase binding
3. B GO:0034464 BBSome
3. B GO:1900038 negative regulation of cellular response to hypoxia
3. B GO:0030544 Hsp70 protein binding
3. B GO:1900191 negative regulation of single-species biofilm formation
3. B GO:0006111 regulation of gluconeogenesis
3. B GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding
3. B GO:0005790 smooth endoplasmic reticulum
3. B GO:0017053 transcription repressor complex
3. B GO:1905798 positive regulation of intraciliary anterograde transport
3. B GO:0036334 epidermal stem cell homeostasis
3. B GO:1903428 positive regulation of reactive oxygen species biosynthetic process
3. B GO:1903646 positive regulation of chaperone-mediated protein folding
3. B GO:1904278 positive regulation of wax biosynthetic process
3. B GO:0034976 response to endoplasmic reticulum stress
3. B GO:2001162 positive regulation of histone H3-K79 methylation
3. B GO:0016262 protein N-acetylglucosaminyltransferase activity
3. B GO:0071365 cellular response to auxin stimulus
3. B GO:0070102 interleukin-6-mediated signaling pathway
3. B GO:0016441 posttranscriptional gene silencing
3. B GO:0009615 response to virus
3. B GO:0031145 anaphase-promoting complex-dependent catabolic process
3. B GO:0097541 axonemal basal plate
3. B GO:1905515 non-motile cilium assembly
3. B GO:0044292 dendrite terminus
3. B GO:0051571 positive regulation of histone H3-K4 methylation
3. B GO:1900364 negative regulation of mRNA polyadenylation
3. B GO:0071222 cellular response to lipopolysaccharide
3. B GO:0060544 regulation of necroptotic process
3. B GO:0006986 response to unfolded protein
3. B GO:0019060 intracellular transport of viral protein in host cell
3. B GO:0090315 negative regulation of protein targeting to membrane
3. B GO:0070417 cellular response to cold
3. B GO:0016485 protein processing
3. B GO:2000785 regulation of autophagosome assembly
3. B GO:0006493 protein O-linked glycosylation
3. B GO:0007259 receptor signaling pathway via JAK-STAT
3. B GO:1903912 negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
3. B GO:0043984 histone H4-K16 acetylation
3. B GO:0051085 chaperone cofactor-dependent protein refolding
3. B GO:0006110 regulation of glycolytic process
3. B GO:0060426 lung vasculature development
3. B GO:0036126 sperm flagellum
3. B GO:0071360 cellular response to exogenous dsRNA
3. B GO:0002081 outer acrosomal membrane
3. B GO:0017122 protein N-acetylglucosaminyltransferase complex
3. B GO:0030433 ubiquitin-dependent ERAD pathway
3. B GO:0051087 chaperone binding
3. B GO:0120162 positive regulation of cold-induced thermogenesis
3. B GO:0097730 non-motile cilium
3. B GO:0060548 negative regulation of cell death
3. B GO:0060122 inner ear receptor cell stereocilium organization
3. B GO:0050821 protein stabilization
3. B GO:0010310 regulation of hydrogen peroxide metabolic process
3. B GO:1903569 positive regulation of protein localization to ciliary membrane
3. B GO:0070286 axonemal dynein complex assembly
3. B GO:0051569 regulation of histone H3-K4 methylation
3. B GO:0060914 heart formation
3. B GO:0005819 spindle
3. B GO:0009910 negative regulation of flower development
3. B GO:0006626 protein targeting to mitochondrion
3. B GO:2001020 regulation of response to DNA damage stimulus
3. B GO:2000377 regulation of reactive oxygen species metabolic process
3. B GO:0019827 stem cell population maintenance
3. B GO:0032868 response to insulin
3. B GO:0072686 mitotic spindle
3. B GO:0045638 negative regulation of myeloid cell differentiation
3. B GO:0097546 ciliary base
3. B GO:0031397 negative regulation of protein ubiquitination
3. B GO:0033137 negative regulation of peptidyl-serine phosphorylation
3. B GO:0006486 protein glycosylation
3. B GO:0034975 protein folding in endoplasmic reticulum
3. B GO:0035269 protein O-linked mannosylation
3. B GO:0021513 spinal cord dorsal/ventral patterning
3. B GO:0010390 histone monoubiquitination
3. B GO:0042487 regulation of odontogenesis of dentin-containing tooth
3. B GO:0016560 protein import into peroxisome matrix, docking
3. B GO:0043947 obsolete positive regulation by host of symbiont catalytic activity
3. B GO:0005634 nucleus
3. B GO:0051097 negative regulation of helicase activity
3. B GO:0001835 blastocyst hatching
3. B GO:0000123 histone acetyltransferase complex
3. B GO:0036064 ciliary basal body
3. B GO:0048015 phosphatidylinositol-mediated signaling
3. B GO:0031647 regulation of protein stability
3. B GO:0070979 protein K11-linked ubiquitination
3. B GO:0004169 dolichyl-phosphate-mannose-protein mannosyltransferase activity
3. B GO:0000993 RNA polymerase II complex binding
3. B GO:0051879 Hsp90 protein binding
3. B GO:0051607 defense response to virus
3. B GO:0002088 lens development in camera-type eye
3. B GO:0009949 polarity specification of anterior/posterior axis
3. B GO:0071333 cellular response to glucose stimulus
3. B GO:0005778 peroxisomal membrane
3. B GO:0016593 Cdc73/Paf1 complex
3. B GO:0060091 kinocilium
3. B GO:1903929 primary palate development
3. B GO:0031111 negative regulation of microtubule polymerization or depolymerization
3. B GO:0036494 positive regulation of translation initiation in response to endoplasmic reticulum stress
3. B GO:0060447 bud outgrowth involved in lung branching
3. B GO:0009908 flower development
3. B GO:0005052 peroxisome matrix targeting signal-1 binding
3. B GO:0034405 response to fluid shear stress
3. B GO:1905801 positive regulation of intraciliary retrograde transport
3. B GO:0031966 mitochondrial membrane
3. B GO:0048853 forebrain morphogenesis
3. B GO:0080182 histone H3-K4 trimethylation
3. B GO:0060271 cilium assembly
3. B GO:1900182 positive regulation of protein localization to nucleus
3. B GO:0001711 endodermal cell fate commitment
3. B GO:0006915 apoptotic process
3. B GO:0005813 centrosome
3. B GO:0034427 nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5'
3. B GO:0032991 protein-containing complex
3. B GO:0042073 intraciliary transport
3. B GO:0061371 determination of heart left/right asymmetry
3. B GO:0005829 cytosol
3. B GO:0045793 positive regulation of cell size
3. B GO:0010801 negative regulation of peptidyl-threonine phosphorylation
3. B GO:0016027 inaD signaling complex
3. B GO:0045842 positive regulation of mitotic metaphase/anaphase transition
3. B GO:0005680 anaphase-promoting complex
3. B GO:0030703 eggshell formation
3. B GO:0016607 nuclear speck
3. B GO:0001933 negative regulation of protein phosphorylation
3. B GO:0097542 ciliary tip
3. B GO:0048312 intracellular distribution of mitochondria
3. B GO:0070678 preprotein binding
3. B GO:0006620 posttranslational protein targeting to endoplasmic reticulum membrane
3. B GO:0042169 SH2 domain binding
3. B GO:1902017 regulation of cilium assembly
3. B GO:0031359 integral component of chloroplast outer membrane
3. B GO:0006469 negative regulation of protein kinase activity
3. B GO:1900034 regulation of cellular response to heat
3. B GO:1904107 protein localization to microvillus membrane
3. B GO:0030900 forebrain development
3. B GO:0009938 negative regulation of gibberellic acid mediated signaling pathway
3. B GO:0007290 spermatid nucleus elongation
3. B GO:2000653 regulation of genetic imprinting
3. B GO:0061087 positive regulation of histone H3-K27 methylation
3. B GO:0001829 trophectodermal cell differentiation
3. B GO:0032474 otolith morphogenesis
3. B GO:0046626 regulation of insulin receptor signaling pathway
3. B GO:0070478 nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay
3. B GO:0043982 histone H4-K8 acetylation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB F4JS25 Suppressor of RPS4-RLD 1 3.44e-15 5.73e-08 3.64e-76
1. PB Q8NBP0 Tetratricopeptide repeat protein 13 0 4.48e-129 0.0
2. P Q23544 Protein adenylyltransferase fic-1 2.83e-02 3.76e-02 NA
2. P Q4UWF4 Uridine 5'-monophosphate transferase 1.86e-01 2.96e-06 NA
3. B Q96301 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 7.27e-05 NA 6.15e-09
3. B P17883 Superkiller protein 3 2.94e-04 NA 0.003
3. B Q3AH18 Photosystem I assembly protein Ycf3 2.02e-02 NA 0.030
3. B Q4R5F5 Interferon-induced protein with tetratricopeptide repeats 1 8.50e-07 NA 0.042
3. B Q9Y2Z0 Protein SGT1 homolog 4.33e-02 NA 3.96e-07
3. B Q58208 TPR repeat-containing protein MJ0798 4.19e-06 NA 2.41e-06
3. B Q13099 Intraflagellar transport protein 88 homolog 3.51e-04 NA 0.001
3. B Q43468 Hsp70-Hsp90 organizing protein 1 1.39e-04 NA 0.011
3. B Q8XG77 Lipoprotein NlpI 2.79e-05 NA 0.036
3. B P30260 Cell division cycle protein 27 homolog 2.04e-04 NA 1.65e-04
3. B Q9LVH5 Outer envelope protein 64, chloroplastic 1.49e-02 NA 5.02e-05
3. B A7Z061 Cell division cycle protein 27 homolog 9.66e-04 NA 1.75e-04
3. B Q7CKI5 Lipoprotein NlpI 8.76e-06 NA 0.003
3. B Q04737 TPR repeat-containing protein slr0751 1.08e-08 NA 8.52e-13
3. B Q8IUR5 Protein O-mannosyl-transferase TMTC1 6.26e-05 NA 1.93e-06
3. B P41889 Anaphase-promoting complex subunit cut9 1.39e-04 NA 0.020
3. B Q8CGY8 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 6.36e-05 NA 6.11e-11
3. B B5X0I6 Protein CTR9 homolog 4.57e-05 NA 0.004
3. B Q8S8L9 Uncharacterized TPR repeat-containing protein At2g32450 1.35e-05 NA 1.63e-06
3. B P0CT30 Small glutamine-rich tetratricopeptide repeat-containing protein 2 1.03e-02 NA 5.83e-06
3. B O34452 TPR repeat-containing protein YrrB 1.72e-09 NA 5.66e-04
3. B O67178 Uncharacterized protein aq_1088 1.99e-04 NA 4.52e-07
3. B Q5F3K0 Tetratricopeptide repeat protein 27 1.11e-04 NA 0.002
3. B Q62018 RNA polymerase-associated protein CTR9 homolog 3.46e-05 NA 1.01e-05
3. B Q5T764 Interferon-induced protein with tetratricopeptide repeats 1B 3.98e-06 NA 0.017
3. B Q01495 Peroxisomal targeting signal receptor 9.94e-06 NA 0.018
3. B Q8RVB2 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 6.99e-05 NA 3.24e-08
3. B Q9STH1 Hsp70-Hsp90 organizing protein 3 6.07e-05 NA 0.001
3. B O15294 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 2.85e-05 NA 6.16e-11
3. B Q5R8D8 DnaJ homolog subfamily C member 7 4.64e-07 NA 0.002
3. B Q54DA8 Protein STIP1 homolog 5.48e-05 NA 0.025
3. B O23052 Uncharacterized TPR repeat-containing protein At1g05150 1.93e-05 NA 6.62e-07
3. B Q8BRH0 Protein O-mannosyl-transferase TMTC3 3.41e-05 NA 0.003
3. B Q5CZ52 Bardet-Biedl syndrome 4 protein homolog 2.53e-07 NA 0.003
3. B Q96EQ0 Small glutamine-rich tetratricopeptide repeat-containing protein beta 1.44e-03 NA 0.001
3. B F4I3Z5 Tetratricopeptide repeat protein SKI3 1.66e-04 NA 3.53e-04
3. B Q9WVM3 Anaphase-promoting complex subunit 7 9.60e-05 NA 0.022
3. B Q5U2X2 Sperm-associated antigen 1 1.32e-02 NA 2.30e-06
3. B Q61371 Intraflagellar transport protein 88 homolog 2.04e-04 NA 5.25e-04
3. B Q17QZ7 Tetratricopeptide repeat protein 27 1.13e-04 NA 0.004
3. B Q58823 TPR repeat-containing protein MJ1428 8.76e-07 NA 2.27e-05
3. B Q99615 DnaJ homolog subfamily C member 7 4.73e-07 NA 0.001
3. B Q9MUK5 Translocon at the outer membrane of chloroplasts 64 3.62e-02 NA 0.003
3. B P15705 Heat shock protein STI1 3.16e-04 NA 0.029
3. B Q07617 Sperm-associated antigen 1 1.33e-02 NA 4.02e-06
3. B Q58741 TPR repeat-containing protein MJ1345 1.22e-15 NA 2.49e-10
3. B Q2KIK0 Protein SGT1 homolog 1.15e-01 NA 6.81e-05
3. B Q27HV0 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 4.78e-05 NA 6.21e-11
3. B Q6YZI0 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 1.10e-04 NA 4.55e-10
3. B Q9LNB6 Hsp70-Hsp90 organizing protein 1 9.21e-05 NA 5.21e-05
3. B Q6CT48 Peroxisomal targeting signal receptor 4.43e-06 NA 2.74e-04
3. B Q9CX34 Protein SGT1 homolog 5.72e-02 NA 2.26e-04
3. B P14922 General transcriptional corepressor CYC8 1.62e-04 NA 2.41e-04
3. B A7MB10 Protein RRP5 homolog 1.59e-01 NA 0.037
3. B P31600 Bacteriophage adsorption protein A 2.13e-03 NA 0.048
3. B Q7CPQ1 Lipoprotein NlpI 8.35e-06 NA 0.036
3. B O94556 Anaphase-promoting complex subunit 8 6.79e-06 NA 0.007
3. B Q80W98 Small glutamine-rich tetratricopeptide repeat-containing protein beta 3.65e-04 NA 0.009
3. B Q9HGM9 DnaJ homolog subfamily C member 7 homolog 1.19e-06 NA 7.38e-05
3. B Q9UJX3 Anaphase-promoting complex subunit 7 1.26e-05 NA 0.020
3. B Q3UV71 Protein O-mannosyl-transferase TMTC1 4.91e-05 NA 2.82e-06
3. B Q9M8Y0 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC 1.82e-05 NA 1.80e-11
3. B Q4V8A2 Cell division cycle protein 27 homolog 3.91e-04 NA 1.09e-04
3. B C0PEY7 Tetratricopeptide repeat domain-containing protein PYG7, chloroplastic 1.31e-02 NA 0.004
3. B Q1C3L9 Lipoprotein NlpI 1.07e-06 NA 0.003
3. B Q9VGU5 Tetratricopeptide repeat protein 14 homolog 1.42e-01 NA 0.010
3. B O82422 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 1.50e-04 NA 9.71e-10
3. B O60184 General transcriptional corepressor ssn6 2.79e-04 NA 0.030
3. B Q1CM50 Lipoprotein NlpI 1.06e-06 NA 0.003
3. B Q6DEU9 RNA polymerase-associated protein CTR9 homolog 3.95e-05 NA 1.92e-06
3. B Q57711 TPR repeat-containing protein MJ0941 3.14e-08 NA 1.45e-07
3. B Q86TZ1 Tetratricopeptide repeat protein 6 1.32e-07 NA 3.27e-09
3. B P33746 Sol locus transcriptional repressor 2.41e-06 NA 0.005
3. B Q9H6T3 RNA polymerase II-associated protein 3 4.33e-04 NA 0.002
3. B Q5ZKQ3 RNA polymerase II-associated protein 3 1.38e-03 NA 0.001
3. B Q06AN9 Cell division cycle protein 27 homolog A 4.65e-05 NA 3.99e-04
3. B O06917 TPR repeat-containing protein MJ0263 1.71e-11 NA 0.002
3. B P19737 TPR repeat-containing protein SYNPCC7002_A0425 5.87e-08 NA 2.82e-04
3. B Q5XEP2 Hsp70-Hsp90 organizing protein 2 5.73e-05 NA 2.61e-04
3. B P38825 Protein TOM71 6.66e-06 NA 0.003
3. B Q54J83 Anaphase-promoting complex subunit 3 2.05e-03 NA 1.99e-04
3. B O14217 Probable mitochondrial import receptor subunit tom70 1.41e-05 NA 0.048
3. B Q5I0X7 Tetratricopeptide repeat protein 32 2.24e-04 NA 0.002
3. B D7REX8 Protein unc-45 homolog B 4.66e-04 NA 0.037
3. B P23231 Mitochondrial import receptor subunit tom70 1.08e-05 NA 4.01e-11
3. B O18158 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 1.96e-05 NA 1.75e-08
3. B G5EG38 Cell division cycle protein 16 homolog 1.09e-04 NA 0.008
3. B O82039 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 5.94e-05 NA 1.33e-08
3. B Q8CJ00 NADPH oxidase activator 1 3.08e-02 NA 0.012
3. B B0BN85 Protein SGT1 homolog 3.95e-02 NA 5.44e-04
3. B Q99144 Peroxisomal targeting signal receptor 4.39e-03 NA 0.023
3. B Q9DAC7 Tetratricopeptide repeat protein 32 1.80e-04 NA 0.005
3. B P81436 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 4.21e-05 NA 6.16e-11
3. B Q9VL78 FK506-binding protein 59 2.85e-02 NA 0.003
3. B Q8LP10 Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY 1.47e-04 NA 8.30e-05
3. B Q91YW3 DnaJ homolog subfamily C member 3 9.07e-07 NA 2.36e-07
3. B Q4QR29 RNA polymerase-associated protein CTR9 homolog 5.94e-05 NA 1.09e-06
3. B A8E7I5 Tetratricopeptide repeat protein 36 2.58e-03 NA 0.034
3. B Q9SUT5 Protein SGT1 homolog B 6.65e-03 NA 0.001
3. B Q84JR9 TPR repeat-containing thioredoxin TTL4 6.33e-04 NA 0.049
3. B Q9QYI3 DnaJ homolog subfamily C member 7 5.30e-06 NA 0.001
3. B Q5ZI13 DnaJ homolog subfamily C member 3 3.32e-07 NA 3.03e-07
3. B Q80ZX8 Sperm-associated antigen 1 1.11e-02 NA 3.72e-06
3. B Q9VF81 Protein O-mannosyl-transferase TMTC4 1.05e-05 NA 0.037
3. B P38042 Anaphase-promoting complex subunit CDC27 6.87e-04 NA 0.001
3. B Q7ZU45 Outer dynein arm-docking complex subunit 4 7.41e-06 NA 0.013
3. B A2A6Q5 Cell division cycle protein 27 homolog 1.14e-03 NA 1.03e-04
3. B Q13217 DnaJ homolog subfamily C member 3 5.27e-07 NA 2.15e-07
3. B F8RP11 Hsp70-Hsp90 organizing protein 8.63e-05 NA 0.002
3. B P09914 Interferon-induced protein with tetratricopeptide repeats 1 7.00e-07 NA 3.32e-04
3. B Q58350 TPR repeat-containing protein MJ0940 4.38e-10 NA 1.37e-06
3. B Q6PD62 RNA polymerase-associated protein CTR9 homolog 1.43e-04 NA 1.01e-05
3. B Q57JI4 Lipoprotein NlpI 8.19e-06 NA 0.036
3. B Q9SUR9 Protein SGT1 homolog A 6.92e-03 NA 0.009
3. B P56558 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 2.23e-05 NA 5.98e-11
3. B Q8IWX7 Protein unc-45 homolog B 5.07e-04 NA 0.013
3. B Q54IP0 DnaJ homolog subfamily C member 7 homolog 5.05e-07 NA 8.23e-05
3. B Q9TRY0 Peptidyl-prolyl cis-trans isomerase FKBP4 4.12e-02 NA 0.045
3. B Q54M21 DnaJ homolog subfamily C member 3 homolog 2.03e-04 NA 8.18e-05
3. B Q23049 Tetratricopeptide repeat protein 8 6.93e-07 NA 2.10e-04
3. B Q8CGY6 Protein unc-45 homolog B 7.67e-04 NA 0.036
3. B Q9R0T3 DnaJ homolog subfamily C member 3 5.06e-07 NA 8.08e-08
3. B Q8VD33 Small glutamine-rich tetratricopeptide repeat-containing protein beta 4.50e-04 NA 0.009
3. B Q27968 DnaJ homolog subfamily C member 3 8.31e-07 NA 1.47e-07