Summary

Q8NC38

Homolog: P16531.
Function: Seminal vesicle protein SVP-2 (Fragment).

Statistics

Total GO Annotation: 22
Unique PROST Go: 18
Unique BLAST Go: 4

Total Homologs: 20
Unique PROST Homologs: 18
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P16531 (Seminal vesicle protein SVP-2 (Fragment)) with a FATCAT P-Value: 0.0213 and RMSD of 3.03 angstrom. The sequence alignment identity is 24.2%.
Structural alignment shown in left. Query protein Q8NC38 colored as red in alignment, homolog P16531 colored as blue. Query protein Q8NC38 is also shown in right top, homolog P16531 showed in right bottom. They are colored based on secondary structures. 

  Q8NC38 MLAVPVRLK---VGSR-KPEWGTNRLTSCPAKDPLDRRLQNLRDRERVPEPQRSLRPGVQE-DSREHGQVPEVSDPQVDLEFVDLQAKPRYRRLILKTQI 95
  P16531 HLALLLILENQASGRRLR---GSAR-----AQDPV---VSRVWHKEEVEESESS-R-G-QDFDKR---RFWEKDDPTG--EHVSV----RHEHL-EKSHI 76

  Q8NC38 --PEAS--DSQAA--QKP-QAHRQIPETTEAGRETTSN------------------- 126
  P16531 RFKEDSIDDSGSAGGLNPSKGHLRL-KRHDAMEELVSVEDQALANGADPGKSNMQRV 132

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0044196 host cell nucleolus
2. P GO:0051028 mRNA transport
2. P GO:2000252 negative regulation of feeding behavior
2. P GO:0030216 keratinocyte differentiation
2. P GO:0032355 response to estradiol
2. P GO:0004864 protein phosphatase inhibitor activity
2. P GO:0005200 structural constituent of cytoskeleton
2. P GO:0005882 intermediate filament
2. P GO:0008544 epidermis development
2. P GO:0010921 regulation of phosphatase activity
2. P GO:0007010 cytoskeleton organization
2. P GO:0019212 phosphatase inhibitor activity
2. P GO:0031424 keratinization
2. P GO:0007417 central nervous system development
2. P GO:0048018 receptor ligand activity
2. P GO:0004865 protein serine/threonine phosphatase inhibitor activity
2. P GO:0001533 cornified envelope
3. B GO:0046983 protein dimerization activity
3. B GO:0006526 arginine biosynthetic process
3. B GO:0003942 N-acetyl-gamma-glutamyl-phosphate reductase activity
3. B GO:0051287 NAD binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8NC38 Putative uncharacterized protein ZNF436-AS1 0 1.06e-146 8.94e-88
2. P C9JFL3 Proline, histidine and glycine-rich protein 1 3.05e-01 1.20e-02 NA
2. P Q9PR55 Uncharacterized protein UU089.1 8.67e-01 7.11e-05 NA
2. P Q9CQK8 Small proline-rich protein 2A1 2.59e-01 5.00e-02 NA
2. P Q8TGM4 Putative uncharacterized protein YLR286W-A 6.03e-01 1.23e-02 NA
2. P Q6ZRG5 Putative uncharacterized protein FLJ43944 3.57e-02 2.98e-02 NA
2. P O96001 Protein phosphatase 1 regulatory subunit 17 2.73e-02 1.14e-05 NA
2. P P17754 Protein Rev NA 2.42e-03 NA
2. P O21436 Kinetoplastid membrane protein 11 5.41e-01 1.12e-02 NA
2. P Q4KL71 Small proline-rich protein 2A3 1.40e-01 5.00e-02 NA
2. P Q9Z2E4 Protein phosphatase 1 regulatory subunit 17 8.39e-02 1.11e-04 NA
2. P Q3LI77 Keratin-associated protein 13-4 1.03e-01 2.81e-02 NA
2. P P84179 87 kDa annexin-binding protein (Fragments) NA 1.02e-02 NA
2. P Q9DH85 Uncharacterized gene 4 protein NA 1.06e-09 NA
2. P G5CKU5 RYamide neuropeptides 2.77e-01 3.73e-02 NA
2. P P53884 Putative uncharacterized protein YNL174W 8.14e-01 3.46e-03 NA
2. P P0C785 Replication-associated protein NA 1.63e-03 NA
2. P Q65204 Uncharacterized protein E66L NA 2.47e-02 NA
2. P P16531 Seminal vesicle protein SVP-2 (Fragment) 2.13e-02 7.09e-09 NA
3. B A6M1Z6 N-acetyl-gamma-glutamyl-phosphate reductase 9.53e-01 NA 0.018