Summary

Q8NEA4

Homolog: Q5R796.
Function: F-box only protein 36.

Statistics

Total GO Annotation: 14
Unique PROST Go: 10
Unique BLAST Go: 4

Total Homologs: 11
Unique PROST Homologs: 6
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q5R796 (F-box only protein 36) with a FATCAT P-Value: 0.0 and RMSD of 0.51 angstrom. The sequence alignment identity is 98.9%.
Structural alignment shown in left. Query protein Q8NEA4 colored as red in alignment, homolog Q5R796 colored as blue. Query protein Q8NEA4 is also shown in right top, homolog Q5R796 showed in right bottom. They are colored based on secondary structures. 

  Q8NEA4 MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILDYVINLCKGKFDFLERLSDD 100
  Q5R796 MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIYRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILDYVINLCKGKFDFLERLSDD 100

  Q8NEA4 LLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKYGNLREKQP 188
  Q5R796 LLLNIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKYGNLREKQP 188

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0009751 response to salicylic acid
2. P GO:0016567 protein ubiquitination
2. P GO:0071456 cellular response to hypoxia
2. P GO:0009961 response to 1-aminocyclopropane-1-carboxylic acid
2. P GO:0009617 response to bacterium
2. P GO:0009611 response to wounding
2. P GO:0006970 response to osmotic stress
2. P GO:0009753 response to jasmonic acid
2. P GO:0009737 response to abscisic acid
2. P GO:0009651 response to salt stress
3. B GO:0004842 ubiquitin-protein transferase activity
3. B GO:0006508 proteolysis
3. B GO:0005829 cytosol
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9CQ24 F-box only protein 36 0.00e+00 1.21e-78 1.29e-106
1. PB Q5R796 F-box only protein 36 0.00e+00 4.44e-117 2.72e-138
1. PB Q8NEA4 F-box only protein 36 0 1.57e-142 1.73e-139
2. P Q9FLX3 F-box protein At5g52880 8.56e-03 7.72e-05 NA
2. P Q9S9T6 F-box protein At4g05010 1.11e-02 5.70e-03 NA
2. P Q3E8K6 Putative F-box protein At5g39470 1.45e-02 2.29e-12 NA
2. P O65416 F-box protein SKIP27 3.47e-02 3.80e-07 NA
2. P Q5XF11 F-box protein At4g35930 9.99e-02 7.53e-03 NA
2. P Q8GX77 F-box protein At1g61340 4.19e-02 3.92e-04 NA
3. B Q9UK99 F-box only protein 3 2.88e-02 NA 0.038
3. B A6H7H7 F-box only protein 3 2.43e-02 NA 0.037