Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q8C1F5
(Tetratricopeptide repeat protein 16) with a FATCAT P-Value: 2.73e-12 and RMSD of 4.13 angstrom. The sequence alignment identity is 51.1%.
Structural alignment shown in left. Query protein Q8NEE8 colored as red in alignment, homolog Q8C1F5 colored as blue.
Query protein Q8NEE8 is also shown in right top, homolog Q8C1F5 showed in right bottom. They are colored based on secondary structures.
Q8NEE8 MTDSDEDALKVDQGPSRDIPKPWVIPAPKGILQHIFGTSHVFQSICD-VKPKVTGLTVPLKVREYYSRGQQCLEQADWETAVLLFSRALHLDPQLVDFYA 99 Q8C1F5 --------------------------------------------MTDPTKRRMIGSTVPAKVREYYNQGHQCLLQEDWEMSVLFFSRALHLDPKLVDFYV 56 Q8NEE8 LRAEAYLQLCDFSSAAQNLRRAYSLQQDNCKHLERLTFVLYLQGQCLFEQCAFLDALNVFSHAAELQPEKPCFRYRCMACLLALKQHQACLTLITNELKQ 199 Q8C1F5 FRAEAFIQLCDFSSALQNLRRAYSYDPGNNKYLNRLAFVLYLQGQCLYELCDFQEALCVFLQASDLQPQNASFSYRCMACLLALKRYHDCLALITREVKQ 156 Q8NEE8 DTTNADVYIFRARLYNFLQKPHLCYRDLHSALLLNPKHPQARMLLQKMVAQAQQARQDAGILAVQGKLQHALQRINRAIENNPLDPSLFLFRGTMYRRLQ 299 Q8C1F5 GRASADVYILRARLYNFFQKAKLCYQDLRSALLLDPLHAQAKGLLQKMVDQAKQSLQDASTLAVQGKVHRALKCINCAIENNPLDPNFFFFRGTLRRRLQ 256 Q8NEE8 EFDGAVEDFLKVLDMVTEDQEDMVRQAQRQLLLTYNDFAVHCYRQGAYQEGVLLLNKALRDEQQEKGLYINRGDCFFQLGNLAFAEADYQQALALSPQDE 399 Q8C1F5 QFDHAVEDFLKAMDMVTDTQDNLVKQAQRQLLLTYNDFAVHCYNHGAYQEGVLLLNKAIRDEQNEKGLYINRGDCFFQLGNLAFAEADYKQALALSPLDE 356 Q8NEE8 GANTRMGLLQEKMGFCEQRRKQFQKAENHFSTAIRHNPQKAQYYLYRAKSRQLLQNIFGARQDVATVLLLNPKQPKLSLLMTNLFPGMSVEEVLSTQIAH 499 Q8C1F5 GANLRMGVLQEKLGFCQQKHRQFQTAEEHFSEAIRHSPQKPQYYLHRAKCRQFLQNTLGARLDVATVLLVNPEYPKMAAVMNTLFPSMTVENVLKSQVAE 456 Q8NEE8 LARLQLEQMVE-GSLQAGSPQGIVGMLKRHELERQKALALQHSWKQGEPLIATSEELKATPEIPQVKPGSSEGEAEAPEEEEEKEKEKKEEKKSELIPSK 598 Q8C1F5 LAKLQLSRMIENGPKNI-YPQSTV--VQR-LLERRKAQVLVKLWKQ-ERL-GTPEE-EVT--LYQ-----------APQLAEEK-KVKTARRRT------ 529 Q8NEE8 VASLSDSYLDQTSSASSMSFRTTGTSETEMSAICQEYRSTSATAVTFSDSSLLKTQSSDSGNNREALSHGPRKIKA-TQGQRQSL--SKTE--PTQSQRR 693 Q8C1F5 --SLTDSYADQTSSGSVFSIVSISTSGPEMST-SQEYKSSSHTAIEFSESTLLKPQLSVPRKSQE-LTWSPKVVQAVT----ENLIQNATEVTPAYGQR- 620 Q8NEE8 NSSKTKATIHKRNSSKTKATQSQRRNSSKTRATQGQGQSSSKTEATQGQRQSSSEIEATQGPRQEPSKTKTTRSPRQRPRKVKAARGRSW-----RPS-K 787 Q8C1F5 -DSK-KAT----QVPKPK----------KTEDPKDPSQSTSTT-------------EAPEGPR--PSKSRSTLSVKERIRRAKAVRAQGWKLKAQRSSQK 689 Q8NEE8 VDATQGRSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQGMSSTS-SKAES----TWGPSPSLSKTEVDQ---D---LTYYEAV 873 Q8C1F5 V--T--KTPSLTHSTTHS----DIGESANDT---PGQTPWPSKAADSLSFSE-ISSTDLSSSESFLELT-----NLLTQEVQQIPGDREKLTSDD-- 767
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005634 | nucleus |
| 1. PB | GO:0005654 | nucleoplasm |
| 2. P | GO:0051607 | defense response to virus |
| 2. P | GO:0051879 | Hsp90 protein binding |
| 2. P | GO:0045087 | innate immune response |
| 3. B | GO:0030850 | prostate gland development |
| 3. B | GO:0006825 | copper ion transport |
| 3. B | GO:0021766 | hippocampus development |
| 3. B | GO:0048029 | monosaccharide binding |
| 3. B | GO:0042277 | peptide binding |
| 3. B | GO:0097237 | cellular response to toxic substance |
| 3. B | GO:0032922 | circadian regulation of gene expression |
| 3. B | GO:0000244 | spliceosomal tri-snRNP complex assembly |
| 3. B | GO:0071539 | protein localization to centrosome |
| 3. B | GO:0005874 | microtubule |
| 3. B | GO:0045862 | positive regulation of proteolysis |
| 3. B | GO:0060296 | regulation of cilium beat frequency involved in ciliary motility |
| 3. B | GO:0007091 | metaphase/anaphase transition of mitotic cell cycle |
| 3. B | GO:0048156 | tau protein binding |
| 3. B | GO:0046548 | retinal rod cell development |
| 3. B | GO:0035020 | regulation of Rac protein signal transduction |
| 3. B | GO:0034451 | centriolar satellite |
| 3. B | GO:0061077 | chaperone-mediated protein folding |
| 3. B | GO:0097255 | R2TP complex |
| 3. B | GO:0009100 | glycoprotein metabolic process |
| 3. B | GO:0010187 | negative regulation of seed germination |
| 3. B | GO:0000791 | euchromatin |
| 3. B | GO:0019903 | protein phosphatase binding |
| 3. B | GO:1902855 | regulation of non-motile cilium assembly |
| 3. B | GO:0032435 | negative regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 3. B | GO:0097363 | protein O-GlcNAc transferase activity |
| 3. B | GO:0000413 | protein peptidyl-prolyl isomerization |
| 3. B | GO:0005528 | FK506 binding |
| 3. B | GO:0035259 | glucocorticoid receptor binding |
| 3. B | GO:0006463 | steroid hormone receptor complex assembly |
| 3. B | GO:0048487 | beta-tubulin binding |
| 3. B | GO:1900150 | regulation of defense response to fungus |
| 3. B | GO:0006041 | glucosamine metabolic process |
| 3. B | GO:0009867 | jasmonic acid mediated signaling pathway |
| 3. B | GO:0038108 | negative regulation of appetite by leptin-mediated signaling pathway |
| 3. B | GO:0032465 | regulation of cytokinesis |
| 3. B | GO:0060324 | face development |
| 3. B | GO:0001895 | retina homeostasis |
| 3. B | GO:0003085 | negative regulation of systemic arterial blood pressure |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0060170 | ciliary membrane |
| 3. B | GO:0006403 | RNA localization |
| 3. B | GO:0043981 | histone H4-K5 acetylation |
| 3. B | GO:0010977 | negative regulation of neuron projection development |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0042588 | zymogen granule |
| 3. B | GO:0072380 | TRC complex |
| 3. B | GO:0048854 | brain morphogenesis |
| 3. B | GO:0007098 | centrosome cycle |
| 3. B | GO:0042995 | cell projection |
| 3. B | GO:0034464 | BBSome |
| 3. B | GO:1900038 | negative regulation of cellular response to hypoxia |
| 3. B | GO:0019005 | SCF ubiquitin ligase complex |
| 3. B | GO:0006111 | regulation of gluconeogenesis |
| 3. B | GO:0005547 | phosphatidylinositol-3,4,5-trisphosphate binding |
| 3. B | GO:0030534 | adult behavior |
| 3. B | GO:0043025 | neuronal cell body |
| 3. B | GO:1903428 | positive regulation of reactive oxygen species biosynthetic process |
| 3. B | GO:1903646 | positive regulation of chaperone-mediated protein folding |
| 3. B | GO:0046540 | U4/U6 x U5 tri-snRNP complex |
| 3. B | GO:0016262 | protein N-acetylglucosaminyltransferase activity |
| 3. B | GO:0033210 | leptin-mediated signaling pathway |
| 3. B | GO:0071365 | cellular response to auxin stimulus |
| 3. B | GO:0071005 | U2-type precatalytic spliceosome |
| 3. B | GO:0031072 | heat shock protein binding |
| 3. B | GO:0030521 | androgen receptor signaling pathway |
| 3. B | GO:0071013 | catalytic step 2 spliceosome |
| 3. B | GO:0000281 | mitotic cytokinesis |
| 3. B | GO:0031145 | anaphase-promoting complex-dependent catabolic process |
| 3. B | GO:1905515 | non-motile cilium assembly |
| 3. B | GO:0060544 | regulation of necroptotic process |
| 3. B | GO:0051219 | phosphoprotein binding |
| 3. B | GO:0090315 | negative regulation of protein targeting to membrane |
| 3. B | GO:0016485 | protein processing |
| 3. B | GO:0051492 | regulation of stress fiber assembly |
| 3. B | GO:0006493 | protein O-linked glycosylation |
| 3. B | GO:0021756 | striatum development |
| 3. B | GO:0043984 | histone H4-K16 acetylation |
| 3. B | GO:1903912 | negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation |
| 3. B | GO:0006110 | regulation of glycolytic process |
| 3. B | GO:0044321 | response to leptin |
| 3. B | GO:0017122 | protein N-acetylglucosaminyltransferase complex |
| 3. B | GO:0048608 | reproductive structure development |
| 3. B | GO:0043021 | ribonucleoprotein complex binding |
| 3. B | GO:0120162 | positive regulation of cold-induced thermogenesis |
| 3. B | GO:0030433 | ubiquitin-dependent ERAD pathway |
| 3. B | GO:0097730 | non-motile cilium |
| 3. B | GO:0060548 | negative regulation of cell death |
| 3. B | GO:0016358 | dendrite development |
| 3. B | GO:0061512 | protein localization to cilium |
| 3. B | GO:0005682 | U5 snRNP |
| 3. B | GO:0044295 | axonal growth cone |
| 3. B | GO:0003713 | transcription coactivator activity |
| 3. B | GO:0031115 | negative regulation of microtubule polymerization |
| 3. B | GO:1903546 | protein localization to photoreceptor outer segment |
| 3. B | GO:0032868 | response to insulin |
| 3. B | GO:0072686 | mitotic spindle |
| 3. B | GO:0046661 | male sex differentiation |
| 3. B | GO:0033137 | negative regulation of peptidyl-serine phosphorylation |
| 3. B | GO:0031397 | negative regulation of protein ubiquitination |
| 3. B | GO:0032767 | copper-dependent protein binding |
| 3. B | GO:0051457 | maintenance of protein location in nucleus |
| 3. B | GO:0033365 | protein localization to organelle |
| 3. B | GO:0045444 | fat cell differentiation |
| 3. B | GO:0001843 | neural tube closure |
| 3. B | GO:0000375 | RNA splicing, via transesterification reactions |
| 3. B | GO:0000123 | histone acetyltransferase complex |
| 3. B | GO:0000242 | pericentriolar material |
| 3. B | GO:0036064 | ciliary basal body |
| 3. B | GO:0048015 | phosphatidylinositol-mediated signaling |
| 3. B | GO:0045494 | photoreceptor cell maintenance |
| 3. B | GO:0070979 | protein K11-linked ubiquitination |
| 3. B | GO:0031348 | negative regulation of defense response |
| 3. B | GO:0043014 | alpha-tubulin binding |
| 3. B | GO:0048471 | perinuclear region of cytoplasm |
| 3. B | GO:0060613 | fat pad development |
| 3. B | GO:0003755 | peptidyl-prolyl cis-trans isomerase activity |
| 3. B | GO:0034454 | microtubule anchoring at centrosome |
| 3. B | GO:0060090 | molecular adaptor activity |
| 3. B | GO:0000398 | mRNA splicing, via spliceosome |
| 3. B | GO:0031111 | negative regulation of microtubule polymerization or depolymerization |
| 3. B | GO:0005814 | centriole |
| 3. B | GO:0036494 | positive regulation of translation initiation in response to endoplasmic reticulum stress |
| 3. B | GO:0034452 | dynactin binding |
| 3. B | GO:0031966 | mitochondrial membrane |
| 3. B | GO:0061629 | RNA polymerase II-specific DNA-binding transcription factor binding |
| 3. B | GO:0050681 | androgen receptor binding |
| 3. B | GO:0007286 | spermatid development |
| 3. B | GO:0021591 | ventricular system development |
| 3. B | GO:0080182 | histone H3-K4 trimethylation |
| 3. B | GO:0031503 | protein-containing complex localization |
| 3. B | GO:1900182 | positive regulation of protein localization to nucleus |
| 3. B | GO:0021987 | cerebral cortex development |
| 3. B | GO:0007608 | sensory perception of smell |
| 3. B | GO:0031514 | motile cilium |
| 3. B | GO:0007566 | embryo implantation |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0040024 | dauer larval development |
| 3. B | GO:0005813 | centrosome |
| 3. B | GO:0032991 | protein-containing complex |
| 3. B | GO:0035845 | photoreceptor cell outer segment organization |
| 3. B | GO:0005829 | cytosol |
| 3. B | GO:0045793 | positive regulation of cell size |
| 3. B | GO:0010801 | negative regulation of peptidyl-threonine phosphorylation |
| 3. B | GO:0045842 | positive regulation of mitotic metaphase/anaphase transition |
| 3. B | GO:0005680 | anaphase-promoting complex |
| 3. B | GO:0016607 | nuclear speck |
| 3. B | GO:0001933 | negative regulation of protein phosphorylation |
| 3. B | GO:0019216 | regulation of lipid metabolic process |
| 3. B | GO:0048312 | intracellular distribution of mitochondria |
| 3. B | GO:0070678 | preprotein binding |
| 3. B | GO:0006620 | posttranslational protein targeting to endoplasmic reticulum membrane |
| 3. B | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 3. B | GO:0031359 | integral component of chloroplast outer membrane |
| 3. B | GO:0050893 | sensory processing |
| 3. B | GO:1900034 | regulation of cellular response to heat |
| 3. B | GO:0045724 | positive regulation of cilium assembly |
| 3. B | GO:0035869 | ciliary transition zone |
| 3. B | GO:0061087 | positive regulation of histone H3-K27 methylation |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0046626 | regulation of insulin receptor signaling pathway |
| 3. B | GO:0071333 | cellular response to glucose stimulus |
| 3. B | GO:0030674 | protein-macromolecule adaptor activity |
| 3. B | GO:0043982 | histone H4-K8 acetylation |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8NEE8 | Tetratricopeptide repeat protein 16 | 0 | 4.38e-131 | 0.0 |
| 1. PB | Q8C1F5 | Tetratricopeptide repeat protein 16 | 2.73e-12 | 2.31e-12 | 0.0 |
| 1. PB | Q95LZ5 | Tetratricopeptide repeat protein 16 | 7.83e-11 | 1.20e-85 | 0.0 |
| 2. P | Q5EA11 | Tetratricopeptide repeat protein 4 | 9.47e-03 | 2.58e-02 | NA |
| 2. P | Q8R3H9 | Tetratricopeptide repeat protein 4 | 1.52e-02 | 1.35e-02 | NA |
| 2. P | A2A3L6 | Tetratricopeptide repeat protein 24 | 2.57e-04 | 4.80e-04 | NA |
| 2. P | Q9FKV5 | Protein POLLENLESS 3-LIKE 1 | 6.94e-03 | 5.02e-06 | NA |
| 3. B | Q2KJJ0 | Pre-mRNA-processing factor 6 | 3.92e-04 | NA | 0.034 |
| 3. B | F4KCL7 | Outer envelope protein 64, mitochondrial | 5.09e-02 | NA | 0.042 |
| 3. B | Q49AM3 | Tetratricopeptide repeat protein 31 | 4.93e-03 | NA | 0.010 |
| 3. B | Q4V8A2 | Cell division cycle protein 27 homolog | 4.63e-05 | NA | 0.048 |
| 3. B | Q9D706 | RNA polymerase II-associated protein 3 | 2.49e-03 | NA | 0.018 |
| 3. B | Q96RK4 | Bardet-Biedl syndrome 4 protein | 1.03e-07 | NA | 0.020 |
| 3. B | Q57711 | TPR repeat-containing protein MJ0941 | 4.37e-08 | NA | 6.19e-05 |
| 3. B | Q9LVH5 | Outer envelope protein 64, chloroplastic | 6.76e-02 | NA | 7.23e-04 |
| 3. B | Q86TZ1 | Tetratricopeptide repeat protein 6 | 8.30e-10 | NA | 6.63e-05 |
| 3. B | Q68FQ7 | RNA polymerase II-associated protein 3 | 3.17e-03 | NA | 0.001 |
| 3. B | Q9H6T3 | RNA polymerase II-associated protein 3 | 1.90e-03 | NA | 0.039 |
| 3. B | Q8CGY8 | UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit | 4.03e-05 | NA | 0.012 |
| 3. B | Q64378 | Peptidyl-prolyl cis-trans isomerase FKBP5 | 2.51e-02 | NA | 0.017 |
| 3. B | Q02790 | Peptidyl-prolyl cis-trans isomerase FKBP4 | 6.27e-03 | NA | 0.001 |
| 3. B | O15294 | UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit | 3.94e-05 | NA | 0.013 |
| 3. B | Q5R8D8 | DnaJ homolog subfamily C member 7 | 5.22e-05 | NA | 0.011 |
| 3. B | O18158 | UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase | 5.79e-05 | NA | 0.014 |
| 3. B | P23231 | Mitochondrial import receptor subunit tom70 | 2.30e-06 | NA | 0.014 |
| 3. B | Q5RCC2 | Pre-mRNA-processing factor 6 | 3.30e-05 | NA | 0.040 |
| 3. B | P81436 | UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit | 2.08e-05 | NA | 0.013 |
| 3. B | A1A5S1 | Pre-mRNA-processing factor 6 | 3.18e-04 | NA | 0.014 |
| 3. B | P30416 | Peptidyl-prolyl cis-trans isomerase FKBP4 | 1.35e-02 | NA | 0.035 |
| 3. B | Q9SUT5 | Protein SGT1 homolog B | 1.85e-02 | NA | 8.46e-04 |
| 3. B | Q91YR7 | Pre-mRNA-processing factor 6 | 3.90e-04 | NA | 0.013 |
| 3. B | Q5ZI13 | DnaJ homolog subfamily C member 3 | 2.19e-08 | NA | 0.017 |
| 3. B | Q99615 | DnaJ homolog subfamily C member 7 | 2.81e-05 | NA | 0.006 |
| 3. B | A2A6Q5 | Cell division cycle protein 27 homolog | 5.12e-05 | NA | 0.049 |
| 3. B | Q12118 | Small glutamine-rich tetratricopeptide repeat-containing protein 2 | 7.78e-03 | NA | 0.013 |
| 3. B | Q9QVC8 | Peptidyl-prolyl cis-trans isomerase FKBP4 | 4.29e-03 | NA | 0.022 |
| 3. B | F8RP11 | Hsp70-Hsp90 organizing protein | 4.18e-05 | NA | 0.026 |
| 3. B | Q8C1Z7 | Bardet-Biedl syndrome 4 protein homolog | 1.05e-07 | NA | 0.011 |
| 3. B | Q58741 | TPR repeat-containing protein MJ1345 | 1.23e-08 | NA | 8.55e-04 |
| 3. B | Q9TRY0 | Peptidyl-prolyl cis-trans isomerase FKBP4 | 1.34e-02 | NA | 0.002 |
| 3. B | Q9SUR9 | Protein SGT1 homolog A | 2.17e-02 | NA | 0.020 |
| 3. B | Q07617 | Sperm-associated antigen 1 | 1.06e-03 | NA | 0.021 |
| 3. B | Q27HV0 | UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit | 2.35e-05 | NA | 0.013 |
| 3. B | P56558 | UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit | 1.74e-08 | NA | 0.013 |
| 3. B | P27124 | Peptidyl-prolyl cis-trans isomerase FKBP4 | 4.31e-02 | NA | 0.003 |
| 3. B | F4JS25 | Suppressor of RPS4-RLD 1 | 8.08e-04 | NA | 1.28e-04 |
| 3. B | O13797 | Small glutamine-rich tetratricopeptide repeat-containing protein 2 | 2.61e-03 | NA | 0.024 |
| 3. B | O94906 | Pre-mRNA-processing factor 6 | 1.80e-05 | NA | 0.014 |